F344088
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 231 | 174 | 229 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300021441|Ga0213871_10077518|Ga0213871_100775182 |
| Length | 170 |
| Sequence | MLHDLAVAEPTWSPRNPDFEARVRDNFARQGFMGLVGAELDTVAPGRCVLSIGFRPALTQQHGYFHGGLIGTLADMAAGFAAFTLADADTSILTVEYKLNLLEPGQGERLLADARVMRGGKRVSVCQADVWTLDGPRRTRCAVALATLMLLPGRSDHGPPTGSAGPSQRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 3 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 59 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 76 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 111 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 112 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 114 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 115 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 116 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 117 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 118 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 120 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 121 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 122 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 123 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 124 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 126 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 127 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 128 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 129 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 130 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 131 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 132 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 133 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 134 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 146 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 147 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 148 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 149 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 152 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 153 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.7 |
| Metatranscriptomes | 0.43 |
| Isolates | 0.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.19 |
| Rhizosphere | 93.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_11879921 | 2162886012 | Unclassified | 1387 |
| 2 | MBSR1b_contig_9497042 | 2162886012 | Unclassified | 1353 |
| 3 | rootH2_10062296 | 3300003320 | Bacteria | 5824 |
| 4 | Ga0006562J51391_1017864 | 3300003578 | Bacteria | 3420 |
| 5 | Ga0065715_10196225 | 3300005293 | Unclassified | 1386 |
| 6 | Ga0065707_10472062 | 3300005295 | Bacteria | 781 |
| 7 | Ga0070658_10032958 | 3300005327 | Bacteria | 4166 |
| 8 | Ga0070658_11001676 | 3300005327 | Bacteria | 727 |
| 9 | Ga0070676_10076776 | 3300005328 | Bacteria | 2018 |
| 10 | Ga0070676_10130325 | 3300005328 | Bacteria | 1589 |
| 11 | Ga0070676_10603563 | 3300005328 | Bacteria | 792 |
| 12 | Ga0070683_100005696 | 3300005329 | Bacteria | 10406 |
| 13 | Ga0070677_10783774 | 3300005333 | Bacteria | 543 |
| 14 | Ga0070660_100181418 | 3300005339 | Bacteria | 1703 |
| 15 | Ga0070689_101453002 | 3300005340 | Bacteria | 620 |
| 16 | Ga0070661_100026240 | 3300005344 | Bacteria | 4188 |
| 17 | Ga0070668_100050566 | 3300005347 | Bacteria | 3200 |
| 18 | Ga0070674_101080764 | 3300005356 | Bacteria | 708 |
| 19 | Ga0070673_100338292 | 3300005364 | Bacteria | 1333 |
| 20 | Ga0070659_100749968 | 3300005366 | Bacteria | 847 |
| 21 | Ga0070659_101028841 | 3300005366 | Unclassified | 724 |
| 22 | Ga0070667_100093618 | 3300005367 | Bacteria | 2588 |
| 23 | Ga0070703_10002846 | 3300005406 | Bacteria | 4952 |
| 24 | Ga0070709_10034809 | 3300005434 | Bacteria | 3057 |
| 25 | Ga0070711_100043758 | 3300005439 | Bacteria | 3035 |
| 26 | Ga0070705_100014861 | 3300005440 | Bacteria | 4015 |
| 27 | Ga0070694_100119948 | 3300005444 | Bacteria | 1886 |
| 28 | Ga0070694_101005978 | 3300005444 | Unclassified | 692 |
| 29 | Ga0070708_100012038 | 3300005445 | Bacteria | 7052 |
| 30 | Ga0070708_100450030 | 3300005445 | Unclassified | 1215 |
| 31 | Ga0070663_100169598 | 3300005455 | Bacteria | 1686 |
| 32 | Ga0070662_100345529 | 3300005457 | Bacteria | 1218 |
| 33 | Ga0070662_100641565 | 3300005457 | Unclassified | 895 |
| 34 | Ga0070681_10269169 | 3300005458 | Bacteria | 1615 |
| 35 | Ga0070681_10420721 | 3300005458 | Bacteria | 1248 |
| 36 | Ga0068867_100100690 | 3300005459 | Bacteria | 2206 |
| 37 | Ga0070706_100040854 | 3300005467 | Bacteria | 4282 |
| 38 | Ga0070699_100021279 | 3300005518 | Bacteria | 5593 |
| 39 | Ga0070699_100086828 | 3300005518 | Bacteria | 2731 |
| 40 | Ga0070684_100061774 | 3300005535 | Bacteria | 3280 |
| 41 | Ga0070684_100067291 | 3300005535 | Bacteria | 3146 |
| 42 | Ga0070697_100001400 | 3300005536 | Bacteria | 18281 |
| 43 | Ga0070697_100668185 | 3300005536 | Bacteria | 915 |
| 44 | Ga0070697_101492490 | 3300005536 | Bacteria | 604 |
| 45 | Ga0068853_100053309 | 3300005539 | Unclassified | 3483 |
| 46 | Ga0070672_100058070 | 3300005543 | Bacteria | 3039 |
| 47 | Ga0070672_100879867 | 3300005543 | Bacteria | 791 |
| 48 | Ga0070695_100004068 | 3300005545 | Bacteria | 8558 |
| 49 | Ga0070695_100051441 | 3300005545 | Unclassified | 2644 |
| 50 | Ga0070696_100005613 | 3300005546 | Bacteria | 8376 |
| 51 | Ga0070696_100160418 | 3300005546 | Bacteria | 1656 |
| 52 | Ga0070696_100546368 | 3300005546 | Bacteria | 928 |
| 53 | Ga0070693_100001165 | 3300005547 | Bacteria | 11815 |
| 54 | Ga0070704_100118054 | 3300005549 | Unclassified | 2031 |
| 55 | Ga0070664_100067041 | 3300005564 | Bacteria | 3067 |
| 56 | Ga0070664_100459905 | 3300005564 | Bacteria | 1169 |
| 57 | Ga0070664_100490409 | 3300005564 | Bacteria | 1131 |
| 58 | Ga0070664_100584570 | 3300005564 | Bacteria | 1035 |
| 59 | Ga0068857_100003022 | 3300005577 | Bacteria | 13897 |
| 60 | Ga0068854_100970148 | 3300005578 | Unclassified | 751 |
| 61 | Ga0068852_100425192 | 3300005616 | Bacteria | 1311 |
| 62 | Ga0068864_100083699 | 3300005618 | Bacteria | 2802 |
| 63 | Ga0068864_100128412 | 3300005618 | Bacteria | 2274 |
| 64 | Ga0068866_10828329 | 3300005718 | Unclassified | 645 |
| 65 | Ga0068866_10877614 | 3300005718 | Bacteria | 629 |
| 66 | Ga0068861_100652579 | 3300005719 | Bacteria | 972 |
| 67 | Ga0068860_100005502 | 3300005843 | Bacteria | 12825 |
| 68 | Ga0068860_100148944 | 3300005843 | Bacteria | 2253 |
| 69 | Ga0068862_100032348 | 3300005844 | Bacteria | 4419 |
| 70 | Ga0081455_10009745 | 3300005937 | Bacteria | 9841 |
| 71 | Ga0070716_100107023 | 3300006173 | Bacteria | 1726 |
| 72 | Ga0070716_100895356 | 3300006173 | Unclassified | 694 |
| 73 | Ga0075428_100023023 | 3300006844 | Bacteria | 6894 |
| 74 | Ga0075430_100102066 | 3300006846 | Bacteria | 2394 |
| 75 | Ga0075431_100593976 | 3300006847 | Bacteria | 1092 |
| 76 | Ga0075433_10090612 | 3300006852 | Bacteria | 2703 |
| 77 | Ga0075434_100008746 | 3300006871 | Bacteria | 9420 |
| 78 | Ga0068865_100020051 | 3300006881 | Bacteria | 4335 |
| 79 | Ga0075435_100802675 | 3300007076 | Unclassified | 819 |
| 80 | Ga0099794_10231624 | 3300007265 | Unclassified | 950 |
| 81 | Ga0099795_10122335 | 3300007788 | Bacteria | 1042 |
| 82 | Ga0111539_10102406 | 3300009094 | Bacteria | 3361 |
| 83 | Ga0105247_11180564 | 3300009101 | Bacteria | 608 |
| 84 | Ga0105243_10040666 | 3300009148 | Unclassified | 3632 |
| 85 | Ga0105243_10923896 | 3300009148 | Unclassified | 870 |
| 86 | Ga0105242_10196933 | 3300009176 | Bacteria | 1787 |
| 87 | Ga0105248_10534689 | 3300009177 | Unclassified | 1322 |
| 88 | Ga0105248_10747561 | 3300009177 | Unclassified | 1103 |
| 89 | Ga0105249_10041223 | 3300009553 | Bacteria | 4196 |
| 90 | Ga0105239_10886063 | 3300010375 | Unclassified | 1024 |
| 91 | Ga0105246_11196633 | 3300011119 | Bacteria | 699 |
| 92 | Ga0157374_11371093 | 3300013296 | Unclassified | 730 |
| 93 | Ga0157378_10000036 | 3300013297 | Bacteria | 117422 |
| 94 | Ga0157378_12629668 | 3300013297 | Bacteria | 556 |
| 95 | Ga0163162_10033984 | 3300013306 | Bacteria | 5071 |
| 96 | Ga0157372_12237249 | 3300013307 | Unclassified | 628 |
| 97 | Ga0157375_10043301 | 3300013308 | Bacteria | 4365 |
| 98 | Ga0157375_10266357 | 3300013308 | Bacteria | 1875 |
| 99 | Ga0157375_10419280 | 3300013308 | Bacteria | 1505 |
| 100 | Ga0157380_10471174 | 3300014326 | Bacteria | 1212 |
| 101 | Ga0163161_10856318 | 3300017792 | Bacteria | 767 |
| 102 | Ga0213871_10077518 | 3300021441 | Bacteria | 948 |
| 103 | Ga0207656_10376537 | 3300025321 | Bacteria | 711 |
| 104 | Ga0207653_10004825 | 3300025885 | Bacteria | 4217 |
| 105 | Ga0207642_10692214 | 3300025899 | Bacteria | 642 |
| 106 | Ga0207699_10079819 | 3300025906 | Unclassified | 2025 |
| 107 | Ga0207699_10131726 | 3300025906 | Bacteria | 1632 |
| 108 | Ga0207699_10211446 | 3300025906 | Bacteria | 1319 |
| 109 | Ga0207645_10003939 | 3300025907 | Bacteria | 11086 |
| 110 | Ga0207645_10053182 | 3300025907 | Bacteria | 2588 |
| 111 | Ga0207645_10429728 | 3300025907 | Bacteria | 890 |
| 112 | Ga0207705_10683688 | 3300025909 | Unclassified | 798 |
| 113 | Ga0207684_10840044 | 3300025910 | Bacteria | 775 |
| 114 | Ga0207663_10066747 | 3300025916 | Bacteria | 2304 |
| 115 | Ga0207657_10109016 | 3300025919 | Bacteria | 2289 |
| 116 | Ga0207657_10997343 | 3300025919 | Bacteria | 643 |
| 117 | Ga0207649_10204885 | 3300025920 | Bacteria | 1396 |
| 118 | Ga0207652_10024792 | 3300025921 | Bacteria | 4979 |
| 119 | Ga0207687_10399717 | 3300025927 | Unclassified | 1130 |
| 120 | Ga0207690_10259759 | 3300025932 | Bacteria | 1345 |
| 121 | Ga0207706_10136448 | 3300025933 | Bacteria | 2158 |
| 122 | Ga0207706_10633351 | 3300025933 | Unclassified | 917 |
| 123 | Ga0207686_10505033 | 3300025934 | Bacteria | 939 |
| 124 | Ga0207669_10166274 | 3300025937 | Bacteria | 1565 |
| 125 | Ga0207704_10043206 | 3300025938 | Bacteria | 2659 |
| 126 | Ga0207665_10354633 | 3300025939 | Bacteria | 1108 |
| 127 | Ga0207665_10812346 | 3300025939 | Unclassified | 739 |
| 128 | Ga0207665_11629019 | 3300025939 | Unclassified | 511 |
| 129 | Ga0207691_10035226 | 3300025940 | Bacteria | 4648 |
| 130 | Ga0207711_10680000 | 3300025941 | Unclassified | 960 |
| 131 | Ga0207711_10789989 | 3300025941 | Unclassified | 884 |
| 132 | Ga0207661_10033429 | 3300025944 | Bacteria | 3991 |
| 133 | Ga0207661_10037421 | 3300025944 | Bacteria | 3795 |
| 134 | Ga0207679_10101642 | 3300025945 | Bacteria | 2249 |
| 135 | Ga0207679_10261917 | 3300025945 | Bacteria | 1475 |
| 136 | Ga0207679_10334879 | 3300025945 | Bacteria | 1315 |
| 137 | Ga0207712_10772776 | 3300025961 | Unclassified | 843 |
| 138 | Ga0207668_10546815 | 3300025972 | Bacteria | 1002 |
| 139 | Ga0207668_11036322 | 3300025972 | Unclassified | 734 |
| 140 | Ga0207658_10064409 | 3300025986 | Bacteria | 2750 |
| 141 | Ga0207658_11708990 | 3300025986 | Unclassified | 575 |
| 142 | Ga0207639_10266517 | 3300026041 | Bacteria | 1500 |
| 143 | Ga0207678_10449748 | 3300026067 | Bacteria | 1119 |
| 144 | Ga0207641_11667573 | 3300026088 | Bacteria | 639 |
| 145 | Ga0207648_10108917 | 3300026089 | Bacteria | 2432 |
| 146 | Ga0207674_10002317 | 3300026116 | Bacteria | 24108 |
| 147 | Ga0207675_101721541 | 3300026118 | Unclassified | 647 |
| 148 | Ga0207698_10188679 | 3300026142 | Bacteria | 1834 |
| 149 | Ga0268265_10070397 | 3300028380 | Unclassified | 2720 |
| 150 | Ga0268264_10102567 | 3300028381 | Bacteria | 2489 |
| 151 | Ga0268264_11126268 | 3300028381 | Unclassified | 793 |
| 152 | Ga0265340_10256819 | 3300031247 | Unclassified | 778 |
| 153 | Ga0265331_10106868 | 3300031250 | Unclassified | 1285 |
| 154 | Ga0265314_10290117 | 3300031711 | Unclassified | 922 |
| 155 | Ga0265342_10258408 | 3300031712 | Unclassified | 927 |
| 156 | Ga0307413_10188831 | 3300031824 | Bacteria | 1477 |
| 157 | Ga0307410_10099094 | 3300031852 | Bacteria | 2085 |
| 158 | Ga0373926_0000118 | 3300035083 | Bacteria | 16022 |
| 159 | Ga0373954_0012746 | 3300035118 | Bacteria | 3743 |
| 160 | Ga0373954_0014354 | 3300035118 | Bacteria | 3533 |
| 161 | Ga0373956_0246562 | 3300035119 | Bacteria | 849 |
| 162 | Ga0373956_0249768 | 3300035119 | Bacteria | 843 |
| 163 | Ga0373955_0034945 | 3300035172 | Bacteria | 2659 |
| 164 | Ga0373927_0086296 | 3300035695 | Bacteria | 2037 |
| 165 | Ga0373933_0325517 | 3300035724 | Bacteria | 997 |
| 166 | Ga0373947_0014254 | 3300035725 | Unclassified | 4559 |
| 167 | Ga0373937_0133146 | 3300036401 | Bacteria | 2323 |
| 168 | Ga0373937_0202706 | 3300036401 | Bacteria | 1865 |
| 169 | Ga0373937_0272688 | 3300036401 | Bacteria | 1597 |
| 170 | Ga0373925_0001137 | 3300037068 | Bacteria | 23632 |
| 171 | Ga0373925_0236587 | 3300037068 | Bacteria | 1462 |
| 172 | Ga0436360_0451404 | 3300039438 | Bacteria | 1276 |
| 173 | Ga0436363_1141063 | 3300039450 | Bacteria | 944 |
| 174 | Ga0439442_093654 | 3300042002 | Bacteria | 647 |
| 175 | Ga0439462_0141934 | 3300042015 | Bacteria | 673 |
| 176 | Ga0439434_0039280 | 3300042435 | Bacteria | 1452 |
| 177 | Ga0451577_0998627 | 3300042876 | Bacteria | 751 |
| 178 | Ga0453684_0642786 | 3300044712 | Bacteria | 1158 |
| 179 | Ga0453684_0843112 | 3300044712 | Bacteria | 985 |
| 180 | Ga0451576_0001254 | 3300045051 | Bacteria | 44591 |
| 181 | Ga0451576_0099425 | 3300045051 | Bacteria | 3026 |
| 182 | Ga0466967_0567368 | 3300045976 | Bacteria | 1118 |
| 183 | Ga0495580_0067028 | 3300046472 | Bacteria | 2512 |
| 184 | Ga0495580_0322610 | 3300046472 | Bacteria | 1050 |
| 185 | Ga0495582_0724341 | 3300046473 | Unclassified | 576 |
| 186 | Ga0495628_1154345 | 3300046516 | Unclassified | 527 |
| 187 | Ga0495630_0077894 | 3300046517 | Bacteria | 2499 |
| 188 | Ga0495630_0170869 | 3300046517 | Unclassified | 1656 |
| 189 | Ga0495666_0459614 | 3300046526 | Unclassified | 570 |
| 190 | Ga0495669_0135044 | 3300046684 | Bacteria | 1163 |
| 191 | Ga0495624_0196587 | 3300046690 | Unclassified | 1226 |
| 192 | Ga0495604_0561952 | 3300047317 | Unclassified | 735 |
| 193 | Ga0495674_0041638 | 3300047319 | Bacteria | 4102 |
| 194 | Ga0495602_0169459 | 3300048088 | Bacteria | 1696 |
| 195 | Ga0496100_1142071 | 3300048903 | Unclassified | 614 |
| 196 | Ga0496102_0001124 | 3300048905 | Bacteria | 24542 |
| 197 | Ga0496102_0330343 | 3300048905 | Bacteria | 1436 |
| 198 | Ga0496103_0103235 | 3300048906 | Unclassified | 1806 |
| 199 | Ga0496104_0382116 | 3300048907 | Bacteria | 1321 |
| 200 | Ga0496104_1738391 | 3300048907 | Unclassified | 526 |
| 201 | Ga0496106_0015050 | 3300048909 | Bacteria | 5725 |
| 202 | Ga0496108_0607184 | 3300048911 | Bacteria | 953 |
| 203 | Ga0496109_0338572 | 3300048912 | Bacteria | 1421 |
| 204 | Ga0496112_0034915 | 3300048915 | Bacteria | 4894 |
| 205 | Ga0496112_0207094 | 3300048915 | Bacteria | 1919 |
| 206 | Ga0496113_0260722 | 3300048916 | Bacteria | 1385 |
| 207 | Ga0501039_0173158 | 3300049575 | Bacteria | 1697 |
| 208 | Ga0501040_0728160 | 3300049576 | Bacteria | 717 |
| 209 | Ga0501041_0017571 | 3300049577 | Bacteria | 4257 |
| 210 | Ga0501042_0131201 | 3300049578 | Bacteria | 1806 |
| 211 | Ga0501048_0335837 | 3300049582 | Bacteria | 1077 |
| 212 | Ga0501067_0077603 | 3300049583 | Bacteria | 1841 |
| 213 | Ga0501071_0350875 | 3300049587 | Bacteria | 1123 |
| 214 | Ga0501072_0090021 | 3300049588 | Bacteria | 2436 |
| 215 | Ga0501074_0212512 | 3300049590 | Bacteria | 1378 |
| 216 | Ga0501075_0034654 | 3300049591 | Bacteria | 3760 |
| 217 | Ga0501080_0133208 | 3300049742 | Bacteria | 2301 |
| 218 | Ga0501081_0192219 | 3300049743 | Bacteria | 1478 |
| 219 | Ga0501081_0509057 | 3300049743 | Bacteria | 898 |
| 220 | Ga0501083_0194882 | 3300049744 | Bacteria | 1322 |
| 221 | Ga0501035_0368919 | 3300049822 | Bacteria | 1199 |
| 222 | Ga0501045_0120905 | 3300049824 | Bacteria | 1945 |
| 223 | nmdc:mga06r32_488616_c1 | 3300050510 | Bacteria | 1209 |
| 224 | nmdc:mga0n895_60498_c1 | 3300050512 | Bacteria | 3737 |
| 225 | nmdc:mga0rr50_734343_c1 | 3300050513 | Unclassified | 843 |
| 226 | nmdc:mga08x19_156_c1 | 3300050514 | Bacteria | 56117 |
| 227 | nmdc:mga0a205_206201_c1 | 3300050515 | Bacteria | 1855 |
| 228 | Ga0501084_0106228 | 3300054114 | Bacteria | 2359 |
| 229 | Ga0530510_0718788 | 3300061734 | Bacteria | 761 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046517 | Ga0495630_0170869 | Ga0495630_0170869_765_1217 | 113 |
| 2 | 3300007076 | Ga0075435_100802675 | Ga0075435_1008026751 | 116 |
| 3 | 3300050513 | nmdc:mga0rr50_734343_c1 | nmdc:mga0rr50_734343_c1_324_788 | 116 |
| 4 | 3300050514 | nmdc:mga08x19_156_c1 | nmdc:mga08x19_156_c1_31901_32365 | 116 |
| 5 | 3300035083 | Ga0373926_0000118 | Ga0373926_0000118_12546_13010 | 117 |
| 6 | 3300035725 | Ga0373947_0014254 | Ga0373947_0014254_1179_1643 | 117 |
| 7 | 3300037068 | Ga0373925_0001137 | Ga0373925_0001137_1151_1615 | 117 |
| 8 | 3300046526 | Ga0495666_0459614 | Ga0495666_0459614_147_560 | 117 |
| 9 | 3300046690 | Ga0495624_0196587 | Ga0495624_0196587_381_845 | 117 |
| 10 | 3300005364 | Ga0070673_100338292 | Ga0070673_1003382922 | 119 |
| 11 | 3300046473 | Ga0495582_0724341 | Ga0495582_0724341_94_531 | 119 |
| 12 | 3300005549 | Ga0070704_100118054 | Ga0070704_1001180542 | 122 |
| 13 | 3300005719 | Ga0068861_100652579 | Ga0068861_1006525792 | 122 |
| 14 | 3300005844 | Ga0068862_100032348 | Ga0068862_1000323482 | 122 |
| 15 | 3300009148 | Ga0105243_10040666 | Ga0105243_100406663 | 122 |
| 16 | 3300014326 | Ga0157380_10471174 | Ga0157380_104711742 | 122 |
| 17 | 3300025961 | Ga0207712_10772776 | Ga0207712_107727762 | 122 |
| 18 | 3300026118 | Ga0207675_101721541 | Ga0207675_1017215411 | 122 |
| 19 | 3300028380 | Ga0268265_10070397 | Ga0268265_100703972 | 122 |
| 20 | 3300048905 | Ga0496102_0330343 | Ga0496102_0330343_956_1414 | 122 |
| 21 | 3300005327 | Ga0070658_11001676 | Ga0070658_110016762 | 124 |
| 22 | 3300005328 | Ga0070676_10130325 | Ga0070676_101303253 | 124 |
| 23 | 3300005328 | Ga0070676_10603563 | Ga0070676_106035631 | 124 |
| 24 | 3300005347 | Ga0070668_100050566 | Ga0070668_1000505663 | 124 |
| 25 | 3300005356 | Ga0070674_101080764 | Ga0070674_1010807641 | 124 |
| 26 | 3300005366 | Ga0070659_101028841 | Ga0070659_1010288412 | 124 |
| 27 | 3300005459 | Ga0068867_100100690 | Ga0068867_1001006902 | 124 |
| 28 | 3300005539 | Ga0068853_100053309 | Ga0068853_1000533091 | 124 |
| 29 | 3300005543 | Ga0070672_100058070 | Ga0070672_1000580702 | 124 |
| 30 | 3300005578 | Ga0068854_100970148 | Ga0068854_1009701482 | 124 |
| 31 | 3300005718 | Ga0068866_10877614 | Ga0068866_108776141 | 124 |
| 32 | 3300005843 | Ga0068860_100148944 | Ga0068860_1001489444 | 124 |
| 33 | 3300006881 | Ga0068865_100020051 | Ga0068865_1000200513 | 124 |
| 34 | 3300009148 | Ga0105243_10923896 | Ga0105243_109238961 | 124 |
| 35 | 3300009176 | Ga0105242_10196933 | Ga0105242_101969331 | 124 |
| 36 | 3300009177 | Ga0105248_10747561 | Ga0105248_107475613 | 124 |
| 37 | 3300013297 | Ga0157378_12629668 | Ga0157378_126296681 | 124 |
| 38 | 3300013307 | Ga0157372_12237249 | Ga0157372_122372492 | 124 |
| 39 | 3300013308 | Ga0157375_10419280 | Ga0157375_104192802 | 124 |
| 40 | 3300017792 | Ga0163161_10856318 | Ga0163161_108563182 | 124 |
| 41 | 3300025899 | Ga0207642_10692214 | Ga0207642_106922141 | 124 |
| 42 | 3300025907 | Ga0207645_10003939 | Ga0207645_100039393 | 124 |
| 43 | 3300025907 | Ga0207645_10429728 | Ga0207645_104297281 | 124 |
| 44 | 3300025919 | Ga0207657_10997343 | Ga0207657_109973431 | 124 |
| 45 | 3300025927 | Ga0207687_10399717 | Ga0207687_103997173 | 124 |
| 46 | 3300025934 | Ga0207686_10505033 | Ga0207686_105050332 | 124 |
| 47 | 3300025937 | Ga0207669_10166274 | Ga0207669_101662742 | 124 |
| 48 | 3300025938 | Ga0207704_10043206 | Ga0207704_100432062 | 124 |
| 49 | 3300025939 | Ga0207665_11629019 | Ga0207665_116290191 | 124 |
| 50 | 3300025940 | Ga0207691_10035226 | Ga0207691_100352264 | 124 |
| 51 | 3300025941 | Ga0207711_10789989 | Ga0207711_107899892 | 124 |
| 52 | 3300025972 | Ga0207668_10546815 | Ga0207668_105468152 | 124 |
| 53 | 3300026041 | Ga0207639_10266517 | Ga0207639_102665171 | 124 |
| 54 | 3300026089 | Ga0207648_10108917 | Ga0207648_101089171 | 124 |
| 55 | 3300028381 | Ga0268264_11126268 | Ga0268264_111262681 | 124 |
| 56 | 3300046684 | Ga0495669_0135044 | Ga0495669_0135044_444_884 | 124 |
| 57 | 3300048907 | Ga0496104_1738391 | Ga0496104_1738391_17_457 | 124 |
| 58 | 3300049743 | Ga0501081_0509057 | Ga0501081_0509057_36_494 | 124 |
| 59 | 3300054114 | Ga0501084_0106228 | Ga0501084_0106228_608_1066 | 124 |
| 60 | 3300005340 | Ga0070689_101453002 | Ga0070689_1014530021 | 125 |
| 61 | 3300005455 | Ga0070663_100169598 | Ga0070663_1001695982 | 125 |
| 62 | 3300005535 | Ga0070684_100067291 | Ga0070684_1000672912 | 125 |
| 63 | 3300005564 | Ga0070664_100067041 | Ga0070664_1000670412 | 125 |
| 64 | 3300005618 | Ga0068864_100128412 | Ga0068864_1001284123 | 125 |
| 65 | 3300011119 | Ga0105246_11196633 | Ga0105246_111966332 | 125 |
| 66 | 3300013296 | Ga0157374_11371093 | Ga0157374_113710931 | 125 |
| 67 | 3300025321 | Ga0207656_10376537 | Ga0207656_103765372 | 125 |
| 68 | 3300025909 | Ga0207705_10683688 | Ga0207705_106836882 | 125 |
| 69 | 3300025944 | Ga0207661_10037421 | Ga0207661_100374215 | 125 |
| 70 | 3300025945 | Ga0207679_10101642 | Ga0207679_101016423 | 125 |
| 71 | 3300026067 | Ga0207678_10449748 | Ga0207678_104497482 | 125 |
| 72 | 3300031250 | Ga0265331_10106868 | Ga0265331_101068682 | 125 |
| 73 | 3300031711 | Ga0265314_10290117 | Ga0265314_102901172 | 125 |
| 74 | 3300031712 | Ga0265342_10258408 | Ga0265342_102584081 | 125 |
| 75 | 3300035118 | Ga0373954_0012746 | Ga0373954_0012746_2053_2499 | 125 |
| 76 | 3300035119 | Ga0373956_0246562 | Ga0373956_0246562_303_749 | 125 |
| 77 | 3300036401 | Ga0373937_0133146 | Ga0373937_0133146_1196_1642 | 125 |
| 78 | 3300048903 | Ga0496100_1142071 | Ga0496100_1142071_43_486 | 125 |
| 79 | 3300048912 | Ga0496109_0338572 | Ga0496109_0338572_132_575 | 125 |
| 80 | 3300035695 | Ga0373927_0086296 | Ga0373927_0086296_538_993 | 126 |
| 81 | 3300045051 | Ga0451576_0001254 | Ga0451576_0001254_1482_1943 | 126 |
| 82 | 3300045051 | Ga0451576_0099425 | Ga0451576_0099425_618_1079 | 126 |
| 83 | 2162886012 | MBSR1b_contig_11879921 | MBSR1b_0325.00001020 | 127 |
| 84 | 2162886012 | MBSR1b_contig_9497042 | MBSR1b_0669.00007230 | 127 |
| 85 | 3300003320 | rootH2_10062296 | rootH2_100622968 | 127 |
| 86 | 3300003578 | Ga0006562J51391_1017864 | Ga0006562J51391_10178642 | 127 |
| 87 | 3300005293 | Ga0065715_10196225 | Ga0065715_101962253 | 127 |
| 88 | 3300005295 | Ga0065707_10472062 | Ga0065707_104720621 | 127 |
| 89 | 3300005327 | Ga0070658_10032958 | Ga0070658_100329582 | 127 |
| 90 | 3300005328 | Ga0070676_10076776 | Ga0070676_100767762 | 127 |
| 91 | 3300005329 | Ga0070683_100005696 | Ga0070683_1000056964 | 127 |
| 92 | 3300005333 | Ga0070677_10783774 | Ga0070677_107837741 | 127 |
| 93 | 3300005339 | Ga0070660_100181418 | Ga0070660_1001814182 | 127 |
| 94 | 3300005344 | Ga0070661_100026240 | Ga0070661_1000262402 | 127 |
| 95 | 3300005366 | Ga0070659_100749968 | Ga0070659_1007499682 | 127 |
| 96 | 3300005367 | Ga0070667_100093618 | Ga0070667_1000936182 | 127 |
| 97 | 3300005406 | Ga0070703_10002846 | Ga0070703_100028461 | 127 |
| 98 | 3300005434 | Ga0070709_10034809 | Ga0070709_100348092 | 127 |
| 99 | 3300005439 | Ga0070711_100043758 | Ga0070711_1000437583 | 127 |
| 100 | 3300005440 | Ga0070705_100014861 | Ga0070705_1000148612 | 127 |
| 101 | 3300005444 | Ga0070694_100119948 | Ga0070694_1001199482 | 127 |
| 102 | 3300005444 | Ga0070694_101005978 | Ga0070694_1010059781 | 127 |
| 103 | 3300005445 | Ga0070708_100012038 | Ga0070708_1000120385 | 127 |
| 104 | 3300005445 | Ga0070708_100450030 | Ga0070708_1004500302 | 127 |
| 105 | 3300005457 | Ga0070662_100345529 | Ga0070662_1003455292 | 127 |
| 106 | 3300005457 | Ga0070662_100641565 | Ga0070662_1006415652 | 127 |
| 107 | 3300005458 | Ga0070681_10269169 | Ga0070681_102691692 | 127 |
| 108 | 3300005458 | Ga0070681_10420721 | Ga0070681_104207212 | 127 |
| 109 | 3300005467 | Ga0070706_100040854 | Ga0070706_1000408542 | 127 |
| 110 | 3300005518 | Ga0070699_100021279 | Ga0070699_1000212792 | 127 |
| 111 | 3300005518 | Ga0070699_100086828 | Ga0070699_1000868281 | 127 |
| 112 | 3300005535 | Ga0070684_100061774 | Ga0070684_1000617744 | 127 |
| 113 | 3300005536 | Ga0070697_100001400 | Ga0070697_10000140016 | 127 |
| 114 | 3300005536 | Ga0070697_100668185 | Ga0070697_1006681852 | 127 |
| 115 | 3300005536 | Ga0070697_101492490 | Ga0070697_1014924902 | 127 |
| 116 | 3300005543 | Ga0070672_100879867 | Ga0070672_1008798672 | 127 |
| 117 | 3300005545 | Ga0070695_100004068 | Ga0070695_1000040682 | 127 |
| 118 | 3300005545 | Ga0070695_100051441 | Ga0070695_1000514413 | 127 |
| 119 | 3300005546 | Ga0070696_100005613 | Ga0070696_1000056134 | 127 |
| 120 | 3300005546 | Ga0070696_100160418 | Ga0070696_1001604183 | 127 |
| 121 | 3300005546 | Ga0070696_100546368 | Ga0070696_1005463682 | 127 |
| 122 | 3300005547 | Ga0070693_100001165 | Ga0070693_1000011657 | 127 |
| 123 | 3300005564 | Ga0070664_100459905 | Ga0070664_1004599052 | 127 |
| 124 | 3300005564 | Ga0070664_100490409 | Ga0070664_1004904092 | 127 |
| 125 | 3300005564 | Ga0070664_100584570 | Ga0070664_1005845701 | 127 |
| 126 | 3300005577 | Ga0068857_100003022 | Ga0068857_1000030224 | 127 |
| 127 | 3300005616 | Ga0068852_100425192 | Ga0068852_1004251922 | 127 |
| 128 | 3300005618 | Ga0068864_100083699 | Ga0068864_1000836992 | 127 |
| 129 | 3300005718 | Ga0068866_10828329 | Ga0068866_108283292 | 127 |
| 130 | 3300005843 | Ga0068860_100005502 | Ga0068860_1000055026 | 127 |
| 131 | 3300005937 | Ga0081455_10009745 | Ga0081455_100097455 | 127 |
| 132 | 3300006173 | Ga0070716_100107023 | Ga0070716_1001070232 | 127 |
| 133 | 3300006173 | Ga0070716_100895356 | Ga0070716_1008953561 | 127 |
| 134 | 3300006844 | Ga0075428_100023023 | Ga0075428_1000230231 | 127 |
| 135 | 3300006846 | Ga0075430_100102066 | Ga0075430_1001020662 | 127 |
| 136 | 3300006847 | Ga0075431_100593976 | Ga0075431_1005939761 | 127 |
| 137 | 3300006852 | Ga0075433_10090612 | Ga0075433_100906122 | 127 |
| 138 | 3300006871 | Ga0075434_100008746 | Ga0075434_1000087468 | 127 |
| 139 | 3300007265 | Ga0099794_10231624 | Ga0099794_102316242 | 127 |
| 140 | 3300007788 | Ga0099795_10122335 | Ga0099795_101223352 | 127 |
| 141 | 3300009094 | Ga0111539_10102406 | Ga0111539_101024063 | 127 |
| 142 | 3300009101 | Ga0105247_11180564 | Ga0105247_111805641 | 127 |
| 143 | 3300009177 | Ga0105248_10534689 | Ga0105248_105346892 | 127 |
| 144 | 3300009553 | Ga0105249_10041223 | Ga0105249_100412232 | 127 |
| 145 | 3300010375 | Ga0105239_10886063 | Ga0105239_108860632 | 127 |
| 146 | 3300013297 | Ga0157378_10000036 | Ga0157378_1000003683 | 127 |
| 147 | 3300013306 | Ga0163162_10033984 | Ga0163162_100339844 | 127 |
| 148 | 3300013308 | Ga0157375_10043301 | Ga0157375_100433012 | 127 |
| 149 | 3300013308 | Ga0157375_10266357 | Ga0157375_102663573 | 127 |
| 150 | 3300021441 | Ga0213871_10077518 | Ga0213871_100775182 | 127 |
| 151 | 3300025885 | Ga0207653_10004825 | Ga0207653_100048252 | 127 |
| 152 | 3300025906 | Ga0207699_10079819 | Ga0207699_100798192 | 127 |
| 153 | 3300025906 | Ga0207699_10131726 | Ga0207699_101317262 | 127 |
| 154 | 3300025906 | Ga0207699_10211446 | Ga0207699_102114462 | 127 |
| 155 | 3300025907 | Ga0207645_10053182 | Ga0207645_100531822 | 127 |
| 156 | 3300025910 | Ga0207684_10840044 | Ga0207684_108400442 | 127 |
| 157 | 3300025916 | Ga0207663_10066747 | Ga0207663_100667474 | 127 |
| 158 | 3300025919 | Ga0207657_10109016 | Ga0207657_101090163 | 127 |
| 159 | 3300025920 | Ga0207649_10204885 | Ga0207649_102048852 | 127 |
| 160 | 3300025921 | Ga0207652_10024792 | Ga0207652_100247922 | 127 |
| 161 | 3300025932 | Ga0207690_10259759 | Ga0207690_102597592 | 127 |
| 162 | 3300025933 | Ga0207706_10136448 | Ga0207706_101364482 | 127 |
| 163 | 3300025933 | Ga0207706_10633351 | Ga0207706_106333512 | 127 |
| 164 | 3300025939 | Ga0207665_10354633 | Ga0207665_103546332 | 127 |
| 165 | 3300025939 | Ga0207665_10812346 | Ga0207665_108123462 | 127 |
| 166 | 3300025941 | Ga0207711_10680000 | Ga0207711_106800002 | 127 |
| 167 | 3300025944 | Ga0207661_10033429 | Ga0207661_100334292 | 127 |
| 168 | 3300025945 | Ga0207679_10261917 | Ga0207679_102619172 | 127 |
| 169 | 3300025945 | Ga0207679_10334879 | Ga0207679_103348791 | 127 |
| 170 | 3300025972 | Ga0207668_11036322 | Ga0207668_110363221 | 127 |
| 171 | 3300025986 | Ga0207658_10064409 | Ga0207658_100644092 | 127 |
| 172 | 3300025986 | Ga0207658_11708990 | Ga0207658_117089901 | 127 |
| 173 | 3300026088 | Ga0207641_11667573 | Ga0207641_116675731 | 127 |
| 174 | 3300026116 | Ga0207674_10002317 | Ga0207674_1000231725 | 127 |
| 175 | 3300026142 | Ga0207698_10188679 | Ga0207698_101886792 | 127 |
| 176 | 3300028381 | Ga0268264_10102567 | Ga0268264_101025671 | 127 |
| 177 | 3300031247 | Ga0265340_10256819 | Ga0265340_102568191 | 127 |
| 178 | 3300031824 | Ga0307413_10188831 | Ga0307413_101888312 | 127 |
| 179 | 3300031852 | Ga0307410_10099094 | Ga0307410_100990943 | 127 |
| 180 | 3300035118 | Ga0373954_0014354 | Ga0373954_0014354_1683_2147 | 127 |
| 181 | 3300035119 | Ga0373956_0249768 | Ga0373956_0249768_85_549 | 127 |
| 182 | 3300035172 | Ga0373955_0034945 | Ga0373955_0034945_107_571 | 127 |
| 183 | 3300035724 | Ga0373933_0325517 | Ga0373933_0325517_475_939 | 127 |
| 184 | 3300036401 | Ga0373937_0202706 | Ga0373937_0202706_968_1432 | 127 |
| 185 | 3300036401 | Ga0373937_0272688 | Ga0373937_0272688_1141_1587 | 127 |
| 186 | 3300037068 | Ga0373925_0236587 | Ga0373925_0236587_314_778 | 127 |
| 187 | 3300039438 | Ga0436360_0451404 | Ga0436360_0451404_162_674 | 127 |
| 188 | 3300039450 | Ga0436363_1141063 | Ga0436363_1141063_276_788 | 127 |
| 189 | 3300042002 | Ga0439442_093654 | Ga0439442_093654_36_524 | 127 |
| 190 | 3300042015 | Ga0439462_0141934 | Ga0439462_0141934_172_660 | 127 |
| 191 | 3300042435 | Ga0439434_0039280 | Ga0439434_0039280_329_817 | 127 |
| 192 | 3300042876 | Ga0451577_0998627 | Ga0451577_0998627_76_534 | 127 |
| 193 | 3300044712 | Ga0453684_0642786 | Ga0453684_0642786_225_683 | 127 |
| 194 | 3300044712 | Ga0453684_0843112 | Ga0453684_0843112_575_958 | 127 |
| 195 | 3300045976 | Ga0466967_0567368 | Ga0466967_0567368_312_767 | 127 |
| 196 | 3300046472 | Ga0495580_0067028 | Ga0495580_0067028_21_485 | 127 |
| 197 | 3300046472 | Ga0495580_0322610 | Ga0495580_0322610_286_744 | 127 |
| 198 | 3300046516 | Ga0495628_1154345 | Ga0495628_1154345_23_406 | 127 |
| 199 | 3300046517 | Ga0495630_0077894 | Ga0495630_0077894_377_829 | 127 |
| 200 | 3300047317 | Ga0495604_0561952 | Ga0495604_0561952_115_579 | 127 |
| 201 | 3300047319 | Ga0495674_0041638 | Ga0495674_0041638_2353_2817 | 127 |
| 202 | 3300048088 | Ga0495602_0169459 | Ga0495602_0169459_13_396 | 127 |
| 203 | 3300048905 | Ga0496102_0001124 | Ga0496102_0001124_23878_24261 | 127 |
| 204 | 3300048906 | Ga0496103_0103235 | Ga0496103_0103235_1315_1698 | 127 |
| 205 | 3300048907 | Ga0496104_0382116 | Ga0496104_0382116_656_1105 | 127 |
| 206 | 3300048909 | Ga0496106_0015050 | Ga0496106_0015050_597_980 | 127 |
| 207 | 3300048911 | Ga0496108_0607184 | Ga0496108_0607184_288_737 | 127 |
| 208 | 3300048915 | Ga0496112_0034915 | Ga0496112_0034915_4387_4836 | 127 |
| 209 | 3300048915 | Ga0496112_0207094 | Ga0496112_0207094_626_1075 | 127 |
| 210 | 3300048916 | Ga0496113_0260722 | Ga0496113_0260722_530_979 | 127 |
| 211 | 3300049575 | Ga0501039_0173158 | Ga0501039_0173158_613_1068 | 127 |
| 212 | 3300049576 | Ga0501040_0728160 | Ga0501040_0728160_174_629 | 127 |
| 213 | 3300049577 | Ga0501041_0017571 | Ga0501041_0017571_404_862 | 127 |
| 214 | 3300049578 | Ga0501042_0131201 | Ga0501042_0131201_141_596 | 127 |
| 215 | 3300049582 | Ga0501048_0335837 | Ga0501048_0335837_555_1010 | 127 |
| 216 | 3300049583 | Ga0501067_0077603 | Ga0501067_0077603_85_534 | 127 |
| 217 | 3300049587 | Ga0501071_0350875 | Ga0501071_0350875_15_470 | 127 |
| 218 | 3300049588 | Ga0501072_0090021 | Ga0501072_0090021_1546_2001 | 127 |
| 219 | 3300049590 | Ga0501074_0212512 | Ga0501074_0212512_414_869 | 127 |
| 220 | 3300049591 | Ga0501075_0034654 | Ga0501075_0034654_1663_2121 | 127 |
| 221 | 3300049742 | Ga0501080_0133208 | Ga0501080_0133208_135_590 | 127 |
| 222 | 3300049743 | Ga0501081_0192219 | Ga0501081_0192219_71_529 | 127 |
| 223 | 3300049744 | Ga0501083_0194882 | Ga0501083_0194882_337_786 | 127 |
| 224 | 3300049822 | Ga0501035_0368919 | Ga0501035_0368919_128_586 | 127 |
| 225 | 3300049824 | Ga0501045_0120905 | Ga0501045_0120905_914_1369 | 127 |
| 226 | 3300050510 | nmdc:mga06r32_488616_c1 | nmdc:mga06r32_488616_c1_636_1097 | 127 |
| 227 | 3300050512 | nmdc:mga0n895_60498_c1 | nmdc:mga0n895_60498_c1_1592_2053 | 127 |
| 228 | 3300050515 | nmdc:mga0a205_206201_c1 | nmdc:mga0a205_206201_c1_979_1440 | 127 |
| 229 | 3300061734 | Ga0530510_0718788 | Ga0530510_0718788_55_510 | 127 |
| 230 | iso_pu_bacteria | 2854911287 | 2854914998 | 127 |
| 231 | iso_pu_bacteria | 2915650412 | 2915654328 | 127 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e1e-assembly1.cif.gz_B | crystal structure of a thioesterase family protein from silicibacter pomeroyi. northeast structural genomics target sir180a | 0.9721 | 1 | 121 |
| 3nwz-assembly2.cif.gz_C | crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 | 0.9472 | 17 | 119 |
| 3nwz-assembly3.cif.gz_D | crystal structure of bh2602 protein from bacillus halodurans with coa, northeast structural genomics consortium target bhr199 | 0.94 | 18 | 119 |
| 3dkz-assembly1.cif.gz_A | crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. | 0.9311 | 2 | 119 |
| 4ybv-assembly1.cif.gz_D | crystal structure of mutant of (q32a) thioesterase enzyme sav0944 from staphylococcus aureus subsp. aureus mu50 | 0.9246 | 2 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3e1eD00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9709 | 1 | 121 | 3.10.129.10 |
| 3dkzB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9302 | 2 | 119 | 3.10.129.10 |
| 4m20A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.922 | 2 | 120 | 3.10.129.10 |
| 1sbkA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9194 | 2 | 120 | 3.10.129.10 |
| 3e1eD00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9189 | 1 | 121 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S6R8W1-F1-model_v4 | Thioesterase domain-containing protein | 0.9812 | 2 | 119 |
GO:0047617
|
| AF-A0A364NY55-F1-model_v4 | Medium/long-chain acyl-CoA thioesterase YigI (EC 3.1.2.20) | 0.9789 | 1 | 119 |
GO:0016289
|
| AF-A0A7V9UPY1-F1-model_v4 | Medium/long-chain acyl-CoA thioesterase YigI (EC 3.1.2.20) | 0.9787 | 1 | 119 |
GO:0016289
|
| AF-A0A176FA14-F1-model_v4 | Medium/long-chain acyl-CoA thioesterase YigI (EC 3.1.2.20) | 0.9787 | 1 | 121 |
GO:0016289
|
| AF-A0A1H3VV27-F1-model_v4 | Medium/long-chain acyl-CoA thioesterase YigI (EC 3.1.2.20) | 0.9786 | 1 | 120 |
GO:0016289
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar