F344385

General Info

Members Datasets Scaffolds Average Seq Length
231 149 462 213

Family's Representative Sequence

Representative Sequence 3300046537|Ga0495598_0004214|Ga0495598_0004214_2368_3003
Length 211
Sequence VAAPFDNSIEKNSESLSSHTGEGVVIDIGTGDGRFVSASARANPNKFYIGIDANVKPLEKISMKVTRKKSGLPNALFVQAAVEDLPEELNETADEIHIHFPWGSLLRAVVTGDEEILKNLRRVCAPECLLEIVIGIDEERDRSEIERLALPELSPEYLEKVLIPRYNSAGFDVLESRVLNPVEWSRLETSWARKLQSGSNRKVTYLIFQAS

Samples

Sample ID Description Type Environment
1 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
132 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
133 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
134 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
135 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
136 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.43
Rhizosphere 98.27
Stem 0
Stem Tuber 0
Unclassified 24.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495598_0004214 3300046537 Bacteria 3102
2 JGI24751J29686_10000146 3300002459 Bacteria 34382
3 rootH2_10096123 3300003320 Bacteria 2261
4 Ga0065704_10018447 3300005289 Bacteria 1732
5 Ga0070690_100097659 3300005330 Unclassified 1943
6 Ga0070670_100000057 3300005331 Bacteria 118540
7 Ga0070670_100792596 3300005331 Bacteria 855
8 Ga0068869_101044759 3300005334 Unclassified 713
9 Ga0070680_100007585 3300005336 Bacteria 8276
10 Ga0070680_100954453 3300005336 Unclassified 740
11 Ga0070660_100481348 3300005339 Bacteria 1031
12 Ga0070669_100014025 3300005353 Bacteria 5697
13 Ga0070669_100020238 3300005353 Bacteria 4754
14 Ga0070659_100017453 3300005366 Bacteria 5404
15 Ga0070659_100196804 3300005366 Bacteria 1658
16 Ga0070701_10266869 3300005438 Bacteria 1040
17 Ga0070705_100035585 3300005440 Bacteria 2793
18 Ga0070694_100038090 3300005444 Unclassified 3193
19 Ga0070694_100223069 3300005444 Bacteria 1415
20 Ga0070694_100233711 3300005444 Bacteria 1384
21 Ga0070663_100357490 3300005455 Bacteria 1184
22 Ga0070678_100138258 3300005456 Bacteria 1946
23 Ga0070662_100037095 3300005457 Unclassified 3454
24 Ga0070662_100266637 3300005457 Unclassified 1381
25 Ga0070681_10000383 3300005458 Bacteria 35789
26 Ga0068867_100482114 3300005459 Unclassified 1063
27 Ga0070706_100000002 3300005467 Bacteria 326510
28 Ga0070698_100051636 3300005471 Bacteria 4187
29 Ga0070679_100031766 3300005530 Bacteria 5220
30 Ga0070679_100129428 3300005530 Bacteria 2506
31 Ga0070697_100111768 3300005536 Bacteria 2277
32 Ga0070697_100155485 3300005536 Unclassified 1930
33 Ga0068853_100014002 3300005539 Bacteria 6562
34 Ga0068853_100092662 3300005539 Bacteria 2658
35 Ga0070672_100302477 3300005543 Unclassified 1356
36 Ga0070695_100096676 3300005545 Bacteria 1982
37 Ga0070695_100232188 3300005545 Bacteria 1334
38 Ga0070695_100243733 3300005545 Bacteria 1305
39 Ga0070696_100005965 3300005546 Bacteria 8129
40 Ga0070693_100051997 3300005547 Bacteria 2348
41 Ga0070704_100040040 3300005549 Bacteria 3222
42 Ga0070704_100065686 3300005549 Bacteria 2613
43 Ga0068855_100024502 3300005563 Bacteria 7220
44 Ga0068855_100329098 3300005563 Bacteria 1687
45 Ga0070664_100006240 3300005564 Bacteria 9627
46 Ga0070664_100016422 3300005564 Bacteria 6069
47 Ga0068857_100004334 3300005577 Bacteria 11974
48 Ga0068857_100053006 3300005577 Unclassified 3599
49 Ga0068856_101135796 3300005614 Unclassified 798
50 Ga0070702_100223897 3300005615 Bacteria 1260
51 Ga0070702_100270465 3300005615 Bacteria 1162
52 Ga0068852_100217172 3300005616 Bacteria 1817
53 Ga0068852_101210967 3300005616 Bacteria 776
54 Ga0068859_100406588 3300005617 Bacteria 1457
55 Ga0068859_101260116 3300005617 Bacteria 815
56 Ga0068864_100042367 3300005618 Unclassified 3896
57 Ga0068864_100076848 3300005618 Bacteria 2918
58 Ga0068870_10007340 3300005840 Bacteria 4911
59 Ga0068870_10248903 3300005840 Bacteria 1101
60 Ga0068870_10545662 3300005840 Bacteria 780
61 Ga0068863_100251369 3300005841 Unclassified 1708
62 Ga0068858_100038570 3300005842 Unclassified 4432
63 Ga0068860_100076233 3300005843 Bacteria 3189
64 Ga0068860_100199515 3300005843 Bacteria 1938
65 Ga0068860_100294967 3300005843 Bacteria 1587
66 Ga0068862_100085954 3300005844 Bacteria 2733
67 Ga0068862_100228684 3300005844 Bacteria 1686
68 Ga0068862_100995014 3300005844 Bacteria 829
69 Ga0081539_10000931 3300005985 Bacteria 54965
70 Ga0097621_100160791 3300006237 Unclassified 1930
71 Ga0075428_100000404 3300006844 Bacteria 42859
72 Ga0075428_100404876 3300006844 Bacteria 1462
73 Ga0075428_100479301 3300006844 Bacteria 1332
74 Ga0075428_100660129 3300006844 Unclassified 1115
75 Ga0075430_100154406 3300006846 Bacteria 1911
76 Ga0075431_100173743 3300006847 Unclassified 2213
77 Ga0075431_100272649 3300006847 Bacteria 1714
78 Ga0075431_100620023 3300006847 Bacteria 1064
79 Ga0075431_100712806 3300006847 Bacteria 980
80 Ga0075431_100828587 3300006847 Bacteria 897
81 Ga0075433_10062414 3300006852 Unclassified 3263
82 Ga0075434_100405425 3300006871 Bacteria 1384
83 Ga0075434_100440739 3300006871 Unclassified 1324
84 Ga0075434_100684602 3300006871 Bacteria 1043
85 Ga0075429_100016995 3300006880 Bacteria 6290
86 Ga0075429_100157923 3300006880 Bacteria 1986
87 Ga0068865_100244146 3300006881 Bacteria 1414
88 Ga0097620_100406577 3300006931 Bacteria 1457
89 Ga0097620_101259982 3300006931 Bacteria 815
90 Ga0111539_10103224 3300009094 Bacteria 3346
91 Ga0114129_10004420 3300009147 Bacteria 19834
92 Ga0114129_10010234 3300009147 Bacteria 13379
93 Ga0114129_10019147 3300009147 Bacteria 9750
94 Ga0114129_10044644 3300009147 Bacteria 6234
95 Ga0105243_10298577 3300009148 Bacteria 1459
96 Ga0105241_10017240 3300009174 Bacteria 5306
97 Ga0105241_10193446 3300009174 Bacteria 1694
98 Ga0105237_10001367 3300009545 Bacteria 32226
99 Ga0105237_10200140 3300009545 Bacteria 1997
100 Ga0105238_10005324 3300009551 Bacteria 12714
101 Ga0105249_10125743 3300009553 Bacteria 2441
102 Ga0105239_10657170 3300010375 Bacteria 1197
103 Ga0105246_10488616 3300011119 Unclassified 1043
104 Ga0157373_10004056 3300013100 Bacteria 11035
105 Ga0157373_10061408 3300013100 Bacteria 2662
106 Ga0157370_10374760 3300013104 Bacteria 1311
107 Ga0163162_10004325 3300013306 Bacteria 13676
108 Ga0163162_10104842 3300013306 Unclassified 2922
109 Ga0157372_10120408 3300013307 Bacteria 3014
110 Ga0157372_10135779 3300013307 Bacteria 2832
111 Ga0157372_10346839 3300013307 Bacteria 1730
112 Ga0157372_11673470 3300013307 Bacteria 732
113 Ga0163163_10000184 3300014325 Bacteria 64203
114 Ga0163163_10080091 3300014325 Unclassified 3265
115 Ga0163163_10106792 3300014325 Bacteria 2826
116 Ga0157380_10006972 3300014326 Bacteria 7997
117 Ga0157380_10139094 3300014326 Bacteria 2083
118 Ga0157376_10597372 3300014969 Bacteria 1098
119 Ga0157376_11045331 3300014969 Bacteria 841
120 Ga0163161_10363937 3300017792 Bacteria 1152
121 Ga0207653_10122797 3300025885 Unclassified 936
122 Ga0207688_10090947 3300025901 Bacteria 1752
123 Ga0207647_10171780 3300025904 Bacteria 1262
124 Ga0207643_10105571 3300025908 Bacteria 1655
125 Ga0207643_10276594 3300025908 Bacteria 1040
126 Ga0207684_10000076 3300025910 Bacteria 183107
127 Ga0207684_10137616 3300025910 Bacteria 2098
128 Ga0207707_10380584 3300025912 Bacteria 1213
129 Ga0207660_10133653 3300025917 Unclassified 1891
130 Ga0207660_10161886 3300025917 Bacteria 1727
131 Ga0207662_10216895 3300025918 Unclassified 1244
132 Ga0207657_10374136 3300025919 Unclassified 1122
133 Ga0207657_10516566 3300025919 Bacteria 935
134 Ga0207649_10065341 3300025920 Bacteria 2302
135 Ga0207652_10058111 3300025921 Unclassified 3332
136 Ga0207652_10214797 3300025921 Bacteria 1732
137 Ga0207646_10115897 3300025922 Bacteria 2406
138 Ga0207681_10005403 3300025923 Bacteria 7848
139 Ga0207681_10166777 3300025923 Bacteria 1665
140 Ga0207694_10002866 3300025924 Bacteria 13882
141 Ga0207694_10668226 3300025924 Unclassified 876
142 Ga0207650_10000027 3300025925 Bacteria 257466
143 Ga0207659_10551852 3300025926 Bacteria 979
144 Ga0207690_10015233 3300025932 Bacteria 4656
145 Ga0207706_10009885 3300025933 Bacteria 8749
146 Ga0207709_10031020 3300025935 Unclassified 3116
147 Ga0207689_10303603 3300025942 Unclassified 1323
148 Ga0207679_10020078 3300025945 Bacteria 4504
149 Ga0207667_10941368 3300025949 Bacteria 854
150 Ga0207712_10073876 3300025961 Bacteria 2461
151 Ga0207712_10970076 3300025961 Unclassified 753
152 Ga0207703_10969652 3300026035 Unclassified 815
153 Ga0207639_10036712 3300026041 Bacteria 3633
154 Ga0207639_10072349 3300026041 Unclassified 2699
155 Ga0207702_10197323 3300026078 Bacteria 1864
156 Ga0207641_10621824 3300026088 Bacteria 1059
157 Ga0207648_10054548 3300026089 Bacteria 3491
158 Ga0207648_10177543 3300026089 Unclassified 1884
159 Ga0207648_10357533 3300026089 Bacteria 1317
160 Ga0207676_10063743 3300026095 Bacteria 2928
161 Ga0207676_10129596 3300026095 Bacteria 2142
162 Ga0207676_10698972 3300026095 Unclassified 982
163 Ga0207674_10000054 3300026116 Bacteria 114198
164 Ga0207674_10003636 3300026116 Bacteria 18800
165 Ga0207674_10126742 3300026116 Bacteria 2518
166 Ga0207675_100043336 3300026118 Unclassified 4202
167 Ga0207683_10244837 3300026121 Bacteria 1636
168 Ga0207698_10191915 3300026142 Bacteria 1821
169 Ga0207428_10002257 3300027907 Bacteria 19352
170 Ga0268265_10069783 3300028380 Unclassified 2730
171 Ga0268264_10208738 3300028381 Bacteria 1791
172 Ga0268264_10570618 3300028381 Unclassified 1112
173 Ga0307408_100015843 3300031548 Bacteria 5023
174 Ga0307408_100757349 3300031548 Bacteria 878
175 Ga0307405_10071587 3300031731 Unclassified 2231
176 Ga0307413_10036178 3300031824 Unclassified 2840
177 Ga0307410_10007433 3300031852 Bacteria 5996
178 Ga0307406_10037471 3300031901 Unclassified 2995
179 Ga0307406_10721293 3300031901 Bacteria 834
180 Ga0307407_10037242 3300031903 Unclassified 2686
181 Ga0307407_10114243 3300031903 Bacteria 1701
182 Ga0307412_10026420 3300031911 Bacteria 3608
183 Ga0307409_100006434 3300031995 Bacteria 6903
184 Ga0307409_101410230 3300031995 Bacteria 723
185 Ga0307416_100008206 3300032002 Bacteria 6714
186 Ga0307414_10007846 3300032004 Bacteria 6020
187 Ga0307411_10138364 3300032005 Bacteria 1792
188 Ga0307415_100005645 3300032126 Bacteria 6662
189 Ga0373940_0013812 3300035088 Bacteria 1962
190 Ga0395900_0238427 3300037418 Bacteria 1826
191 Ga0395898_0396565 3300037466 Unclassified 1316
192 Ga0395898_0718382 3300037466 Bacteria 941
193 Ga0395901_0492645 3300038443 Unclassified 1249
194 Ga0242420_000511 3300038996 Bacteria 4445
195 Ga0436365_0332862 3300039437 Unclassified 1856
196 Ga0436365_1695354 3300039437 Bacteria 2980
197 Ga0451576_0726224 3300045051 Unclassified 1044
198 Ga0496112_0209305 3300048915 Bacteria 1908
199 Ga0501041_0023180 3300049577 Unclassified 3722
200 Ga0501042_0131355 3300049578 Bacteria 1805
201 Ga0501075_0017905 3300049591 Bacteria 5119
202 Ga0501076_0005884 3300049592 Bacteria 8846
203 Ga0501077_0097518 3300049593 Bacteria 1863
204 Ga0501198_023437 3300049649 Unclassified 994
205 Ga0501227_049913 3300049665 Bacteria 1053
206 Ga0501235_044268 3300049669 Unclassified 1022
207 Ga0501249_061090 3300049679 Bacteria 873
208 Ga0501259_018690 3300049688 Unclassified 1213
209 Ga0501234_029141 3300049707 Unclassified 889
210 Ga0501081_0131356 3300049743 Bacteria 1789
211 Ga0501268_023609 3300049765 Bacteria 1069
212 Ga0501045_0138728 3300049824 Bacteria 1808
213 nmdc:mga05p37_119_c1 3300050507 Bacteria 71161
214 nmdc:mga05p37_222706_c1 3300050507 Unclassified 2276
215 nmdc:mga05p37_41449_c1 3300050507 Bacteria 5652
216 nmdc:mga05p37_69496_c1 3300050507 Bacteria 4332
217 nmdc:mga0qj67_386050_c1 3300050509 Unclassified 1131
218 nmdc:mga0qj67_437444_c1 3300050509 Unclassified 1054
219 nmdc:mga06r32_101332_c1 3300050510 Bacteria 2826
220 nmdc:mga06r32_153707_c1 3300050510 Bacteria 2281
221 nmdc:mga06r32_866134_c1 3300050510 Bacteria 861
222 nmdc:mga08y16_1036866_c1 3300050511 Bacteria 798
223 nmdc:mga08y16_197711_c1 3300050511 Bacteria 2084
224 nmdc:mga08y16_401028_c1 3300050511 Bacteria 1404
225 nmdc:mga08y16_828066_c1 3300050511 Unclassified 916
226 nmdc:mga0n895_618597_c1 3300050512 Bacteria 1084
227 nmdc:mga08x19_5078_c1 3300050514 Bacteria 7781
228 nmdc:mga0a205_469741_c1 3300050515 Bacteria 1117
229 Ga0501084_0049412 3300054114 Unclassified 3521
230 Ga0501082_0016205 3300060353 Bacteria 6415
231 Ga0530510_0207485 3300061734 Bacteria 1456
232 Ga0495598_0004214
233 JGI24751J29686_10000146
234 rootH2_10096123
235 Ga0065704_10018447
236 Ga0070690_100097659
237 Ga0070670_100000057
238 Ga0070670_100792596
239 Ga0068869_101044759
240 Ga0070680_100007585
241 Ga0070680_100954453
242 Ga0070660_100481348
243 Ga0070669_100014025
244 Ga0070669_100020238
245 Ga0070659_100017453
246 Ga0070659_100196804
247 Ga0070701_10266869
248 Ga0070705_100035585
249 Ga0070694_100038090
250 Ga0070694_100223069
251 Ga0070694_100233711
252 Ga0070663_100357490
253 Ga0070678_100138258
254 Ga0070662_100037095
255 Ga0070662_100266637
256 Ga0070681_10000383
257 Ga0068867_100482114
258 Ga0070706_100000002
259 Ga0070698_100051636
260 Ga0070679_100031766
261 Ga0070679_100129428
262 Ga0070697_100111768
263 Ga0070697_100155485
264 Ga0068853_100014002
265 Ga0068853_100092662
266 Ga0070672_100302477
267 Ga0070695_100096676
268 Ga0070695_100232188
269 Ga0070695_100243733
270 Ga0070696_100005965
271 Ga0070693_100051997
272 Ga0070704_100040040
273 Ga0070704_100065686
274 Ga0068855_100024502
275 Ga0068855_100329098
276 Ga0070664_100006240
277 Ga0070664_100016422
278 Ga0068857_100004334
279 Ga0068857_100053006
280 Ga0068856_101135796
281 Ga0070702_100223897
282 Ga0070702_100270465
283 Ga0068852_100217172
284 Ga0068852_101210967
285 Ga0068859_100406588
286 Ga0068859_101260116
287 Ga0068864_100042367
288 Ga0068864_100076848
289 Ga0068870_10007340
290 Ga0068870_10248903
291 Ga0068870_10545662
292 Ga0068863_100251369
293 Ga0068858_100038570
294 Ga0068860_100076233
295 Ga0068860_100199515
296 Ga0068860_100294967
297 Ga0068862_100085954
298 Ga0068862_100228684
299 Ga0068862_100995014
300 Ga0081539_10000931
301 Ga0097621_100160791
302 Ga0075428_100000404
303 Ga0075428_100404876
304 Ga0075428_100479301
305 Ga0075428_100660129
306 Ga0075430_100154406
307 Ga0075431_100173743
308 Ga0075431_100272649
309 Ga0075431_100620023
310 Ga0075431_100712806
311 Ga0075431_100828587
312 Ga0075433_10062414
313 Ga0075434_100405425
314 Ga0075434_100440739
315 Ga0075434_100684602
316 Ga0075429_100016995
317 Ga0075429_100157923
318 Ga0068865_100244146
319 Ga0097620_100406577
320 Ga0097620_101259982
321 Ga0111539_10103224
322 Ga0114129_10004420
323 Ga0114129_10010234
324 Ga0114129_10019147
325 Ga0114129_10044644
326 Ga0105243_10298577
327 Ga0105241_10017240
328 Ga0105241_10193446
329 Ga0105237_10001367
330 Ga0105237_10200140
331 Ga0105238_10005324
332 Ga0105249_10125743
333 Ga0105239_10657170
334 Ga0105246_10488616
335 Ga0157373_10004056
336 Ga0157373_10061408
337 Ga0157370_10374760
338 Ga0163162_10004325
339 Ga0163162_10104842
340 Ga0157372_10120408
341 Ga0157372_10135779
342 Ga0157372_10346839
343 Ga0157372_11673470
344 Ga0163163_10000184
345 Ga0163163_10080091
346 Ga0163163_10106792
347 Ga0157380_10006972
348 Ga0157380_10139094
349 Ga0157376_10597372
350 Ga0157376_11045331
351 Ga0163161_10363937
352 Ga0207653_10122797
353 Ga0207688_10090947
354 Ga0207647_10171780
355 Ga0207643_10105571
356 Ga0207643_10276594
357 Ga0207684_10000076
358 Ga0207684_10137616
359 Ga0207707_10380584
360 Ga0207660_10133653
361 Ga0207660_10161886
362 Ga0207662_10216895
363 Ga0207657_10374136
364 Ga0207657_10516566
365 Ga0207649_10065341
366 Ga0207652_10058111
367 Ga0207652_10214797
368 Ga0207646_10115897
369 Ga0207681_10005403
370 Ga0207681_10166777
371 Ga0207694_10002866
372 Ga0207694_10668226
373 Ga0207650_10000027
374 Ga0207659_10551852
375 Ga0207690_10015233
376 Ga0207706_10009885
377 Ga0207709_10031020
378 Ga0207689_10303603
379 Ga0207679_10020078
380 Ga0207667_10941368
381 Ga0207712_10073876
382 Ga0207712_10970076
383 Ga0207703_10969652
384 Ga0207639_10036712
385 Ga0207639_10072349
386 Ga0207702_10197323
387 Ga0207641_10621824
388 Ga0207648_10054548
389 Ga0207648_10177543
390 Ga0207648_10357533
391 Ga0207676_10063743
392 Ga0207676_10129596
393 Ga0207676_10698972
394 Ga0207674_10000054
395 Ga0207674_10003636
396 Ga0207674_10126742
397 Ga0207675_100043336
398 Ga0207683_10244837
399 Ga0207698_10191915
400 Ga0207428_10002257
401 Ga0268265_10069783
402 Ga0268264_10208738
403 Ga0268264_10570618
404 Ga0307408_100015843
405 Ga0307408_100757349
406 Ga0307405_10071587
407 Ga0307413_10036178
408 Ga0307410_10007433
409 Ga0307406_10037471
410 Ga0307406_10721293
411 Ga0307407_10037242
412 Ga0307407_10114243
413 Ga0307412_10026420
414 Ga0307409_100006434
415 Ga0307409_101410230
416 Ga0307416_100008206
417 Ga0307414_10007846
418 Ga0307411_10138364
419 Ga0307415_100005645
420 Ga0373940_0013812
421 Ga0395900_0238427
422 Ga0395898_0396565
423 Ga0395898_0718382
424 Ga0395901_0492645
425 Ga0242420_000511
426 Ga0436365_0332862
427 Ga0436365_1695354
428 Ga0451576_0726224
429 Ga0496112_0209305
430 Ga0501041_0023180
431 Ga0501042_0131355
432 Ga0501075_0017905
433 Ga0501076_0005884
434 Ga0501077_0097518
435 Ga0501198_023437
436 Ga0501227_049913
437 Ga0501235_044268
438 Ga0501249_061090
439 Ga0501259_018690
440 Ga0501234_029141
441 Ga0501081_0131356
442 Ga0501268_023609
443 Ga0501045_0138728
444 nmdc:mga05p37_119_c1
445 nmdc:mga05p37_222706_c1
446 nmdc:mga05p37_41449_c1
447 nmdc:mga05p37_69496_c1
448 nmdc:mga0qj67_386050_c1
449 nmdc:mga0qj67_437444_c1
450 nmdc:mga06r32_101332_c1
451 nmdc:mga06r32_153707_c1
452 nmdc:mga06r32_866134_c1
453 nmdc:mga08y16_1036866_c1
454 nmdc:mga08y16_197711_c1
455 nmdc:mga08y16_401028_c1
456 nmdc:mga08y16_828066_c1
457 nmdc:mga0n895_618597_c1
458 nmdc:mga08x19_5078_c1
459 nmdc:mga0a205_469741_c1
460 Ga0501084_0049412
461 Ga0501082_0016205
462 Ga0530510_0207485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24675

7

210

0.95

PF02390

Methyltransf_4

Putative methyltransferase

22

102

0.92

PF13847

Methyltransf_31

Methyltransferase domain

19

148

0.85

PF08241

Methyltransf_11

Methyltransferase domain

26

132

0.83

PF13649

Methyltransf_25

Methyltransferase domain

25

127

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ox9-assembly1.cif.gz_Y crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit 0.9069 20 204
7ehf-assembly1.cif.gz_A crystal structure of the aminoglycoside resistance methyltransferase npmb1 0.8733 19 204
5bw4-assembly2.cif.gz_B crystal structure of the 16s rrna (adenine(1408)-n(1))-methyltransferase w203a mutant with cosubstrate sam from catenulisporales acidiphilia 0.8662 20 208
5bw5-assembly1.cif.gz_A crystal structure of the 16s rrna (adenine(1408)-n(1))-methyltransferase d21a mutant from catenulisporales acidiphilia 0.8616 20 205
3p2k-assembly3.cif.gz_C structure of an antibiotic related methyltransferase 0.8607 20 203
ID Description Score Start End Superfamily
5d1hA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8597 20 205 3.40.50.150
3mq2B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8484 20 205 3.40.50.150
4rwzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8411 19 205 3.40.50.150
3p2iA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8318 20 205 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.776 16 139 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7V8Z7K0-F1-model_v4 rRNA methyltransferase 0.9338 62 205
AF-A0A151EJI4-F1-model_v4 Methyltransferase domain-containing protein 0.9274 20 205 GO:0008176
AF-A0A3D0P984-F1-model_v4 rRNA methyltransferase 0.9227 38 138 GO:0008168
GO:0032259
AF-A0A838RSU1-F1-model_v4 Methyltransferase domain-containing protein 0.9223 20 210 GO:0008176
AF-A8C927-F1-model_v4 16S rRNA (adenine(1408)-N(1))-methyltransferase (EC 2.1.1.180) (16S rRNA m1A1408 methyltransferase) 0.9187 20 205 GO:0008168
GO:0032259
GO:0046677

Map