F344176

General Info

Members Datasets Scaffolds Average Seq Length
231 167 462 131

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10601146|Ga0265338_106011461
Length 135
Sequence MPGHLLVSLISLLAVLVYLYMGLLVGRARGKYNVAAPAVSGDPNFERAYRVQMNTLEWLPIFLTSLWLFSFAWGDDRISAAIGLVWIVGRVLYLTGYTQAPERREIGFMIQAFAGLALLLGALGKVIWMIVQHGV

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
78 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
79 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
89 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
90 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
93 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
103 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
104 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
157 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
158 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
159 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
160 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
161 2904699407
162 2906610324
163 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
164 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
165 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
166 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
167 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.51
Metatranscriptomes 0
Isolates 3.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 2.6
Rhizoplane 11.69
Rhizosphere 72.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10601146 3300028800 Bacteria 766
2 rootH1_10054575 3300003323 Bacteria 1297
3 Ga0065165_1002230 3300005262 Bacteria 17253
4 Ga0070683_100477712 3300005329 Bacteria 1190
5 Ga0070680_100076690 3300005336 Bacteria 2752
6 Ga0070660_100071609 3300005339 Bacteria 2707
7 Ga0070660_100566568 3300005339 Bacteria 948
8 Ga0070668_100952454 3300005347 Bacteria 769
9 Ga0070659_100099939 3300005366 Bacteria 2334
10 Ga0070659_100308406 3300005366 Bacteria 1321
11 Ga0070713_101120706 3300005436 Bacteria 761
12 Ga0070713_101713925 3300005436 Bacteria 610
13 Ga0070710_10313193 3300005437 Bacteria 1028
14 Ga0070711_100014629 3300005439 Bacteria 4946
15 Ga0070663_100170689 3300005455 Bacteria 1681
16 Ga0070663_100615674 3300005455 Bacteria 915
17 Ga0070678_100059132 3300005456 Bacteria 2816
18 Ga0070678_100574335 3300005456 Bacteria 1004
19 Ga0070662_101276923 3300005457 Bacteria 632
20 Ga0070681_10725895 3300005458 Bacteria 910
21 Ga0068853_100127727 3300005539 Bacteria 2273
22 Ga0068853_101080238 3300005539 Bacteria 774
23 Ga0070665_100347813 3300005548 Bacteria 1488
24 Ga0070665_101017401 3300005548 Bacteria 841
25 Ga0068855_100052929 3300005563 Bacteria 4778
26 Ga0068855_100553718 3300005563 Bacteria 1245
27 Ga0068857_101281268 3300005577 Bacteria 711
28 Ga0068854_100692423 3300005578 Bacteria 879
29 Ga0068854_101599929 3300005578 Bacteria 594
30 Ga0068856_100034545 3300005614 Bacteria 4952
31 Ga0068856_100950340 3300005614 Bacteria 878
32 Ga0068852_100002923 3300005616 Bacteria 11867
33 Ga0068864_100115613 3300005618 Bacteria 2393
34 Ga0068870_10659588 3300005840 Bacteria 718
35 Ga0068863_102274349 3300005841 Bacteria 552
36 Ga0081455_10002680 3300005937 Bacteria 21036
37 Ga0081539_10000530 3300005985 Bacteria 79454
38 Ga0075363_100021387 3300006048 Bacteria 3258
39 Ga0075364_10334500 3300006051 Bacteria 1032
40 Ga0070715_10681450 3300006163 Bacteria 612
41 Ga0070716_100094141 3300006173 Bacteria 1820
42 Ga0070716_100110483 3300006173 Bacteria 1703
43 Ga0070716_100764545 3300006173 Bacteria 745
44 Ga0075367_10310309 3300006178 Bacteria 993
45 Ga0075367_10348052 3300006178 Bacteria 935
46 Ga0075366_10469960 3300006195 Bacteria 776
47 Ga0097621_100434061 3300006237 Bacteria 1181
48 Ga0097621_100916502 3300006237 Bacteria 817
49 Ga0097621_101806521 3300006237 Bacteria 583
50 Ga0068871_100515738 3300006358 Bacteria 1079
51 Ga0068871_100785739 3300006358 Bacteria 877
52 Ga0099795_10210852 3300007788 Bacteria 823
53 Ga0099795_10291792 3300007788 Bacteria 715
54 Ga0099795_10343020 3300007788 Bacteria 666
55 Ga0105240_10456475 3300009093 Bacteria 1429
56 Ga0105248_10008995 3300009177 Bacteria 10981
57 Ga0105237_10005001 3300009545 Bacteria 15097
58 Ga0105238_10220209 3300009551 Bacteria 1874
59 Ga0105238_10289631 3300009551 Bacteria 1620
60 Ga0105249_10274465 3300009553 Bacteria 1681
61 Ga0105249_10476719 3300009553 Bacteria 1290
62 Ga0105249_10961553 3300009553 Bacteria 922
63 Ga0105239_10413358 3300010375 Bacteria 1528
64 Ga0157370_10312369 3300013104 Bacteria 1450
65 Ga0157369_10543350 3300013105 Bacteria 1201
66 Ga0157369_10843570 3300013105 Bacteria 941
67 Ga0157374_11485792 3300013296 Bacteria 701
68 Ga0163162_10193701 3300013306 Bacteria 2161
69 Ga0157372_12592423 3300013307 Bacteria 582
70 Ga0157375_11412410 3300013308 Bacteria 820
71 Ga0163163_10003907 3300014325 Bacteria 12711
72 Ga0157380_11227768 3300014326 Bacteria 794
73 Ga0182008_10146227 3300014497 Bacteria 1184
74 Ga0157379_10160665 3300014968 Bacteria 2028
75 Ga0157379_10188361 3300014968 Bacteria 1865
76 Ga0157379_10886153 3300014968 Bacteria 846
77 Ga0157376_10573539 3300014969 Bacteria 1120
78 Ga0157376_11381554 3300014969 Bacteria 735
79 Ga0163161_10100603 3300017792 Bacteria 2151
80 Ga0163161_11894336 3300017792 Bacteria 531
81 Ga0213874_10157278 3300021377 Bacteria 796
82 Ga0207688_10092856 3300025901 Bacteria 1735
83 Ga0207671_10045352 3300025914 Bacteria 3251
84 Ga0207663_10013767 3300025916 Bacteria 4407
85 Ga0207663_10259484 3300025916 Bacteria 1283
86 Ga0207660_10051228 3300025917 Bacteria 2935
87 Ga0207657_10426520 3300025919 Bacteria 1042
88 Ga0207657_10497735 3300025919 Bacteria 955
89 Ga0207706_11061726 3300025933 Bacteria 678
90 Ga0207665_10649532 3300025939 Bacteria 827
91 Ga0207711_10017650 3300025941 Bacteria 5927
92 Ga0207712_10101126 3300025961 Bacteria 2143
93 Ga0207712_10528744 3300025961 Bacteria 1012
94 Ga0207703_10206120 3300026035 Bacteria 1750
95 Ga0207678_10164178 3300026067 Bacteria 1896
96 Ga0207702_10383845 3300026078 Bacteria 1351
97 Ga0207641_10008809 3300026088 Bacteria 8334
98 Ga0207641_11867630 3300026088 Bacteria 602
99 Ga0207674_11252342 3300026116 Bacteria 711
100 Ga0207674_11922641 3300026116 Bacteria 557
101 Ga0207683_10090575 3300026121 Bacteria 2724
102 Ga0207683_10137631 3300026121 Bacteria 2198
103 Ga0207698_10254506 3300026142 Bacteria 1609
104 Ga0268266_10407185 3300028379 Bacteria 1287
105 Ga0268266_11233677 3300028379 Bacteria 723
106 Ga0268264_10000049 3300028381 Bacteria 329992
107 Ga0307517_10002211 3300028786 Bacteria 31433
108 Ga0307515_10067604 3300028794 Bacteria 4925
109 Ga0265338_10170286 3300028800 Bacteria 1671
110 Ga0265330_10022749 3300031235 Bacteria 2851
111 Ga0265332_10028599 3300031238 Bacteria 2439
112 Ga0265328_10020922 3300031239 Bacteria 2501
113 Ga0265329_10146827 3300031242 Bacteria 763
114 Ga0265340_10001433 3300031247 Bacteria 13676
115 Ga0265316_10658126 3300031344 Bacteria 740
116 Ga0307408_101236067 3300031548 Bacteria 698
117 Ga0307508_10278825 3300031616 Bacteria 1265
118 Ga0265342_10029435 3300031712 Bacteria 3409
119 Ga0307516_10296719 3300031730 Bacteria 1293
120 Ga0307405_11212559 3300031731 Bacteria 653
121 Ga0307412_10579389 3300031911 Bacteria 947
122 Ga0316215_1003575 3300033544 Bacteria 1483
123 Ga0373934_0006704 3300035086 Bacteria 4279
124 Ga0373934_0064045 3300035086 Bacteria 1467
125 Ga0373953_0017919 3300035117 Bacteria 2611
126 Ga0373954_0035106 3300035118 Bacteria 2324
127 Ga0373956_0004628 3300035119 Bacteria 5498
128 Ga0373956_0130064 3300035119 Bacteria 1178
129 Ga0373957_0004057 3300035120 Bacteria 4412
130 Ga0373957_0017083 3300035120 Bacteria 2521
131 Ga0373955_0007710 3300035172 Bacteria 4957
132 Ga0373955_0008760 3300035172 Bacteria 4711
133 Ga0373935_0341047 3300035692 Bacteria 1067
134 Ga0373933_0003021 3300035724 Bacteria 9385
135 Ga0373937_0042388 3300036401 Bacteria 4152
136 Ga0373937_0052765 3300036401 Bacteria 3729
137 Ga0373937_0089872 3300036401 Bacteria 2844
138 Ga0395905_0040243 3300037471 Bacteria 4384
139 Ga0395905_0084507 3300037471 Bacteria 2974
140 Ga0395901_0146812 3300038443 Bacteria 2479
141 Ga0436365_1398859 3300039437 Bacteria 1520
142 Ga0436361_0139538 3300039447 Bacteria 540
143 Ga0436363_1017465 3300039450 Bacteria 3806
144 Ga0436363_1071760 3300039450 Bacteria 2055
145 Ga0439465_0350596 3300041413 Bacteria 557
146 Ga0451797_0253797 3300041453 Bacteria 619
147 Ga0466966_0000378 3300044684 Bacteria 29054
148 Ga0466961_0000129 3300044693 Bacteria 50353
149 Ga0466971_0118062 3300044719 Bacteria 1227
150 Ga0466959_0002230 3300045049 Bacteria 12347
151 Ga0495629_0079021 3300046459 Bacteria 2297
152 Ga0495651_0029696 3300046462 Bacteria 4263
153 Ga0495651_0106994 3300046462 Bacteria 2072
154 Ga0495651_0144577 3300046462 Bacteria 1721
155 Ga0495653_0108424 3300046463 Bacteria 1999
156 Ga0495664_0013714 3300046477 Bacteria 4596
157 Ga0495606_0295536 3300046507 Bacteria 880
158 Ga0495608_0027521 3300046511 Bacteria 3868
159 Ga0495608_0028543 3300046511 Bacteria 3792
160 Ga0495618_0217048 3300046514 Bacteria 1208
161 Ga0495643_0350065 3300046522 Bacteria 662
162 Ga0495587_0030660 3300046536 Bacteria 3260
163 Ga0495587_0050767 3300046536 Bacteria 2454
164 Ga0495609_0230915 3300046538 Bacteria 766
165 Ga0495645_0005858 3300046543 Bacteria 8485
166 Ga0495667_0021826 3300046559 Bacteria 4318
167 Ga0495667_0192546 3300046559 Bacteria 1306
168 Ga0495668_0467713 3300046616 Bacteria 694
169 Ga0495634_0010082 3300046642 Bacteria 6934
170 Ga0495657_0067260 3300046675 Bacteria 2352
171 Ga0495599_0021172 3300046678 Bacteria 4056
172 Ga0495613_0018569 3300046689 Bacteria 5185
173 Ga0495600_0014337 3300046809 Bacteria 4994
174 Ga0495600_0044491 3300046809 Bacteria 2897
175 Ga0495604_0034568 3300047317 Bacteria 3998
176 Ga0495604_0043108 3300047317 Bacteria 3533
177 Ga0495672_0018382 3300047320 Bacteria 4642
178 Ga0495675_0010088 3300047444 Bacteria 5892
179 Ga0495684_0418789 3300047471 Bacteria 937
180 Ga0495593_0006271 3300047673 Bacteria 6981
181 Ga0495602_0081302 3300048088 Bacteria 2725
182 Ga0496100_0060876 3300048903 Bacteria 2486
183 Ga0496102_0016911 3300048905 Bacteria 6383
184 Ga0496102_0875984 3300048905 Bacteria 820
185 Ga0496102_1423834 3300048905 Bacteria 612
186 Ga0496103_0037052 3300048906 Bacteria 2989
187 Ga0496104_0002526 3300048907 Bacteria 15766
188 Ga0496105_0000212 3300048908 Bacteria 38935
189 Ga0496106_0009630 3300048909 Bacteria 7135
190 Ga0496106_0501445 3300048909 Bacteria 975
191 Ga0496107_0061031 3300048910 Bacteria 2730
192 Ga0496107_0536341 3300048910 Bacteria 867
193 Ga0496107_0650907 3300048910 Bacteria 777
194 Ga0496108_0011418 3300048911 Bacteria 7221
195 Ga0496109_0414609 3300048912 Bacteria 1272
196 Ga0496110_1338984 3300048913 Bacteria 625
197 Ga0496111_0024727 3300048914 Bacteria 4235
198 Ga0496112_0007966 3300048915 Bacteria 9447
199 Ga0496113_0041677 3300048916 Bacteria 3389
200 Ga0496113_1384176 3300048916 Bacteria 545
201 Ga0496114_0060277 3300048917 Bacteria 3171
202 Ga0496115_0004664 3300048918 Bacteria 9931
203 Ga0496115_0022519 3300048918 Bacteria 4883
204 Ga0496115_0104190 3300048918 Bacteria 2328
205 Ga0496115_0160412 3300048918 Bacteria 1858
206 Ga0496115_0504833 3300048918 Bacteria 971
207 Ga0496121_0100776 3300048924 Bacteria 2229
208 Ga0496124_0763942 3300048927 Bacteria 604
209 Ga0496125_0131533 3300048928 Bacteria 1760
210 Ga0496125_0445704 3300048928 Bacteria 743
211 Ga0496126_0007610 3300048929 Bacteria 11831
212 Ga0496126_0034951 3300048929 Bacteria 4713
213 Ga0496126_0444691 3300048929 Bacteria 1044
214 Ga0496126_0761268 3300048929 Bacteria 747
215 Ga0496126_1179139 3300048929 Bacteria 564
216 nmdc:mga03n38_3581_c1 3300050490 Bacteria 5014
217 Ga0495601_0007704 3300053077 Bacteria 6330
218 Ga0495595_0010759 3300053084 Bacteria 3811
219 Ga0495619_0005433 3300053085 Bacteria 8074
220 Ga0500636_0011421 3300053177 Bacteria 5201
221 Ga0500637_0232747 3300053178 Bacteria 1037
222 2671121438 2667528175 Bacteria 7532676
223 2793070940 2791355197 Bacteria 8420563
224 2885411731 2885409591 Bacteria 9235467
225 2904709147
226 2906613243
227 2935634782 2935630451 Bacteria 8169952
228 2941511888 2941507105 Bacteria 8166816
229 2941519590 2941515067 Bacteria 8166720
230 2941527718 2941523033 Bacteria 8169134
231 3005475519 3005474847 Bacteria 9259049
232 Ga0265338_10601146
233 rootH1_10054575
234 Ga0065165_1002230
235 Ga0070683_100477712
236 Ga0070680_100076690
237 Ga0070660_100071609
238 Ga0070660_100566568
239 Ga0070668_100952454
240 Ga0070659_100099939
241 Ga0070659_100308406
242 Ga0070713_101120706
243 Ga0070713_101713925
244 Ga0070710_10313193
245 Ga0070711_100014629
246 Ga0070663_100170689
247 Ga0070663_100615674
248 Ga0070678_100059132
249 Ga0070678_100574335
250 Ga0070662_101276923
251 Ga0070681_10725895
252 Ga0068853_100127727
253 Ga0068853_101080238
254 Ga0070665_100347813
255 Ga0070665_101017401
256 Ga0068855_100052929
257 Ga0068855_100553718
258 Ga0068857_101281268
259 Ga0068854_100692423
260 Ga0068854_101599929
261 Ga0068856_100034545
262 Ga0068856_100950340
263 Ga0068852_100002923
264 Ga0068864_100115613
265 Ga0068870_10659588
266 Ga0068863_102274349
267 Ga0081455_10002680
268 Ga0081539_10000530
269 Ga0075363_100021387
270 Ga0075364_10334500
271 Ga0070715_10681450
272 Ga0070716_100094141
273 Ga0070716_100110483
274 Ga0070716_100764545
275 Ga0075367_10310309
276 Ga0075367_10348052
277 Ga0075366_10469960
278 Ga0097621_100434061
279 Ga0097621_100916502
280 Ga0097621_101806521
281 Ga0068871_100515738
282 Ga0068871_100785739
283 Ga0099795_10210852
284 Ga0099795_10291792
285 Ga0099795_10343020
286 Ga0105240_10456475
287 Ga0105248_10008995
288 Ga0105237_10005001
289 Ga0105238_10220209
290 Ga0105238_10289631
291 Ga0105249_10274465
292 Ga0105249_10476719
293 Ga0105249_10961553
294 Ga0105239_10413358
295 Ga0157370_10312369
296 Ga0157369_10543350
297 Ga0157369_10843570
298 Ga0157374_11485792
299 Ga0163162_10193701
300 Ga0157372_12592423
301 Ga0157375_11412410
302 Ga0163163_10003907
303 Ga0157380_11227768
304 Ga0182008_10146227
305 Ga0157379_10160665
306 Ga0157379_10188361
307 Ga0157379_10886153
308 Ga0157376_10573539
309 Ga0157376_11381554
310 Ga0163161_10100603
311 Ga0163161_11894336
312 Ga0213874_10157278
313 Ga0207688_10092856
314 Ga0207671_10045352
315 Ga0207663_10013767
316 Ga0207663_10259484
317 Ga0207660_10051228
318 Ga0207657_10426520
319 Ga0207657_10497735
320 Ga0207706_11061726
321 Ga0207665_10649532
322 Ga0207711_10017650
323 Ga0207712_10101126
324 Ga0207712_10528744
325 Ga0207703_10206120
326 Ga0207678_10164178
327 Ga0207702_10383845
328 Ga0207641_10008809
329 Ga0207641_11867630
330 Ga0207674_11252342
331 Ga0207674_11922641
332 Ga0207683_10090575
333 Ga0207683_10137631
334 Ga0207698_10254506
335 Ga0268266_10407185
336 Ga0268266_11233677
337 Ga0268264_10000049
338 Ga0307517_10002211
339 Ga0307515_10067604
340 Ga0265338_10170286
341 Ga0265330_10022749
342 Ga0265332_10028599
343 Ga0265328_10020922
344 Ga0265329_10146827
345 Ga0265340_10001433
346 Ga0265316_10658126
347 Ga0307408_101236067
348 Ga0307508_10278825
349 Ga0265342_10029435
350 Ga0307516_10296719
351 Ga0307405_11212559
352 Ga0307412_10579389
353 Ga0316215_1003575
354 Ga0373934_0006704
355 Ga0373934_0064045
356 Ga0373953_0017919
357 Ga0373954_0035106
358 Ga0373956_0004628
359 Ga0373956_0130064
360 Ga0373957_0004057
361 Ga0373957_0017083
362 Ga0373955_0007710
363 Ga0373955_0008760
364 Ga0373935_0341047
365 Ga0373933_0003021
366 Ga0373937_0042388
367 Ga0373937_0052765
368 Ga0373937_0089872
369 Ga0395905_0040243
370 Ga0395905_0084507
371 Ga0395901_0146812
372 Ga0436365_1398859
373 Ga0436361_0139538
374 Ga0436363_1017465
375 Ga0436363_1071760
376 Ga0439465_0350596
377 Ga0451797_0253797
378 Ga0466966_0000378
379 Ga0466961_0000129
380 Ga0466971_0118062
381 Ga0466959_0002230
382 Ga0495629_0079021
383 Ga0495651_0029696
384 Ga0495651_0106994
385 Ga0495651_0144577
386 Ga0495653_0108424
387 Ga0495664_0013714
388 Ga0495606_0295536
389 Ga0495608_0027521
390 Ga0495608_0028543
391 Ga0495618_0217048
392 Ga0495643_0350065
393 Ga0495587_0030660
394 Ga0495587_0050767
395 Ga0495609_0230915
396 Ga0495645_0005858
397 Ga0495667_0021826
398 Ga0495667_0192546
399 Ga0495668_0467713
400 Ga0495634_0010082
401 Ga0495657_0067260
402 Ga0495599_0021172
403 Ga0495613_0018569
404 Ga0495600_0014337
405 Ga0495600_0044491
406 Ga0495604_0034568
407 Ga0495604_0043108
408 Ga0495672_0018382
409 Ga0495675_0010088
410 Ga0495684_0418789
411 Ga0495593_0006271
412 Ga0495602_0081302
413 Ga0496100_0060876
414 Ga0496102_0016911
415 Ga0496102_0875984
416 Ga0496102_1423834
417 Ga0496103_0037052
418 Ga0496104_0002526
419 Ga0496105_0000212
420 Ga0496106_0009630
421 Ga0496106_0501445
422 Ga0496107_0061031
423 Ga0496107_0536341
424 Ga0496107_0650907
425 Ga0496108_0011418
426 Ga0496109_0414609
427 Ga0496110_1338984
428 Ga0496111_0024727
429 Ga0496112_0007966
430 Ga0496113_0041677
431 Ga0496113_1384176
432 Ga0496114_0060277
433 Ga0496115_0004664
434 Ga0496115_0022519
435 Ga0496115_0104190
436 Ga0496115_0160412
437 Ga0496115_0504833
438 Ga0496121_0100776
439 Ga0496124_0763942
440 Ga0496125_0131533
441 Ga0496125_0445704
442 Ga0496126_0007610
443 Ga0496126_0034951
444 Ga0496126_0444691
445 Ga0496126_0761268
446 Ga0496126_1179139
447 nmdc:mga03n38_3581_c1
448 Ga0495601_0007704
449 Ga0495595_0010759
450 Ga0495619_0005433
451 Ga0500636_0011421
452 Ga0500637_0232747
453 2671121438
454 2793070940
455 2885411731
456 2904709147
457 2906613243
458 2935634782
459 2941511888
460 2941519590
461 2941527718
462 3005475519

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

7

124

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ssu-assembly1.cif.gz_B crystal structure of human microsomal glutathione s-transferase 2 in complex with co-substrate glutathione 0.9601 4 128
3leo-assembly1.cif.gz_A structure of human leukotriene c4 synthase mutant r31q in complex with glutathione 0.9582 3 128
3hkk-assembly1.cif.gz_A structure of human leukotriene c4 synthase in complex with glutathione sulfonate 0.9576 3 128
4jrz-assembly1.cif.gz_A human ltc4 synthase in complex with product analogs - implications for enzyme catalysis 0.9568 3 128
4ntb-assembly1.cif.gz_A mus musculus ltc4 synthase in gsh complex form 0.9568 3 128
ID Description Score Start End Superfamily
af_A2RST1_1_145_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.9646 3 128 1.20.120.550
af_F1QIS1_3_136_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.9592 1 128 1.20.120.550
af_A0A0G2JU12_1_126_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.959 18 128 1.20.120.550
3leoA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.9582 3 128 1.20.120.550
4jrzA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.9568 3 128 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A4W6DAV9-F1-model_v4 Microsomal glutathione S-transferase 2 0.99 1 81 GO:0004364
GO:0004464
GO:0004602
GO:0005635
GO:0005789
GO:0008047
GO:0019370
AF-A0A2E5YNG3-F1-model_v4 MAPEG family protein 0.9859 3 127 GO:0004364
GO:0004602
GO:0006691
GO:0016020
AF-A0A3B9NN56-F1-model_v4 MAPEG family protein 0.9854 3 128 GO:0004364
GO:0004602
GO:0006691
GO:0016020
AF-A0A212R282-F1-model_v4 Glutathione S-transferase 0.9847 1 127 GO:0004364
GO:0004602
GO:0006691
GO:0016020
AF-A0A4Y9P9W0-F1-model_v4 MAPEG family protein 0.9832 1 127 GO:0004364
GO:0004602
GO:0006691
GO:0016020

Map