F344322

General Info

Members Datasets Scaffolds Average Seq Length
231 119 462 130

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0519242|Ga0466970_0519242_109_540
Length 143
Sequence MWCHHIHLEVPMTLTGTGIRALNLVCVGTPDQDKAVAFYESLGFEKRTDEPFGGGYRWIEVYPPEGTTGIALAPPAPGGEPVEPAQTGITLTTTDIDATHAAMKALGVDVDAEVSRMGAPVPPLFWFRDPTGHTLMVVEVEES

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
19 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
20 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
21 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
30 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
31 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
32 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
42 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
43 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
44 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
45 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
46 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
47 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
48 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
49 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
50 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
51 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
52 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
53 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
54 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
55 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
56 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
57 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
58 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
59 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
62 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
63 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
66 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
67 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
68 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
69 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
70 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
71 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
72 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
73 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
74 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
75 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
76 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
77 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
78 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
79 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
80 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
81 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
82 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
83 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
84 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
85 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
86 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
87 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
101 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
102 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
103 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
104 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
118 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
119 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.81
Metatranscriptomes 5.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.79
Rhizosphere 77.92
Stem 0
Stem Tuber 0
Unclassified 3.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0519242 3300044765 Bacteria 687
2 rootH2_10164621 3300003320 Bacteria 1662
3 Ga0070661_101171096 3300005344 Bacteria 642
4 Ga0070669_101395692 3300005353 Bacteria 608
5 Ga0070709_10064547 3300005434 Bacteria 2342
6 Ga0070714_100041806 3300005435 Bacteria 3870
7 Ga0070714_100091526 3300005435 Bacteria 2665
8 Ga0070714_100163311 3300005435 Bacteria 2016
9 Ga0070714_100899540 3300005435 Bacteria 859
10 Ga0070714_100900894 3300005435 Bacteria 859
11 Ga0070714_101932914 3300005435 Bacteria 576
12 Ga0070713_100142165 3300005436 Bacteria 2127
13 Ga0070713_100275926 3300005436 Bacteria 1541
14 Ga0070713_100404909 3300005436 Bacteria 1275
15 Ga0070710_10009334 3300005437 Bacteria 4797
16 Ga0070706_100930108 3300005467 Bacteria 803
17 Ga0070698_101032518 3300005471 Bacteria 770
18 Ga0070684_102132005 3300005535 Bacteria 529
19 Ga0070665_100155596 3300005548 Bacteria 2288
20 Ga0068855_101688299 3300005563 Bacteria 646
21 Ga0068854_100521941 3300005578 Bacteria 1003
22 Ga0070717_10021008 3300006028 Bacteria 5142
23 Ga0070717_10204847 3300006028 Bacteria 1729
24 Ga0070717_10248493 3300006028 Bacteria 1571
25 Ga0070717_10706886 3300006028 Bacteria 916
26 Ga0070717_11634856 3300006028 Bacteria 583
27 Ga0070715_10329594 3300006163 Bacteria 827
28 Ga0070712_100071774 3300006175 Bacteria 2478
29 Ga0070712_100545981 3300006175 Bacteria 976
30 Ga0070712_100930733 3300006175 Bacteria 750
31 Ga0157373_10588220 3300013100 Bacteria 809
32 Ga0157369_10544396 3300013105 Bacteria 1200
33 Ga0157369_11048398 3300013105 Bacteria 834
34 Ga0157369_12072225 3300013105 Bacteria 577
35 Ga0157372_10310543 3300013307 Bacteria 1835
36 Ga0157372_11017507 3300013307 Unclassified 959
37 Ga0197907_10949875 3300020069 Bacteria 760
38 Ga0206356_10625693 3300020070 Bacteria 511
39 Ga0206349_1258016 3300020075 Bacteria 501
40 Ga0206351_10570522 3300020077 Bacteria 1724
41 Ga0206350_10517163 3300020080 Bacteria 661
42 Ga0206350_11505245 3300020080 Bacteria 1121
43 Ga0206354_11274444 3300020081 Bacteria 563
44 Ga0206353_11108147 3300020082 Bacteria 951
45 Ga0154015_1448589 3300020610 Unclassified 1122
46 Ga0213874_10026900 3300021377 Bacteria 1633
47 Ga0213874_10043621 3300021377 Bacteria 1351
48 Ga0213876_10036928 3300021384 Bacteria 2577
49 Ga0213876_10344933 3300021384 Bacteria 792
50 Ga0213875_10015965 3300021388 Bacteria 3648
51 Ga0213875_10042784 3300021388 Unclassified 2127
52 Ga0224712_10411634 3300022467 Bacteria 645
53 Ga0224712_10547058 3300022467 Bacteria 562
54 Ga0224712_10678034 3300022467 Bacteria 506
55 Ga0207692_10510164 3300025898 Bacteria 764
56 Ga0207692_10633191 3300025898 Bacteria 690
57 Ga0207685_10053076 3300025905 Bacteria 1573
58 Ga0207699_10067303 3300025906 Bacteria 2177
59 Ga0207671_10246749 3300025914 Bacteria 1403
60 Ga0207693_10002813 3300025915 Bacteria 15077
61 Ga0207700_10188231 3300025928 Bacteria 1733
62 Ga0207700_10230769 3300025928 Bacteria 1573
63 Ga0207700_10270034 3300025928 Bacteria 1459
64 Ga0207664_10035623 3300025929 Bacteria 3841
65 Ga0207664_10063052 3300025929 Bacteria 2962
66 Ga0207664_10475857 3300025929 Bacteria 1117
67 Ga0207664_10625225 3300025929 Bacteria 967
68 Ga0207664_10958896 3300025929 Bacteria 767
69 Ga0207664_11194111 3300025929 Bacteria 679
70 Ga0207679_11172725 3300025945 Bacteria 705
71 Ga0373934_0165416 3300035086 Bacteria 908
72 Ga0373923_0480371 3300035111 Bacteria 605
73 Ga0373955_0194471 3300035172 Bacteria 1207
74 Ga0373937_0007807 3300036401 Bacteria 9277
75 Ga0436364_0277923 3300037853 Bacteria 7902
76 Ga0436364_0557675 3300037853 Bacteria 20536
77 Ga0436364_0657103 3300037853 Bacteria 3192
78 Ga0436364_0872455 3300037853 Bacteria 1364
79 Ga0436364_1048478 3300037853 Bacteria 2116
80 Ga0436364_1207749 3300037853 Bacteria 538
81 Ga0436364_1307626 3300037853 Bacteria 5066
82 Ga0436365_0491262 3300039437 Bacteria 5187
83 Ga0436365_0586044 3300039437 Bacteria 9308
84 Ga0436365_0998738 3300039437 Bacteria 5372
85 Ga0436365_1208184 3300039437 Bacteria 19667
86 Ga0436360_1200462 3300039438 Bacteria 665
87 Ga0436363_0451087 3300039450 Bacteria 7459
88 Ga0436363_0485390 3300039450 Unclassified 849
89 Ga0436363_1047278 3300039450 Bacteria 530
90 Ga0436363_1450478 3300039450 Bacteria 1258
91 Ga0436363_1579310 3300039450 Unclassified 1031
92 Ga0436363_1613927 3300039450 Archaea 957
93 Ga0436362_0258418 3300039453 Bacteria 3478
94 Ga0436362_0833982 3300039453 Bacteria 539
95 Ga0436362_0997746 3300039453 Unclassified 3567
96 Ga0451791_0194571 3300041451 Unclassified 612
97 Ga0451849_1247865 3300041505 Bacteria 658
98 Ga0466969_0035765 3300044656 Bacteria 2511
99 Ga0466969_0046274 3300044656 Bacteria 2158
100 Ga0466969_0294387 3300044656 Bacteria 735
101 Ga0466972_0256001 3300044658 Bacteria 818
102 Ga0466966_0008398 3300044684 Bacteria 6836
103 Ga0466966_0086139 3300044684 Bacteria 1953
104 Ga0466966_0134380 3300044684 Bacteria 1513
105 Ga0466966_0305807 3300044684 Bacteria 955
106 Ga0466961_0009779 3300044693 Bacteria 6104
107 Ga0466961_0015464 3300044693 Bacteria 4897
108 Ga0466961_0016225 3300044693 Bacteria 4783
109 Ga0466961_0039163 3300044693 Bacteria 3039
110 Ga0466961_0205877 3300044693 Bacteria 1216
111 Ga0466961_0304575 3300044693 Bacteria 973
112 Ga0466961_0856116 3300044693 Bacteria 542
113 Ga0466963_0020492 3300044694 Bacteria 4158
114 Ga0466963_0037399 3300044694 Bacteria 3169
115 Ga0466963_0041452 3300044694 Bacteria 3020
116 Ga0466963_0074359 3300044694 Bacteria 2291
117 Ga0466963_0393331 3300044694 Bacteria 977
118 Ga0466963_0634877 3300044694 Bacteria 754
119 Ga0466963_0777280 3300044694 Bacteria 675
120 Ga0466963_1342217 3300044694 Bacteria 502
121 Ga0466964_0517404 3300044706 Bacteria 643
122 Ga0466964_0850271 3300044706 Bacteria 519
123 Ga0466964_0869641 3300044706 Bacteria 514
124 Ga0466971_0029754 3300044719 Bacteria 2443
125 Ga0466971_0238398 3300044719 Bacteria 865
126 Ga0466971_0344063 3300044719 Bacteria 721
127 Ga0466971_0403741 3300044719 Bacteria 666
128 Ga0466968_0032546 3300044735 Bacteria 2170
129 Ga0466970_0040610 3300044765 Bacteria 2471
130 Ga0466970_0064858 3300044765 Bacteria 1959
131 Ga0466970_0094286 3300044765 Bacteria 1626
132 Ga0466957_0142629 3300044842 Bacteria 1544
133 Ga0466957_0190327 3300044842 Bacteria 1344
134 Ga0466960_0241869 3300044901 Bacteria 1000
135 Ga0466960_0371815 3300044901 Bacteria 819
136 Ga0466960_0483890 3300044901 Bacteria 723
137 Ga0466959_0005160 3300045049 Bacteria 8899
138 Ga0466959_0047392 3300045049 Bacteria 3161
139 Ga0466959_0075041 3300045049 Bacteria 2444
140 Ga0466959_0114097 3300045049 Bacteria 1926
141 Ga0466959_0156472 3300045049 Bacteria 1604
142 Ga0466959_1068162 3300045049 Unclassified 537
143 Ga0466959_1071039 3300045049 Bacteria 536
144 Ga0466958_0031111 3300045836 Bacteria 3172
145 Ga0466958_0060781 3300045836 Bacteria 2300
146 Ga0466958_0238231 3300045836 Bacteria 1162
147 Ga0466958_0256684 3300045836 Bacteria 1119
148 Ga0466958_0513618 3300045836 Bacteria 778
149 Ga0466958_0559288 3300045836 Bacteria 743
150 Ga0466958_0560029 3300045836 Bacteria 743
151 Ga0466958_1005535 3300045836 Bacteria 544
152 Ga0466967_0000612 3300045976 Bacteria 17825
153 Ga0466967_0002859 3300045976 Bacteria 10966
154 Ga0466967_0005775 3300045976 Bacteria 8650
155 Ga0466967_0108223 3300045976 Bacteria 2550
156 Ga0466967_0157615 3300045976 Bacteria 2128
157 Ga0466967_0386624 3300045976 Bacteria 1359
158 Ga0466967_0388381 3300045976 Bacteria 1356
159 Ga0466967_0574982 3300045976 Bacteria 1110
160 Ga0466967_0612590 3300045976 Bacteria 1075
161 Ga0495592_0003913 3300046454 Bacteria 10782
162 Ga0495651_0021606 3300046462 Bacteria 5002
163 Ga0495653_0219312 3300046463 Bacteria 1279
164 Ga0495662_0166013 3300046476 Bacteria 1088
165 Ga0495664_0187507 3300046477 Bacteria 1254
166 Ga0495608_0008891 3300046511 Bacteria 7021
167 Ga0495608_0909936 3300046511 Bacteria 515
168 Ga0495618_0198825 3300046514 Bacteria 1269
169 Ga0495628_0004542 3300046516 Bacteria 12294
170 Ga0495628_0028144 3300046516 Bacteria 4570
171 Ga0495630_0084811 3300046517 Bacteria 2391
172 Ga0495587_0055936 3300046536 Bacteria 2322
173 Ga0495667_0012925 3300046559 Bacteria 5658
174 Ga0495634_0036919 3300046642 Bacteria 3340
175 Ga0495635_0021934 3300046663 Bacteria 4450
176 Ga0495657_0044145 3300046675 Bacteria 3034
177 Ga0495600_0006155 3300046809 Bacteria 7274
178 Ga0495581_0414820 3300047315 Bacteria 785
179 Ga0495604_0361585 3300047317 Bacteria 962
180 Ga0495674_0462730 3300047319 Bacteria 1018
181 Ga0495680_0002500 3300047322 Bacteria 18803
182 Ga0495675_0032486 3300047444 Bacteria 3331
183 Ga0495684_0067615 3300047471 Bacteria 2717
184 Ga0495684_0177140 3300047471 Bacteria 1582
185 Ga0495602_0010648 3300048088 Bacteria 9539
186 Ga0495602_0533526 3300048088 Bacteria 816
187 Ga0495614_0431827 3300048089 Bacteria 622
188 Ga0496101_1093832 3300048904 Bacteria 626
189 Ga0496102_0232175 3300048905 Bacteria 1739
190 Ga0496103_0181191 3300048906 Bacteria 1354
191 Ga0496104_0021014 3300048907 Bacteria 5989
192 Ga0496105_0136563 3300048908 Bacteria 2020
193 Ga0496108_1614471 3300048911 Bacteria 536
194 Ga0496109_0002784 3300048912 Bacteria 14654
195 Ga0496109_0366871 3300048912 Bacteria 1360
196 Ga0496109_1738229 3300048912 Bacteria 557
197 Ga0496110_0148412 3300048913 Bacteria 2122
198 Ga0496112_0054725 3300048915 Bacteria 3922
199 Ga0496113_0021541 3300048916 Bacteria 4548
200 Ga0496113_1044822 3300048916 Bacteria 642
201 Ga0496114_0211917 3300048917 Bacteria 1699
202 Ga0496114_0774741 3300048917 Bacteria 837
203 Ga0496115_0029291 3300048918 Bacteria 4323
204 Ga0496115_0905509 3300048918 Bacteria 680
205 Ga0496116_0003716 3300048919 Bacteria 14925
206 Ga0496117_0008217 3300048920 Bacteria 9951
207 Ga0496118_0013412 3300048921 Bacteria 7755
208 Ga0496119_0018209 3300048922 Bacteria 5244
209 Ga0496120_0063503 3300048923 Bacteria 2054
210 Ga0496124_0452477 3300048927 Bacteria 875
211 Ga0496126_0032338 3300048929 Bacteria 4929
212 Ga0496126_0393283 3300048929 Bacteria 1126
213 Ga0501032_0049351 3300049569 Bacteria 2839
214 Ga0501033_0052412 3300049570 Bacteria 3024
215 Ga0501034_0024183 3300049571 Bacteria 6179
216 Ga0501036_0915460 3300049572 Bacteria 719
217 Ga0501038_0553373 3300049574 Bacteria 875
218 Ga0501047_0234140 3300049581 Bacteria 1689
219 Ga0501047_0668319 3300049581 Bacteria 857
220 Ga0501070_0669535 3300049586 Bacteria 823
221 Ga0501080_0150703 3300049742 Bacteria 2150
222 Ga0501035_0000218 3300049822 Bacteria 68475
223 Ga0501035_0270578 3300049822 Bacteria 1438
224 Ga0501044_0000639 3300049823 Bacteria 42286
225 Ga0501044_0064918 3300049823 Bacteria 3724
226 Ga0495601_0214211 3300053077 Bacteria 1258
227 Ga0495619_0071590 3300053085 Bacteria 2320
228 Ga0466962_0018993 3300061719 Bacteria 3302
229 Ga0466962_0083125 3300061719 Bacteria 1532
230 Ga0466962_0161027 3300061719 Bacteria 1091
231 Ga0466962_0260912 3300061719 Bacteria 853
232 Ga0466970_0519242
233 rootH2_10164621
234 Ga0070661_101171096
235 Ga0070669_101395692
236 Ga0070709_10064547
237 Ga0070714_100041806
238 Ga0070714_100091526
239 Ga0070714_100163311
240 Ga0070714_100899540
241 Ga0070714_100900894
242 Ga0070714_101932914
243 Ga0070713_100142165
244 Ga0070713_100275926
245 Ga0070713_100404909
246 Ga0070710_10009334
247 Ga0070706_100930108
248 Ga0070698_101032518
249 Ga0070684_102132005
250 Ga0070665_100155596
251 Ga0068855_101688299
252 Ga0068854_100521941
253 Ga0070717_10021008
254 Ga0070717_10204847
255 Ga0070717_10248493
256 Ga0070717_10706886
257 Ga0070717_11634856
258 Ga0070715_10329594
259 Ga0070712_100071774
260 Ga0070712_100545981
261 Ga0070712_100930733
262 Ga0157373_10588220
263 Ga0157369_10544396
264 Ga0157369_11048398
265 Ga0157369_12072225
266 Ga0157372_10310543
267 Ga0157372_11017507
268 Ga0197907_10949875
269 Ga0206356_10625693
270 Ga0206349_1258016
271 Ga0206351_10570522
272 Ga0206350_10517163
273 Ga0206350_11505245
274 Ga0206354_11274444
275 Ga0206353_11108147
276 Ga0154015_1448589
277 Ga0213874_10026900
278 Ga0213874_10043621
279 Ga0213876_10036928
280 Ga0213876_10344933
281 Ga0213875_10015965
282 Ga0213875_10042784
283 Ga0224712_10411634
284 Ga0224712_10547058
285 Ga0224712_10678034
286 Ga0207692_10510164
287 Ga0207692_10633191
288 Ga0207685_10053076
289 Ga0207699_10067303
290 Ga0207671_10246749
291 Ga0207693_10002813
292 Ga0207700_10188231
293 Ga0207700_10230769
294 Ga0207700_10270034
295 Ga0207664_10035623
296 Ga0207664_10063052
297 Ga0207664_10475857
298 Ga0207664_10625225
299 Ga0207664_10958896
300 Ga0207664_11194111
301 Ga0207679_11172725
302 Ga0373934_0165416
303 Ga0373923_0480371
304 Ga0373955_0194471
305 Ga0373937_0007807
306 Ga0436364_0277923
307 Ga0436364_0557675
308 Ga0436364_0657103
309 Ga0436364_0872455
310 Ga0436364_1048478
311 Ga0436364_1207749
312 Ga0436364_1307626
313 Ga0436365_0491262
314 Ga0436365_0586044
315 Ga0436365_0998738
316 Ga0436365_1208184
317 Ga0436360_1200462
318 Ga0436363_0451087
319 Ga0436363_0485390
320 Ga0436363_1047278
321 Ga0436363_1450478
322 Ga0436363_1579310
323 Ga0436363_1613927
324 Ga0436362_0258418
325 Ga0436362_0833982
326 Ga0436362_0997746
327 Ga0451791_0194571
328 Ga0451849_1247865
329 Ga0466969_0035765
330 Ga0466969_0046274
331 Ga0466969_0294387
332 Ga0466972_0256001
333 Ga0466966_0008398
334 Ga0466966_0086139
335 Ga0466966_0134380
336 Ga0466966_0305807
337 Ga0466961_0009779
338 Ga0466961_0015464
339 Ga0466961_0016225
340 Ga0466961_0039163
341 Ga0466961_0205877
342 Ga0466961_0304575
343 Ga0466961_0856116
344 Ga0466963_0020492
345 Ga0466963_0037399
346 Ga0466963_0041452
347 Ga0466963_0074359
348 Ga0466963_0393331
349 Ga0466963_0634877
350 Ga0466963_0777280
351 Ga0466963_1342217
352 Ga0466964_0517404
353 Ga0466964_0850271
354 Ga0466964_0869641
355 Ga0466971_0029754
356 Ga0466971_0238398
357 Ga0466971_0344063
358 Ga0466971_0403741
359 Ga0466968_0032546
360 Ga0466970_0040610
361 Ga0466970_0064858
362 Ga0466970_0094286
363 Ga0466957_0142629
364 Ga0466957_0190327
365 Ga0466960_0241869
366 Ga0466960_0371815
367 Ga0466960_0483890
368 Ga0466959_0005160
369 Ga0466959_0047392
370 Ga0466959_0075041
371 Ga0466959_0114097
372 Ga0466959_0156472
373 Ga0466959_1068162
374 Ga0466959_1071039
375 Ga0466958_0031111
376 Ga0466958_0060781
377 Ga0466958_0238231
378 Ga0466958_0256684
379 Ga0466958_0513618
380 Ga0466958_0559288
381 Ga0466958_0560029
382 Ga0466958_1005535
383 Ga0466967_0000612
384 Ga0466967_0002859
385 Ga0466967_0005775
386 Ga0466967_0108223
387 Ga0466967_0157615
388 Ga0466967_0386624
389 Ga0466967_0388381
390 Ga0466967_0574982
391 Ga0466967_0612590
392 Ga0495592_0003913
393 Ga0495651_0021606
394 Ga0495653_0219312
395 Ga0495662_0166013
396 Ga0495664_0187507
397 Ga0495608_0008891
398 Ga0495608_0909936
399 Ga0495618_0198825
400 Ga0495628_0004542
401 Ga0495628_0028144
402 Ga0495630_0084811
403 Ga0495587_0055936
404 Ga0495667_0012925
405 Ga0495634_0036919
406 Ga0495635_0021934
407 Ga0495657_0044145
408 Ga0495600_0006155
409 Ga0495581_0414820
410 Ga0495604_0361585
411 Ga0495674_0462730
412 Ga0495680_0002500
413 Ga0495675_0032486
414 Ga0495684_0067615
415 Ga0495684_0177140
416 Ga0495602_0010648
417 Ga0495602_0533526
418 Ga0495614_0431827
419 Ga0496101_1093832
420 Ga0496102_0232175
421 Ga0496103_0181191
422 Ga0496104_0021014
423 Ga0496105_0136563
424 Ga0496108_1614471
425 Ga0496109_0002784
426 Ga0496109_0366871
427 Ga0496109_1738229
428 Ga0496110_0148412
429 Ga0496112_0054725
430 Ga0496113_0021541
431 Ga0496113_1044822
432 Ga0496114_0211917
433 Ga0496114_0774741
434 Ga0496115_0029291
435 Ga0496115_0905509
436 Ga0496116_0003716
437 Ga0496117_0008217
438 Ga0496118_0013412
439 Ga0496119_0018209
440 Ga0496120_0063503
441 Ga0496124_0452477
442 Ga0496126_0032338
443 Ga0496126_0393283
444 Ga0501032_0049351
445 Ga0501033_0052412
446 Ga0501034_0024183
447 Ga0501036_0915460
448 Ga0501038_0553373
449 Ga0501047_0234140
450 Ga0501047_0668319
451 Ga0501070_0669535
452 Ga0501080_0150703
453 Ga0501035_0000218
454 Ga0501035_0270578
455 Ga0501044_0000639
456 Ga0501044_0064918
457 Ga0495601_0214211
458 Ga0495619_0071590
459 Ga0466962_0018993
460 Ga0466962_0083125
461 Ga0466962_0161027
462 Ga0466962_0260912

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

137

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hc5-assembly2.cif.gz_C crystal structure of member of glyoxalase/bleomycin resistance protein/dioxygenase superfamily from sphaerobacter thermophilus dsm 20745 0.9036 4 125
5umq-assembly1.cif.gz_A crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 0.8809 2 123
5uhj-assembly2.cif.gz_B-3 the crystal structure of a natural product biosynthetic enzyme from streptomyces sp. cb03234 0.8726 2 123
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8633 4 124
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8585 1 124
ID Description Score Start End Superfamily
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8972 4 125 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8834 4 125 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8711 3 123 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8439 3 123 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.841 9 123 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7I7W567-F1-model_v4 deleted 0.9956 1 125
AF-A0A7I7W567-F1-model_v4 deleted 0.9877 1 125
AF-A0A537XET1-F1-model_v4 Glyoxalase 0.9514 2 125
AF-A0A538AGB2-F1-model_v4 Glyoxalase 0.9399 1 125
AF-A0A1Q6XDX9-F1-model_v4 Glyoxalase 0.934 2 124

Map