F344088

General Info

Members Datasets Scaffolds Average Seq Length
231 174 229 146

Family's Representative Sequence

Representative Sequence 3300021441|Ga0213871_10077518|Ga0213871_100775182
Length 170
Sequence MLHDLAVAEPTWSPRNPDFEARVRDNFARQGFMGLVGAELDTVAPGRCVLSIGFRPALTQQHGYFHGGLIGTLADMAAGFAAFTLADADTSILTVEYKLNLLEPGQGERLLADARVMRGGKRVSVCQADVWTLDGPRRTRCAVALATLMLLPGRSDHGPPTGSAGPSQRA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2854911287 Brucella lupini LUP21 Isolate Unclassified
3 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
128 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
129 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0.43
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.19
Rhizosphere 93.07
Stem 0
Stem Tuber 0
Unclassified 1.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11879921 2162886012 Unclassified 1387
2 MBSR1b_contig_9497042 2162886012 Unclassified 1353
3 rootH2_10062296 3300003320 Bacteria 5824
4 Ga0006562J51391_1017864 3300003578 Bacteria 3420
5 Ga0065715_10196225 3300005293 Unclassified 1386
6 Ga0065707_10472062 3300005295 Bacteria 781
7 Ga0070658_10032958 3300005327 Bacteria 4166
8 Ga0070658_11001676 3300005327 Bacteria 727
9 Ga0070676_10076776 3300005328 Bacteria 2018
10 Ga0070676_10130325 3300005328 Bacteria 1589
11 Ga0070676_10603563 3300005328 Bacteria 792
12 Ga0070683_100005696 3300005329 Bacteria 10406
13 Ga0070677_10783774 3300005333 Bacteria 543
14 Ga0070660_100181418 3300005339 Bacteria 1703
15 Ga0070689_101453002 3300005340 Bacteria 620
16 Ga0070661_100026240 3300005344 Bacteria 4188
17 Ga0070668_100050566 3300005347 Bacteria 3200
18 Ga0070674_101080764 3300005356 Bacteria 708
19 Ga0070673_100338292 3300005364 Bacteria 1333
20 Ga0070659_100749968 3300005366 Bacteria 847
21 Ga0070659_101028841 3300005366 Unclassified 724
22 Ga0070667_100093618 3300005367 Bacteria 2588
23 Ga0070703_10002846 3300005406 Bacteria 4952
24 Ga0070709_10034809 3300005434 Bacteria 3057
25 Ga0070711_100043758 3300005439 Bacteria 3035
26 Ga0070705_100014861 3300005440 Bacteria 4015
27 Ga0070694_100119948 3300005444 Bacteria 1886
28 Ga0070694_101005978 3300005444 Unclassified 692
29 Ga0070708_100012038 3300005445 Bacteria 7052
30 Ga0070708_100450030 3300005445 Unclassified 1215
31 Ga0070663_100169598 3300005455 Bacteria 1686
32 Ga0070662_100345529 3300005457 Bacteria 1218
33 Ga0070662_100641565 3300005457 Unclassified 895
34 Ga0070681_10269169 3300005458 Bacteria 1615
35 Ga0070681_10420721 3300005458 Bacteria 1248
36 Ga0068867_100100690 3300005459 Bacteria 2206
37 Ga0070706_100040854 3300005467 Bacteria 4282
38 Ga0070699_100021279 3300005518 Bacteria 5593
39 Ga0070699_100086828 3300005518 Bacteria 2731
40 Ga0070684_100061774 3300005535 Bacteria 3280
41 Ga0070684_100067291 3300005535 Bacteria 3146
42 Ga0070697_100001400 3300005536 Bacteria 18281
43 Ga0070697_100668185 3300005536 Bacteria 915
44 Ga0070697_101492490 3300005536 Bacteria 604
45 Ga0068853_100053309 3300005539 Unclassified 3483
46 Ga0070672_100058070 3300005543 Bacteria 3039
47 Ga0070672_100879867 3300005543 Bacteria 791
48 Ga0070695_100004068 3300005545 Bacteria 8558
49 Ga0070695_100051441 3300005545 Unclassified 2644
50 Ga0070696_100005613 3300005546 Bacteria 8376
51 Ga0070696_100160418 3300005546 Bacteria 1656
52 Ga0070696_100546368 3300005546 Bacteria 928
53 Ga0070693_100001165 3300005547 Bacteria 11815
54 Ga0070704_100118054 3300005549 Unclassified 2031
55 Ga0070664_100067041 3300005564 Bacteria 3067
56 Ga0070664_100459905 3300005564 Bacteria 1169
57 Ga0070664_100490409 3300005564 Bacteria 1131
58 Ga0070664_100584570 3300005564 Bacteria 1035
59 Ga0068857_100003022 3300005577 Bacteria 13897
60 Ga0068854_100970148 3300005578 Unclassified 751
61 Ga0068852_100425192 3300005616 Bacteria 1311
62 Ga0068864_100083699 3300005618 Bacteria 2802
63 Ga0068864_100128412 3300005618 Bacteria 2274
64 Ga0068866_10828329 3300005718 Unclassified 645
65 Ga0068866_10877614 3300005718 Bacteria 629
66 Ga0068861_100652579 3300005719 Bacteria 972
67 Ga0068860_100005502 3300005843 Bacteria 12825
68 Ga0068860_100148944 3300005843 Bacteria 2253
69 Ga0068862_100032348 3300005844 Bacteria 4419
70 Ga0081455_10009745 3300005937 Bacteria 9841
71 Ga0070716_100107023 3300006173 Bacteria 1726
72 Ga0070716_100895356 3300006173 Unclassified 694
73 Ga0075428_100023023 3300006844 Bacteria 6894
74 Ga0075430_100102066 3300006846 Bacteria 2394
75 Ga0075431_100593976 3300006847 Bacteria 1092
76 Ga0075433_10090612 3300006852 Bacteria 2703
77 Ga0075434_100008746 3300006871 Bacteria 9420
78 Ga0068865_100020051 3300006881 Bacteria 4335
79 Ga0075435_100802675 3300007076 Unclassified 819
80 Ga0099794_10231624 3300007265 Unclassified 950
81 Ga0099795_10122335 3300007788 Bacteria 1042
82 Ga0111539_10102406 3300009094 Bacteria 3361
83 Ga0105247_11180564 3300009101 Bacteria 608
84 Ga0105243_10040666 3300009148 Unclassified 3632
85 Ga0105243_10923896 3300009148 Unclassified 870
86 Ga0105242_10196933 3300009176 Bacteria 1787
87 Ga0105248_10534689 3300009177 Unclassified 1322
88 Ga0105248_10747561 3300009177 Unclassified 1103
89 Ga0105249_10041223 3300009553 Bacteria 4196
90 Ga0105239_10886063 3300010375 Unclassified 1024
91 Ga0105246_11196633 3300011119 Bacteria 699
92 Ga0157374_11371093 3300013296 Unclassified 730
93 Ga0157378_10000036 3300013297 Bacteria 117422
94 Ga0157378_12629668 3300013297 Bacteria 556
95 Ga0163162_10033984 3300013306 Bacteria 5071
96 Ga0157372_12237249 3300013307 Unclassified 628
97 Ga0157375_10043301 3300013308 Bacteria 4365
98 Ga0157375_10266357 3300013308 Bacteria 1875
99 Ga0157375_10419280 3300013308 Bacteria 1505
100 Ga0157380_10471174 3300014326 Bacteria 1212
101 Ga0163161_10856318 3300017792 Bacteria 767
102 Ga0213871_10077518 3300021441 Bacteria 948
103 Ga0207656_10376537 3300025321 Bacteria 711
104 Ga0207653_10004825 3300025885 Bacteria 4217
105 Ga0207642_10692214 3300025899 Bacteria 642
106 Ga0207699_10079819 3300025906 Unclassified 2025
107 Ga0207699_10131726 3300025906 Bacteria 1632
108 Ga0207699_10211446 3300025906 Bacteria 1319
109 Ga0207645_10003939 3300025907 Bacteria 11086
110 Ga0207645_10053182 3300025907 Bacteria 2588
111 Ga0207645_10429728 3300025907 Bacteria 890
112 Ga0207705_10683688 3300025909 Unclassified 798
113 Ga0207684_10840044 3300025910 Bacteria 775
114 Ga0207663_10066747 3300025916 Bacteria 2304
115 Ga0207657_10109016 3300025919 Bacteria 2289
116 Ga0207657_10997343 3300025919 Bacteria 643
117 Ga0207649_10204885 3300025920 Bacteria 1396
118 Ga0207652_10024792 3300025921 Bacteria 4979
119 Ga0207687_10399717 3300025927 Unclassified 1130
120 Ga0207690_10259759 3300025932 Bacteria 1345
121 Ga0207706_10136448 3300025933 Bacteria 2158
122 Ga0207706_10633351 3300025933 Unclassified 917
123 Ga0207686_10505033 3300025934 Bacteria 939
124 Ga0207669_10166274 3300025937 Bacteria 1565
125 Ga0207704_10043206 3300025938 Bacteria 2659
126 Ga0207665_10354633 3300025939 Bacteria 1108
127 Ga0207665_10812346 3300025939 Unclassified 739
128 Ga0207665_11629019 3300025939 Unclassified 511
129 Ga0207691_10035226 3300025940 Bacteria 4648
130 Ga0207711_10680000 3300025941 Unclassified 960
131 Ga0207711_10789989 3300025941 Unclassified 884
132 Ga0207661_10033429 3300025944 Bacteria 3991
133 Ga0207661_10037421 3300025944 Bacteria 3795
134 Ga0207679_10101642 3300025945 Bacteria 2249
135 Ga0207679_10261917 3300025945 Bacteria 1475
136 Ga0207679_10334879 3300025945 Bacteria 1315
137 Ga0207712_10772776 3300025961 Unclassified 843
138 Ga0207668_10546815 3300025972 Bacteria 1002
139 Ga0207668_11036322 3300025972 Unclassified 734
140 Ga0207658_10064409 3300025986 Bacteria 2750
141 Ga0207658_11708990 3300025986 Unclassified 575
142 Ga0207639_10266517 3300026041 Bacteria 1500
143 Ga0207678_10449748 3300026067 Bacteria 1119
144 Ga0207641_11667573 3300026088 Bacteria 639
145 Ga0207648_10108917 3300026089 Bacteria 2432
146 Ga0207674_10002317 3300026116 Bacteria 24108
147 Ga0207675_101721541 3300026118 Unclassified 647
148 Ga0207698_10188679 3300026142 Bacteria 1834
149 Ga0268265_10070397 3300028380 Unclassified 2720
150 Ga0268264_10102567 3300028381 Bacteria 2489
151 Ga0268264_11126268 3300028381 Unclassified 793
152 Ga0265340_10256819 3300031247 Unclassified 778
153 Ga0265331_10106868 3300031250 Unclassified 1285
154 Ga0265314_10290117 3300031711 Unclassified 922
155 Ga0265342_10258408 3300031712 Unclassified 927
156 Ga0307413_10188831 3300031824 Bacteria 1477
157 Ga0307410_10099094 3300031852 Bacteria 2085
158 Ga0373926_0000118 3300035083 Bacteria 16022
159 Ga0373954_0012746 3300035118 Bacteria 3743
160 Ga0373954_0014354 3300035118 Bacteria 3533
161 Ga0373956_0246562 3300035119 Bacteria 849
162 Ga0373956_0249768 3300035119 Bacteria 843
163 Ga0373955_0034945 3300035172 Bacteria 2659
164 Ga0373927_0086296 3300035695 Bacteria 2037
165 Ga0373933_0325517 3300035724 Bacteria 997
166 Ga0373947_0014254 3300035725 Unclassified 4559
167 Ga0373937_0133146 3300036401 Bacteria 2323
168 Ga0373937_0202706 3300036401 Bacteria 1865
169 Ga0373937_0272688 3300036401 Bacteria 1597
170 Ga0373925_0001137 3300037068 Bacteria 23632
171 Ga0373925_0236587 3300037068 Bacteria 1462
172 Ga0436360_0451404 3300039438 Bacteria 1276
173 Ga0436363_1141063 3300039450 Bacteria 944
174 Ga0439442_093654 3300042002 Bacteria 647
175 Ga0439462_0141934 3300042015 Bacteria 673
176 Ga0439434_0039280 3300042435 Bacteria 1452
177 Ga0451577_0998627 3300042876 Bacteria 751
178 Ga0453684_0642786 3300044712 Bacteria 1158
179 Ga0453684_0843112 3300044712 Bacteria 985
180 Ga0451576_0001254 3300045051 Bacteria 44591
181 Ga0451576_0099425 3300045051 Bacteria 3026
182 Ga0466967_0567368 3300045976 Bacteria 1118
183 Ga0495580_0067028 3300046472 Bacteria 2512
184 Ga0495580_0322610 3300046472 Bacteria 1050
185 Ga0495582_0724341 3300046473 Unclassified 576
186 Ga0495628_1154345 3300046516 Unclassified 527
187 Ga0495630_0077894 3300046517 Bacteria 2499
188 Ga0495630_0170869 3300046517 Unclassified 1656
189 Ga0495666_0459614 3300046526 Unclassified 570
190 Ga0495669_0135044 3300046684 Bacteria 1163
191 Ga0495624_0196587 3300046690 Unclassified 1226
192 Ga0495604_0561952 3300047317 Unclassified 735
193 Ga0495674_0041638 3300047319 Bacteria 4102
194 Ga0495602_0169459 3300048088 Bacteria 1696
195 Ga0496100_1142071 3300048903 Unclassified 614
196 Ga0496102_0001124 3300048905 Bacteria 24542
197 Ga0496102_0330343 3300048905 Bacteria 1436
198 Ga0496103_0103235 3300048906 Unclassified 1806
199 Ga0496104_0382116 3300048907 Bacteria 1321
200 Ga0496104_1738391 3300048907 Unclassified 526
201 Ga0496106_0015050 3300048909 Bacteria 5725
202 Ga0496108_0607184 3300048911 Bacteria 953
203 Ga0496109_0338572 3300048912 Bacteria 1421
204 Ga0496112_0034915 3300048915 Bacteria 4894
205 Ga0496112_0207094 3300048915 Bacteria 1919
206 Ga0496113_0260722 3300048916 Bacteria 1385
207 Ga0501039_0173158 3300049575 Bacteria 1697
208 Ga0501040_0728160 3300049576 Bacteria 717
209 Ga0501041_0017571 3300049577 Bacteria 4257
210 Ga0501042_0131201 3300049578 Bacteria 1806
211 Ga0501048_0335837 3300049582 Bacteria 1077
212 Ga0501067_0077603 3300049583 Bacteria 1841
213 Ga0501071_0350875 3300049587 Bacteria 1123
214 Ga0501072_0090021 3300049588 Bacteria 2436
215 Ga0501074_0212512 3300049590 Bacteria 1378
216 Ga0501075_0034654 3300049591 Bacteria 3760
217 Ga0501080_0133208 3300049742 Bacteria 2301
218 Ga0501081_0192219 3300049743 Bacteria 1478
219 Ga0501081_0509057 3300049743 Bacteria 898
220 Ga0501083_0194882 3300049744 Bacteria 1322
221 Ga0501035_0368919 3300049822 Bacteria 1199
222 Ga0501045_0120905 3300049824 Bacteria 1945
223 nmdc:mga06r32_488616_c1 3300050510 Bacteria 1209
224 nmdc:mga0n895_60498_c1 3300050512 Bacteria 3737
225 nmdc:mga0rr50_734343_c1 3300050513 Unclassified 843
226 nmdc:mga08x19_156_c1 3300050514 Bacteria 56117
227 nmdc:mga0a205_206201_c1 3300050515 Bacteria 1855
228 Ga0501084_0106228 3300054114 Bacteria 2359
229 Ga0530510_0718788 3300061734 Bacteria 761

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046517 Ga0495630_0170869 Ga0495630_0170869_765_1217 113
2 3300007076 Ga0075435_100802675 Ga0075435_1008026751 116
3 3300050513 nmdc:mga0rr50_734343_c1 nmdc:mga0rr50_734343_c1_324_788 116
4 3300050514 nmdc:mga08x19_156_c1 nmdc:mga08x19_156_c1_31901_32365 116
5 3300035083 Ga0373926_0000118 Ga0373926_0000118_12546_13010 117
6 3300035725 Ga0373947_0014254 Ga0373947_0014254_1179_1643 117
7 3300037068 Ga0373925_0001137 Ga0373925_0001137_1151_1615 117
8 3300046526 Ga0495666_0459614 Ga0495666_0459614_147_560 117
9 3300046690 Ga0495624_0196587 Ga0495624_0196587_381_845 117
10 3300005364 Ga0070673_100338292 Ga0070673_1003382922 119
11 3300046473 Ga0495582_0724341 Ga0495582_0724341_94_531 119
12 3300005549 Ga0070704_100118054 Ga0070704_1001180542 122
13 3300005719 Ga0068861_100652579 Ga0068861_1006525792 122
14 3300005844 Ga0068862_100032348 Ga0068862_1000323482 122
15 3300009148 Ga0105243_10040666 Ga0105243_100406663 122
16 3300014326 Ga0157380_10471174 Ga0157380_104711742 122
17 3300025961 Ga0207712_10772776 Ga0207712_107727762 122
18 3300026118 Ga0207675_101721541 Ga0207675_1017215411 122
19 3300028380 Ga0268265_10070397 Ga0268265_100703972 122
20 3300048905 Ga0496102_0330343 Ga0496102_0330343_956_1414 122
21 3300005327 Ga0070658_11001676 Ga0070658_110016762 124
22 3300005328 Ga0070676_10130325 Ga0070676_101303253 124
23 3300005328 Ga0070676_10603563 Ga0070676_106035631 124
24 3300005347 Ga0070668_100050566 Ga0070668_1000505663 124
25 3300005356 Ga0070674_101080764 Ga0070674_1010807641 124
26 3300005366 Ga0070659_101028841 Ga0070659_1010288412 124
27 3300005459 Ga0068867_100100690 Ga0068867_1001006902 124
28 3300005539 Ga0068853_100053309 Ga0068853_1000533091 124
29 3300005543 Ga0070672_100058070 Ga0070672_1000580702 124
30 3300005578 Ga0068854_100970148 Ga0068854_1009701482 124
31 3300005718 Ga0068866_10877614 Ga0068866_108776141 124
32 3300005843 Ga0068860_100148944 Ga0068860_1001489444 124
33 3300006881 Ga0068865_100020051 Ga0068865_1000200513 124
34 3300009148 Ga0105243_10923896 Ga0105243_109238961 124
35 3300009176 Ga0105242_10196933 Ga0105242_101969331 124
36 3300009177 Ga0105248_10747561 Ga0105248_107475613 124
37 3300013297 Ga0157378_12629668 Ga0157378_126296681 124
38 3300013307 Ga0157372_12237249 Ga0157372_122372492 124
39 3300013308 Ga0157375_10419280 Ga0157375_104192802 124
40 3300017792 Ga0163161_10856318 Ga0163161_108563182 124
41 3300025899 Ga0207642_10692214 Ga0207642_106922141 124
42 3300025907 Ga0207645_10003939 Ga0207645_100039393 124
43 3300025907 Ga0207645_10429728 Ga0207645_104297281 124
44 3300025919 Ga0207657_10997343 Ga0207657_109973431 124
45 3300025927 Ga0207687_10399717 Ga0207687_103997173 124
46 3300025934 Ga0207686_10505033 Ga0207686_105050332 124
47 3300025937 Ga0207669_10166274 Ga0207669_101662742 124
48 3300025938 Ga0207704_10043206 Ga0207704_100432062 124
49 3300025939 Ga0207665_11629019 Ga0207665_116290191 124
50 3300025940 Ga0207691_10035226 Ga0207691_100352264 124
51 3300025941 Ga0207711_10789989 Ga0207711_107899892 124
52 3300025972 Ga0207668_10546815 Ga0207668_105468152 124
53 3300026041 Ga0207639_10266517 Ga0207639_102665171 124
54 3300026089 Ga0207648_10108917 Ga0207648_101089171 124
55 3300028381 Ga0268264_11126268 Ga0268264_111262681 124
56 3300046684 Ga0495669_0135044 Ga0495669_0135044_444_884 124
57 3300048907 Ga0496104_1738391 Ga0496104_1738391_17_457 124
58 3300049743 Ga0501081_0509057 Ga0501081_0509057_36_494 124
59 3300054114 Ga0501084_0106228 Ga0501084_0106228_608_1066 124
60 3300005340 Ga0070689_101453002 Ga0070689_1014530021 125
61 3300005455 Ga0070663_100169598 Ga0070663_1001695982 125
62 3300005535 Ga0070684_100067291 Ga0070684_1000672912 125
63 3300005564 Ga0070664_100067041 Ga0070664_1000670412 125
64 3300005618 Ga0068864_100128412 Ga0068864_1001284123 125
65 3300011119 Ga0105246_11196633 Ga0105246_111966332 125
66 3300013296 Ga0157374_11371093 Ga0157374_113710931 125
67 3300025321 Ga0207656_10376537 Ga0207656_103765372 125
68 3300025909 Ga0207705_10683688 Ga0207705_106836882 125
69 3300025944 Ga0207661_10037421 Ga0207661_100374215 125
70 3300025945 Ga0207679_10101642 Ga0207679_101016423 125
71 3300026067 Ga0207678_10449748 Ga0207678_104497482 125
72 3300031250 Ga0265331_10106868 Ga0265331_101068682 125
73 3300031711 Ga0265314_10290117 Ga0265314_102901172 125
74 3300031712 Ga0265342_10258408 Ga0265342_102584081 125
75 3300035118 Ga0373954_0012746 Ga0373954_0012746_2053_2499 125
76 3300035119 Ga0373956_0246562 Ga0373956_0246562_303_749 125
77 3300036401 Ga0373937_0133146 Ga0373937_0133146_1196_1642 125
78 3300048903 Ga0496100_1142071 Ga0496100_1142071_43_486 125
79 3300048912 Ga0496109_0338572 Ga0496109_0338572_132_575 125
80 3300035695 Ga0373927_0086296 Ga0373927_0086296_538_993 126
81 3300045051 Ga0451576_0001254 Ga0451576_0001254_1482_1943 126
82 3300045051 Ga0451576_0099425 Ga0451576_0099425_618_1079 126
83 2162886012 MBSR1b_contig_11879921 MBSR1b_0325.00001020 127
84 2162886012 MBSR1b_contig_9497042 MBSR1b_0669.00007230 127
85 3300003320 rootH2_10062296 rootH2_100622968 127
86 3300003578 Ga0006562J51391_1017864 Ga0006562J51391_10178642 127
87 3300005293 Ga0065715_10196225 Ga0065715_101962253 127
88 3300005295 Ga0065707_10472062 Ga0065707_104720621 127
89 3300005327 Ga0070658_10032958 Ga0070658_100329582 127
90 3300005328 Ga0070676_10076776 Ga0070676_100767762 127
91 3300005329 Ga0070683_100005696 Ga0070683_1000056964 127
92 3300005333 Ga0070677_10783774 Ga0070677_107837741 127
93 3300005339 Ga0070660_100181418 Ga0070660_1001814182 127
94 3300005344 Ga0070661_100026240 Ga0070661_1000262402 127
95 3300005366 Ga0070659_100749968 Ga0070659_1007499682 127
96 3300005367 Ga0070667_100093618 Ga0070667_1000936182 127
97 3300005406 Ga0070703_10002846 Ga0070703_100028461 127
98 3300005434 Ga0070709_10034809 Ga0070709_100348092 127
99 3300005439 Ga0070711_100043758 Ga0070711_1000437583 127
100 3300005440 Ga0070705_100014861 Ga0070705_1000148612 127
101 3300005444 Ga0070694_100119948 Ga0070694_1001199482 127
102 3300005444 Ga0070694_101005978 Ga0070694_1010059781 127
103 3300005445 Ga0070708_100012038 Ga0070708_1000120385 127
104 3300005445 Ga0070708_100450030 Ga0070708_1004500302 127
105 3300005457 Ga0070662_100345529 Ga0070662_1003455292 127
106 3300005457 Ga0070662_100641565 Ga0070662_1006415652 127
107 3300005458 Ga0070681_10269169 Ga0070681_102691692 127
108 3300005458 Ga0070681_10420721 Ga0070681_104207212 127
109 3300005467 Ga0070706_100040854 Ga0070706_1000408542 127
110 3300005518 Ga0070699_100021279 Ga0070699_1000212792 127
111 3300005518 Ga0070699_100086828 Ga0070699_1000868281 127
112 3300005535 Ga0070684_100061774 Ga0070684_1000617744 127
113 3300005536 Ga0070697_100001400 Ga0070697_10000140016 127
114 3300005536 Ga0070697_100668185 Ga0070697_1006681852 127
115 3300005536 Ga0070697_101492490 Ga0070697_1014924902 127
116 3300005543 Ga0070672_100879867 Ga0070672_1008798672 127
117 3300005545 Ga0070695_100004068 Ga0070695_1000040682 127
118 3300005545 Ga0070695_100051441 Ga0070695_1000514413 127
119 3300005546 Ga0070696_100005613 Ga0070696_1000056134 127
120 3300005546 Ga0070696_100160418 Ga0070696_1001604183 127
121 3300005546 Ga0070696_100546368 Ga0070696_1005463682 127
122 3300005547 Ga0070693_100001165 Ga0070693_1000011657 127
123 3300005564 Ga0070664_100459905 Ga0070664_1004599052 127
124 3300005564 Ga0070664_100490409 Ga0070664_1004904092 127
125 3300005564 Ga0070664_100584570 Ga0070664_1005845701 127
126 3300005577 Ga0068857_100003022 Ga0068857_1000030224 127
127 3300005616 Ga0068852_100425192 Ga0068852_1004251922 127
128 3300005618 Ga0068864_100083699 Ga0068864_1000836992 127
129 3300005718 Ga0068866_10828329 Ga0068866_108283292 127
130 3300005843 Ga0068860_100005502 Ga0068860_1000055026 127
131 3300005937 Ga0081455_10009745 Ga0081455_100097455 127
132 3300006173 Ga0070716_100107023 Ga0070716_1001070232 127
133 3300006173 Ga0070716_100895356 Ga0070716_1008953561 127
134 3300006844 Ga0075428_100023023 Ga0075428_1000230231 127
135 3300006846 Ga0075430_100102066 Ga0075430_1001020662 127
136 3300006847 Ga0075431_100593976 Ga0075431_1005939761 127
137 3300006852 Ga0075433_10090612 Ga0075433_100906122 127
138 3300006871 Ga0075434_100008746 Ga0075434_1000087468 127
139 3300007265 Ga0099794_10231624 Ga0099794_102316242 127
140 3300007788 Ga0099795_10122335 Ga0099795_101223352 127
141 3300009094 Ga0111539_10102406 Ga0111539_101024063 127
142 3300009101 Ga0105247_11180564 Ga0105247_111805641 127
143 3300009177 Ga0105248_10534689 Ga0105248_105346892 127
144 3300009553 Ga0105249_10041223 Ga0105249_100412232 127
145 3300010375 Ga0105239_10886063 Ga0105239_108860632 127
146 3300013297 Ga0157378_10000036 Ga0157378_1000003683 127
147 3300013306 Ga0163162_10033984 Ga0163162_100339844 127
148 3300013308 Ga0157375_10043301 Ga0157375_100433012 127
149 3300013308 Ga0157375_10266357 Ga0157375_102663573 127
150 3300021441 Ga0213871_10077518 Ga0213871_100775182 127
151 3300025885 Ga0207653_10004825 Ga0207653_100048252 127
152 3300025906 Ga0207699_10079819 Ga0207699_100798192 127
153 3300025906 Ga0207699_10131726 Ga0207699_101317262 127
154 3300025906 Ga0207699_10211446 Ga0207699_102114462 127
155 3300025907 Ga0207645_10053182 Ga0207645_100531822 127
156 3300025910 Ga0207684_10840044 Ga0207684_108400442 127
157 3300025916 Ga0207663_10066747 Ga0207663_100667474 127
158 3300025919 Ga0207657_10109016 Ga0207657_101090163 127
159 3300025920 Ga0207649_10204885 Ga0207649_102048852 127
160 3300025921 Ga0207652_10024792 Ga0207652_100247922 127
161 3300025932 Ga0207690_10259759 Ga0207690_102597592 127
162 3300025933 Ga0207706_10136448 Ga0207706_101364482 127
163 3300025933 Ga0207706_10633351 Ga0207706_106333512 127
164 3300025939 Ga0207665_10354633 Ga0207665_103546332 127
165 3300025939 Ga0207665_10812346 Ga0207665_108123462 127
166 3300025941 Ga0207711_10680000 Ga0207711_106800002 127
167 3300025944 Ga0207661_10033429 Ga0207661_100334292 127
168 3300025945 Ga0207679_10261917 Ga0207679_102619172 127
169 3300025945 Ga0207679_10334879 Ga0207679_103348791 127
170 3300025972 Ga0207668_11036322 Ga0207668_110363221 127
171 3300025986 Ga0207658_10064409 Ga0207658_100644092 127
172 3300025986 Ga0207658_11708990 Ga0207658_117089901 127
173 3300026088 Ga0207641_11667573 Ga0207641_116675731 127
174 3300026116 Ga0207674_10002317 Ga0207674_1000231725 127
175 3300026142 Ga0207698_10188679 Ga0207698_101886792 127
176 3300028381 Ga0268264_10102567 Ga0268264_101025671 127
177 3300031247 Ga0265340_10256819 Ga0265340_102568191 127
178 3300031824 Ga0307413_10188831 Ga0307413_101888312 127
179 3300031852 Ga0307410_10099094 Ga0307410_100990943 127
180 3300035118 Ga0373954_0014354 Ga0373954_0014354_1683_2147 127
181 3300035119 Ga0373956_0249768 Ga0373956_0249768_85_549 127
182 3300035172 Ga0373955_0034945 Ga0373955_0034945_107_571 127
183 3300035724 Ga0373933_0325517 Ga0373933_0325517_475_939 127
184 3300036401 Ga0373937_0202706 Ga0373937_0202706_968_1432 127
185 3300036401 Ga0373937_0272688 Ga0373937_0272688_1141_1587 127
186 3300037068 Ga0373925_0236587 Ga0373925_0236587_314_778 127
187 3300039438 Ga0436360_0451404 Ga0436360_0451404_162_674 127
188 3300039450 Ga0436363_1141063 Ga0436363_1141063_276_788 127
189 3300042002 Ga0439442_093654 Ga0439442_093654_36_524 127
190 3300042015 Ga0439462_0141934 Ga0439462_0141934_172_660 127
191 3300042435 Ga0439434_0039280 Ga0439434_0039280_329_817 127
192 3300042876 Ga0451577_0998627 Ga0451577_0998627_76_534 127
193 3300044712 Ga0453684_0642786 Ga0453684_0642786_225_683 127
194 3300044712 Ga0453684_0843112 Ga0453684_0843112_575_958 127
195 3300045976 Ga0466967_0567368 Ga0466967_0567368_312_767 127
196 3300046472 Ga0495580_0067028 Ga0495580_0067028_21_485 127
197 3300046472 Ga0495580_0322610 Ga0495580_0322610_286_744 127
198 3300046516 Ga0495628_1154345 Ga0495628_1154345_23_406 127
199 3300046517 Ga0495630_0077894 Ga0495630_0077894_377_829 127
200 3300047317 Ga0495604_0561952 Ga0495604_0561952_115_579 127
201 3300047319 Ga0495674_0041638 Ga0495674_0041638_2353_2817 127
202 3300048088 Ga0495602_0169459 Ga0495602_0169459_13_396 127
203 3300048905 Ga0496102_0001124 Ga0496102_0001124_23878_24261 127
204 3300048906 Ga0496103_0103235 Ga0496103_0103235_1315_1698 127
205 3300048907 Ga0496104_0382116 Ga0496104_0382116_656_1105 127
206 3300048909 Ga0496106_0015050 Ga0496106_0015050_597_980 127
207 3300048911 Ga0496108_0607184 Ga0496108_0607184_288_737 127
208 3300048915 Ga0496112_0034915 Ga0496112_0034915_4387_4836 127
209 3300048915 Ga0496112_0207094 Ga0496112_0207094_626_1075 127
210 3300048916 Ga0496113_0260722 Ga0496113_0260722_530_979 127
211 3300049575 Ga0501039_0173158 Ga0501039_0173158_613_1068 127
212 3300049576 Ga0501040_0728160 Ga0501040_0728160_174_629 127
213 3300049577 Ga0501041_0017571 Ga0501041_0017571_404_862 127
214 3300049578 Ga0501042_0131201 Ga0501042_0131201_141_596 127
215 3300049582 Ga0501048_0335837 Ga0501048_0335837_555_1010 127
216 3300049583 Ga0501067_0077603 Ga0501067_0077603_85_534 127
217 3300049587 Ga0501071_0350875 Ga0501071_0350875_15_470 127
218 3300049588 Ga0501072_0090021 Ga0501072_0090021_1546_2001 127
219 3300049590 Ga0501074_0212512 Ga0501074_0212512_414_869 127
220 3300049591 Ga0501075_0034654 Ga0501075_0034654_1663_2121 127
221 3300049742 Ga0501080_0133208 Ga0501080_0133208_135_590 127
222 3300049743 Ga0501081_0192219 Ga0501081_0192219_71_529 127
223 3300049744 Ga0501083_0194882 Ga0501083_0194882_337_786 127
224 3300049822 Ga0501035_0368919 Ga0501035_0368919_128_586 127
225 3300049824 Ga0501045_0120905 Ga0501045_0120905_914_1369 127
226 3300050510 nmdc:mga06r32_488616_c1 nmdc:mga06r32_488616_c1_636_1097 127
227 3300050512 nmdc:mga0n895_60498_c1 nmdc:mga0n895_60498_c1_1592_2053 127
228 3300050515 nmdc:mga0a205_206201_c1 nmdc:mga0a205_206201_c1_979_1440 127
229 3300061734 Ga0530510_0718788 Ga0530510_0718788_55_510 127
230 iso_pu_bacteria 2854911287 2854914998 127
231 iso_pu_bacteria 2915650412 2915654328 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

62

138

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e1e-assembly1.cif.gz_B crystal structure of a thioesterase family protein from silicibacter pomeroyi. northeast structural genomics target sir180a 0.9721 1 121
3nwz-assembly2.cif.gz_C crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.9472 17 119
3nwz-assembly3.cif.gz_D crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 0.94 18 119
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.9311 2 119
4ybv-assembly1.cif.gz_D crystal structure of mutant of (q32a) thioesterase enzyme sav0944 from staphylococcus aureus subsp. aureus mu50 0.9246 2 120
ID Description Score Start End Superfamily
3e1eD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9709 1 121 3.10.129.10
3dkzB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9302 2 119 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.922 2 120 3.10.129.10
1sbkA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9194 2 120 3.10.129.10
3e1eD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9189 1 121 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2S6R8W1-F1-model_v4 Thioesterase domain-containing protein 0.9812 2 119 GO:0047617
AF-A0A364NY55-F1-model_v4 Medium/long-chain acyl-CoA thioesterase YigI (EC 3.1.2.20) 0.9789 1 119 GO:0016289
AF-A0A7V9UPY1-F1-model_v4 Medium/long-chain acyl-CoA thioesterase YigI (EC 3.1.2.20) 0.9787 1 119 GO:0016289
AF-A0A176FA14-F1-model_v4 Medium/long-chain acyl-CoA thioesterase YigI (EC 3.1.2.20) 0.9787 1 121 GO:0016289
AF-A0A1H3VV27-F1-model_v4 Medium/long-chain acyl-CoA thioesterase YigI (EC 3.1.2.20) 0.9786 1 120 GO:0016289

Feature Viewer

pLDDT pTM Quality
94.79 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map