F343925

General Info

Members Datasets Scaffolds Average Seq Length
231 157 462 372

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100016490|Ga0075428_1000164903
Length 402
Sequence MLNNAPARQWLSPAAQTKSRTVSRKVPSLTDFRRLVVKVGSSLLVDSNGGRLHDSWLSSLAEDIANLHRNRRDVLVVSSGAISFGRAVLRLPAGPLKLEDSQAAAAVGQIALARTWSEVLGRHGITAGQVLVTLQDTEERRRYLNARSTIDKLLEWRAIPVINENDTVATNEIRYGDNDRLAARVATMTSADLLVLLSDIDGLYDAPPADNPKAKLVPLVEGITPGIEAMAGAAGSELSRGGMQTKIEAAKIATQGGTHMVIASGRVAHPLAAITAGARCTWFLTPANPITARKKWIAGSLEPKGVLTIDAGAVVALRSGKSLLPAGVIQVDGSFARGDAVVIRGPDGSEVGRGLVAYDSQDALKIKGRPSADIVAILGFAGRTEMVHRDDLAVGRVSDRAS

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
58 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
69 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
77 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
85 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
100 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
141 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
151 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
155 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
156 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
157 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.06
Nodule 0
Rhizoplane 9.96
Rhizosphere 81.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100016490 3300006844 Bacteria 8158
2 JGI25153J46596_10004190 3300003215 Bacteria 7821
3 Ga0070676_10018508 3300005328 Bacteria 3862
4 Ga0070670_100007582 3300005331 Bacteria 9212
5 Ga0070675_100271351 3300005354 Bacteria 1489
6 Ga0070671_100007678 3300005355 Bacteria 8622
7 Ga0070673_100125049 3300005364 Bacteria 2150
8 Ga0070709_10004597 3300005434 Bacteria 7455
9 Ga0070709_10033060 3300005434 Bacteria 3124
10 Ga0070709_10035229 3300005434 Bacteria 3041
11 Ga0070714_100012390 3300005435 Bacteria 6808
12 Ga0070714_100022498 3300005435 Bacteria 5169
13 Ga0070713_100003029 3300005436 Bacteria 11034
14 Ga0070713_100044295 3300005436 Bacteria 3642
15 Ga0070713_100165240 3300005436 Bacteria 1978
16 Ga0070713_100206255 3300005436 Bacteria 1777
17 Ga0070710_10041698 3300005437 Bacteria 2535
18 Ga0070711_100003053 3300005439 Bacteria 9673
19 Ga0070711_100022512 3300005439 Bacteria 4086
20 Ga0070711_100067318 3300005439 Bacteria 2512
21 Ga0070711_100255281 3300005439 Bacteria 1377
22 Ga0070705_100187009 3300005440 Bacteria 1408
23 Ga0070678_100045500 3300005456 Bacteria 3141
24 Ga0070678_100192087 3300005456 Bacteria 1679
25 Ga0070699_100011767 3300005518 Bacteria 7551
26 Ga0070665_100047903 3300005548 Bacteria 4290
27 Ga0068860_100173266 3300005843 Bacteria 2085
28 Ga0081455_10010887 3300005937 Bacteria 9179
29 Ga0081455_10014542 3300005937 Bacteria 7705
30 Ga0081538_10025737 3300005981 Bacteria 4138
31 Ga0081540_1006750 3300005983 Bacteria 8299
32 Ga0081539_10029245 3300005985 Bacteria 3447
33 Ga0070717_10034042 3300006028 Bacteria 4115
34 Ga0075365_10038022 3300006038 Bacteria 3126
35 Ga0075365_10104537 3300006038 Bacteria 1942
36 Ga0075368_10015390 3300006042 Bacteria 2838
37 Ga0075364_10150798 3300006051 Bacteria 1567
38 Ga0070715_10021265 3300006163 Bacteria 2514
39 Ga0070716_100010636 3300006173 Bacteria 4617
40 Ga0070712_100001339 3300006175 Bacteria 14929
41 Ga0070712_100063634 3300006175 Bacteria 2613
42 Ga0075367_10005439 3300006178 Bacteria 6323
43 Ga0075428_100174877 3300006844 Bacteria 2326
44 Ga0075431_100003028 3300006847 Bacteria 16263
45 Ga0075431_100013654 3300006847 Bacteria 8208
46 Ga0075434_100016910 3300006871 Bacteria 7017
47 Ga0075434_100040139 3300006871 Bacteria 4636
48 Ga0075434_100078616 3300006871 Bacteria 3294
49 Ga0075429_100339544 3300006880 Bacteria 1315
50 Ga0075435_100054649 3300007076 Bacteria 3223
51 Ga0111539_10001515 3300009094 Bacteria 31011
52 Ga0111539_10043832 3300009094 Bacteria 5362
53 Ga0114129_10006345 3300009147 Bacteria 16768
54 Ga0114129_10008610 3300009147 Bacteria 14548
55 Ga0114129_10021478 3300009147 Bacteria 9162
56 Ga0114129_10736883 3300009147 Bacteria 1263
57 Ga0105248_10364742 3300009177 Bacteria 1626
58 Ga0163163_10036689 3300014325 Bacteria 4763
59 Ga0209758_1000240 3300025297 Bacteria 114169
60 Ga0207692_10013364 3300025898 Bacteria 3560
61 Ga0207692_10023291 3300025898 Bacteria 2862
62 Ga0207685_10002352 3300025905 Bacteria 4309
63 Ga0207699_10044263 3300025906 Bacteria 2591
64 Ga0207645_10034518 3300025907 Bacteria 3250
65 Ga0207693_10002801 3300025915 Bacteria 15111
66 Ga0207693_10027772 3300025915 Bacteria 4473
67 Ga0207652_10133943 3300025921 Bacteria 2211
68 Ga0207650_10002572 3300025925 Bacteria 12563
69 Ga0207687_10022015 3300025927 Bacteria 4240
70 Ga0207687_10072257 3300025927 Bacteria 2467
71 Ga0207700_10045052 3300025928 Bacteria 3252
72 Ga0207700_10102409 3300025928 Bacteria 2287
73 Ga0207664_10050566 3300025929 Bacteria 3278
74 Ga0207706_10101452 3300025933 Bacteria 2532
75 Ga0207691_10089535 3300025940 Bacteria 2760
76 Ga0207711_10146865 3300025941 Bacteria 2125
77 Ga0207683_10071577 3300026121 Bacteria 3065
78 Ga0209813_10012050 3300027866 Bacteria 2275
79 Ga0268266_10102789 3300028379 Bacteria 2521
80 Ga0268264_10135108 3300028381 Bacteria 2191
81 Ga0265338_10016490 3300028800 Bacteria 8032
82 Ga0265330_10018004 3300031235 Bacteria 3247
83 Ga0265332_10001254 3300031238 Bacteria 14610
84 Ga0265325_10001998 3300031241 Bacteria 14018
85 Ga0265325_10006535 3300031241 Bacteria 7073
86 Ga0265325_10010395 3300031241 Bacteria 5393
87 Ga0265340_10048825 3300031247 Bacteria 2057
88 Ga0265340_10077313 3300031247 Bacteria 1571
89 Ga0265339_10000064 3300031249 Bacteria 92992
90 Ga0265339_10003862 3300031249 Bacteria 10402
91 Ga0265331_10016126 3300031250 Bacteria 3929
92 Ga0265331_10016717 3300031250 Bacteria 3844
93 Ga0265331_10025691 3300031250 Bacteria 2969
94 Ga0265316_10011976 3300031344 Bacteria 7795
95 Ga0265316_10083610 3300031344 Bacteria 2445
96 Ga0265313_10000020 3300031595 Bacteria 145873
97 Ga0265313_10002066 3300031595 Bacteria 17975
98 Ga0265313_10024098 3300031595 Bacteria 3259
99 Ga0265314_10008367 3300031711 Bacteria 8866
100 Ga0265314_10049729 3300031711 Bacteria 2933
101 Ga0265342_10004862 3300031712 Bacteria 10406
102 Ga0265342_10063876 3300031712 Bacteria 2162
103 Ga0265342_10117677 3300031712 Bacteria 1499
104 Ga0307409_100172150 3300031995 Bacteria 1907
105 Ga0373950_0001273 3300034818 Bacteria 3260
106 Ga0373924_0053914 3300035410 Bacteria 1671
107 Ga0373937_0069629 3300036401 Bacteria 3244
108 Ga0373925_0047476 3300037068 Bacteria 3196
109 Ga0373925_0084705 3300037068 Bacteria 2416
110 Ga0436364_1427795 3300037853 Bacteria 2070
111 Ga0395901_0178624 3300038443 Bacteria 2226
112 Ga0436365_1239503 3300039437 Bacteria 2507
113 Ga0436361_0852853 3300039447 Bacteria 8502
114 Ga0436363_1226999 3300039450 Bacteria 2204
115 Ga0439443_007128 3300042003 Bacteria 1550
116 Ga0466968_0072895 3300044735 Bacteria 1498
117 Ga0466957_0070583 3300044842 Bacteria 2159
118 Ga0495592_0111549 3300046454 Bacteria 1935
119 Ga0495629_0038539 3300046459 Bacteria 3366
120 Ga0495629_0047560 3300046459 Bacteria 3009
121 Ga0495651_0031108 3300046462 Bacteria 4162
122 Ga0495662_0030717 3300046476 Bacteria 2593
123 Ga0495664_0026320 3300046477 Bacteria 3387
124 Ga0495608_0106953 3300046511 Bacteria 1800
125 Ga0495630_0038027 3300046517 Bacteria 3598
126 Ga0495630_0139687 3300046517 Bacteria 1842
127 Ga0495665_0013151 3300046531 Bacteria 4479
128 Ga0495640_0015933 3300046533 Bacteria 5639
129 Ga0495640_0022345 3300046533 Bacteria 4624
130 Ga0495586_0040611 3300046535 Bacteria 2504
131 Ga0495645_0043687 3300046543 Bacteria 3269
132 Ga0495645_0081259 3300046543 Bacteria 2325
133 Ga0495667_0035436 3300046559 Bacteria 3335
134 Ga0495656_0087941 3300046615 Bacteria 1416
135 Ga0495634_0012032 3300046642 Bacteria 6272
136 Ga0495634_0014258 3300046642 Bacteria 5735
137 Ga0495634_0141091 3300046642 Bacteria 1529
138 Ga0495635_0025213 3300046663 Bacteria 4142
139 Ga0495646_0075113 3300046680 Bacteria 1982
140 Ga0495613_0072415 3300046689 Bacteria 2512
141 Ga0495613_0077351 3300046689 Bacteria 2421
142 Ga0495613_0251801 3300046689 Bacteria 1232
143 Ga0495624_0113525 3300046690 Bacteria 1665
144 Ga0495604_0089859 3300047317 Bacteria 2282
145 Ga0495674_0091417 3300047319 Bacteria 2599
146 Ga0495674_0106582 3300047319 Bacteria 2380
147 Ga0495675_0106596 3300047444 Bacteria 1751
148 Ga0495684_0012132 3300047471 Bacteria 6647
149 Ga0495684_0034246 3300047471 Bacteria 3897
150 Ga0495602_0112577 3300048088 Bacteria 2208
151 Ga0496100_0063904 3300048903 Bacteria 2434
152 Ga0496100_0114012 3300048903 Bacteria 1882
153 Ga0496101_0141264 3300048904 Bacteria 1835
154 Ga0496102_0082205 3300048905 Bacteria 2970
155 Ga0496103_0046371 3300048906 Bacteria 2683
156 Ga0496104_0191507 3300048907 Bacteria 1956
157 Ga0496105_0013110 3300048908 Bacteria 6574
158 Ga0496105_0074665 3300048908 Bacteria 2801
159 Ga0496106_0103930 3300048909 Bacteria 2205
160 Ga0496106_0341513 3300048909 Bacteria 1202
161 Ga0496107_0056402 3300048910 Bacteria 2838
162 Ga0496108_0004006 3300048911 Bacteria 11815
163 Ga0496108_0386584 3300048911 Bacteria 1222
164 Ga0496109_0000404 3300048912 Bacteria 38842
165 Ga0496109_0110558 3300048912 Bacteria 2555
166 Ga0496110_0001910 3300048913 Bacteria 15419
167 Ga0496110_0004921 3300048913 Bacteria 10430
168 Ga0496111_0027304 3300048914 Bacteria 4037
169 Ga0496111_0107007 3300048914 Bacteria 2058
170 Ga0496112_0002963 3300048915 Bacteria 13850
171 Ga0496113_0001202 3300048916 Bacteria 14187
172 Ga0496115_0007820 3300048918 Bacteria 7881
173 Ga0496115_0164635 3300048918 Bacteria 1834
174 Ga0496126_0047754 3300048929 Bacteria 3918
175 Ga0501033_0023474 3300049570 Bacteria 4651
176 Ga0501033_0081234 3300049570 Bacteria 2377
177 Ga0501034_0020627 3300049571 Bacteria 6731
178 Ga0501042_0108084 3300049578 Bacteria 2003
179 Ga0501043_0018802 3300049579 Bacteria 5423
180 Ga0501047_0031829 3300049581 Bacteria 5089
181 Ga0501067_0017884 3300049583 Bacteria 3924
182 Ga0501068_0086470 3300049584 Bacteria 1930
183 Ga0501069_0022503 3300049585 Bacteria 3429
184 Ga0501070_0027760 3300049586 Bacteria 4748
185 Ga0501071_0135027 3300049587 Bacteria 1835
186 Ga0501072_0001636 3300049588 Bacteria 16771
187 Ga0501072_0144977 3300049588 Bacteria 1893
188 Ga0501073_0023417 3300049589 Bacteria 4434
189 Ga0501074_0014465 3300049590 Bacteria 5741
190 Ga0501075_0251045 3300049591 Bacteria 1348
191 Ga0501077_0077415 3300049593 Bacteria 2107
192 Ga0501080_0013834 3300049742 Bacteria 7429
193 Ga0501083_0009680 3300049744 Bacteria 6807
194 Ga0501083_0132951 3300049744 Bacteria 1631
195 Ga0501044_0031032 3300049823 Bacteria 5627
196 Ga0501044_0031465 3300049823 Bacteria 5586
197 Ga0501044_0116922 3300049823 Bacteria 2671
198 Ga0501044_0207211 3300049823 Bacteria 1917
199 Ga0501045_0056861 3300049824 Bacteria 2862
200 nmdc:mga03683_91264_c1 3300050489 Bacteria 1328
201 nmdc:mga00v17_154902_c1 3300050491 Bacteria 1473
202 nmdc:mga0k408_8835_c1 3300050493 Bacteria 5421
203 nmdc:mga04h51_6000_c1 3300050495 Bacteria 3126
204 nmdc:mga05p37_427_c1 3300050507 Bacteria 45535
205 nmdc:mga05p37_8519_c1 3300050507 Bacteria 12120
206 nmdc:mga0qj67_42130_c1 3300050509 Bacteria 3593
207 nmdc:mga06r32_30530_c1 3300050510 Bacteria 5057
208 nmdc:mga06r32_316_c1 3300050510 Bacteria 40391
209 nmdc:mga06r32_56585_c1 3300050510 Bacteria 3765
210 nmdc:mga06r32_74018_c1 3300050510 Bacteria 3301
211 nmdc:mga08y16_32265_c1 3300050511 Bacteria 5507
212 nmdc:mga08y16_90_c1 3300050511 Bacteria 76458
213 nmdc:mga0n895_11936_c1 3300050512 Bacteria 7774
214 nmdc:mga0n895_166606_c1 3300050512 Bacteria 2235
215 nmdc:mga0n895_34422_c1 3300050512 Bacteria 4875
216 nmdc:mga0n895_83755_c1 3300050512 Bacteria 3181
217 nmdc:mga0a205_162327_c1 3300050515 Bacteria 2130
218 nmdc:mga0sz30_15124_c1 3300050516 Bacteria 3048
219 Ga0495601_0002120 3300053077 Bacteria 11165
220 Ga0495601_0087957 3300053077 Bacteria 1997
221 Ga0495601_0122987 3300053077 Bacteria 1686
222 Ga0495612_0019336 3300053078 Bacteria 2727
223 Ga0495595_0010592 3300053084 Bacteria 3835
224 Ga0500616_0025895 3300053153 Bacteria 3252
225 Ga0501084_0046090 3300054114 Bacteria 3651
226 Ga0501084_0152644 3300054114 Bacteria 1947
227 Ga0530510_0021173 3300061734 Bacteria 4625
228 Ga0530510_0120216 3300061734 Bacteria 1928
229 2643758285 2643221547 Bacteria 4740017
230 2919452570 2919450847 Bacteria 5631160
231 8001847080 8001845381 Bacteria 5804942
232 Ga0075428_100016490
233 JGI25153J46596_10004190
234 Ga0070676_10018508
235 Ga0070670_100007582
236 Ga0070675_100271351
237 Ga0070671_100007678
238 Ga0070673_100125049
239 Ga0070709_10004597
240 Ga0070709_10033060
241 Ga0070709_10035229
242 Ga0070714_100012390
243 Ga0070714_100022498
244 Ga0070713_100003029
245 Ga0070713_100044295
246 Ga0070713_100165240
247 Ga0070713_100206255
248 Ga0070710_10041698
249 Ga0070711_100003053
250 Ga0070711_100022512
251 Ga0070711_100067318
252 Ga0070711_100255281
253 Ga0070705_100187009
254 Ga0070678_100045500
255 Ga0070678_100192087
256 Ga0070699_100011767
257 Ga0070665_100047903
258 Ga0068860_100173266
259 Ga0081455_10010887
260 Ga0081455_10014542
261 Ga0081538_10025737
262 Ga0081540_1006750
263 Ga0081539_10029245
264 Ga0070717_10034042
265 Ga0075365_10038022
266 Ga0075365_10104537
267 Ga0075368_10015390
268 Ga0075364_10150798
269 Ga0070715_10021265
270 Ga0070716_100010636
271 Ga0070712_100001339
272 Ga0070712_100063634
273 Ga0075367_10005439
274 Ga0075428_100174877
275 Ga0075431_100003028
276 Ga0075431_100013654
277 Ga0075434_100016910
278 Ga0075434_100040139
279 Ga0075434_100078616
280 Ga0075429_100339544
281 Ga0075435_100054649
282 Ga0111539_10001515
283 Ga0111539_10043832
284 Ga0114129_10006345
285 Ga0114129_10008610
286 Ga0114129_10021478
287 Ga0114129_10736883
288 Ga0105248_10364742
289 Ga0163163_10036689
290 Ga0209758_1000240
291 Ga0207692_10013364
292 Ga0207692_10023291
293 Ga0207685_10002352
294 Ga0207699_10044263
295 Ga0207645_10034518
296 Ga0207693_10002801
297 Ga0207693_10027772
298 Ga0207652_10133943
299 Ga0207650_10002572
300 Ga0207687_10022015
301 Ga0207687_10072257
302 Ga0207700_10045052
303 Ga0207700_10102409
304 Ga0207664_10050566
305 Ga0207706_10101452
306 Ga0207691_10089535
307 Ga0207711_10146865
308 Ga0207683_10071577
309 Ga0209813_10012050
310 Ga0268266_10102789
311 Ga0268264_10135108
312 Ga0265338_10016490
313 Ga0265330_10018004
314 Ga0265332_10001254
315 Ga0265325_10001998
316 Ga0265325_10006535
317 Ga0265325_10010395
318 Ga0265340_10048825
319 Ga0265340_10077313
320 Ga0265339_10000064
321 Ga0265339_10003862
322 Ga0265331_10016126
323 Ga0265331_10016717
324 Ga0265331_10025691
325 Ga0265316_10011976
326 Ga0265316_10083610
327 Ga0265313_10000020
328 Ga0265313_10002066
329 Ga0265313_10024098
330 Ga0265314_10008367
331 Ga0265314_10049729
332 Ga0265342_10004862
333 Ga0265342_10063876
334 Ga0265342_10117677
335 Ga0307409_100172150
336 Ga0373950_0001273
337 Ga0373924_0053914
338 Ga0373937_0069629
339 Ga0373925_0047476
340 Ga0373925_0084705
341 Ga0436364_1427795
342 Ga0395901_0178624
343 Ga0436365_1239503
344 Ga0436361_0852853
345 Ga0436363_1226999
346 Ga0439443_007128
347 Ga0466968_0072895
348 Ga0466957_0070583
349 Ga0495592_0111549
350 Ga0495629_0038539
351 Ga0495629_0047560
352 Ga0495651_0031108
353 Ga0495662_0030717
354 Ga0495664_0026320
355 Ga0495608_0106953
356 Ga0495630_0038027
357 Ga0495630_0139687
358 Ga0495665_0013151
359 Ga0495640_0015933
360 Ga0495640_0022345
361 Ga0495586_0040611
362 Ga0495645_0043687
363 Ga0495645_0081259
364 Ga0495667_0035436
365 Ga0495656_0087941
366 Ga0495634_0012032
367 Ga0495634_0014258
368 Ga0495634_0141091
369 Ga0495635_0025213
370 Ga0495646_0075113
371 Ga0495613_0072415
372 Ga0495613_0077351
373 Ga0495613_0251801
374 Ga0495624_0113525
375 Ga0495604_0089859
376 Ga0495674_0091417
377 Ga0495674_0106582
378 Ga0495675_0106596
379 Ga0495684_0012132
380 Ga0495684_0034246
381 Ga0495602_0112577
382 Ga0496100_0063904
383 Ga0496100_0114012
384 Ga0496101_0141264
385 Ga0496102_0082205
386 Ga0496103_0046371
387 Ga0496104_0191507
388 Ga0496105_0013110
389 Ga0496105_0074665
390 Ga0496106_0103930
391 Ga0496106_0341513
392 Ga0496107_0056402
393 Ga0496108_0004006
394 Ga0496108_0386584
395 Ga0496109_0000404
396 Ga0496109_0110558
397 Ga0496110_0001910
398 Ga0496110_0004921
399 Ga0496111_0027304
400 Ga0496111_0107007
401 Ga0496112_0002963
402 Ga0496113_0001202
403 Ga0496115_0007820
404 Ga0496115_0164635
405 Ga0496126_0047754
406 Ga0501033_0023474
407 Ga0501033_0081234
408 Ga0501034_0020627
409 Ga0501042_0108084
410 Ga0501043_0018802
411 Ga0501047_0031829
412 Ga0501067_0017884
413 Ga0501068_0086470
414 Ga0501069_0022503
415 Ga0501070_0027760
416 Ga0501071_0135027
417 Ga0501072_0001636
418 Ga0501072_0144977
419 Ga0501073_0023417
420 Ga0501074_0014465
421 Ga0501075_0251045
422 Ga0501077_0077415
423 Ga0501080_0013834
424 Ga0501083_0009680
425 Ga0501083_0132951
426 Ga0501044_0031032
427 Ga0501044_0031465
428 Ga0501044_0116922
429 Ga0501044_0207211
430 Ga0501045_0056861
431 nmdc:mga03683_91264_c1
432 nmdc:mga00v17_154902_c1
433 nmdc:mga0k408_8835_c1
434 nmdc:mga04h51_6000_c1
435 nmdc:mga05p37_427_c1
436 nmdc:mga05p37_8519_c1
437 nmdc:mga0qj67_42130_c1
438 nmdc:mga06r32_30530_c1
439 nmdc:mga06r32_316_c1
440 nmdc:mga06r32_56585_c1
441 nmdc:mga06r32_74018_c1
442 nmdc:mga08y16_32265_c1
443 nmdc:mga08y16_90_c1
444 nmdc:mga0n895_11936_c1
445 nmdc:mga0n895_166606_c1
446 nmdc:mga0n895_34422_c1
447 nmdc:mga0n895_83755_c1
448 nmdc:mga0a205_162327_c1
449 nmdc:mga0sz30_15124_c1
450 Ga0495601_0002120
451 Ga0495601_0087957
452 Ga0495601_0122987
453 Ga0495612_0019336
454 Ga0495595_0010592
455 Ga0500616_0025895
456 Ga0501084_0046090
457 Ga0501084_0152644
458 Ga0530510_0021173
459 Ga0530510_0120216
460 2643758285
461 2919452570
462 8001847080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01472

PUA

PUA domain

305

378

0.97

PF00696

AA_kinase

Amino acid kinase family

33

264

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ey4-assembly1.cif.gz_A crystal structure of a cbf5-nop10-gar1 complex 0.9491 288 348
8i9t-assembly1.cif.gz_CG cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state dbp10-1 0.9174 287 346
2w21-assembly1.cif.gz_A-2 crystal structure of the aminoacid kinase domain of the glutamate 5 kinase of escherichia coli. 0.9103 16 269
2ako-assembly2.cif.gz_D crystal structure of glutamate 5-kinase from campylobacter jejuni 0.9044 17 266
2w21-assembly1.cif.gz_A-2 crystal structure of the aminoacid kinase domain of the glutamate 5 kinase of escherichia coli. 0.8998 16 269
ID Description Score Start End Superfamily
2j5tB02 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9825 286 378 2.30.130.10
af_Q54LB6_223_322_2.30.130.10 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9645 285 378 2.30.130.10
2j5tB02 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9621 286 378 2.30.130.10
4q1tD02 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9596 284 378 2.30.130.10
af_O13810_285_387_2.30.130.10 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9474 279 378 2.30.130.10
ID Description Score Start End GO Terms
AF-A0A4Q3C6E4-F1-model_v4 Glutamate 5-kinase 0.9966 292 376 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561
AF-A0A383D3J9-F1-model_v4 PUA domain-containing protein 0.9954 303 378 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561
AF-A0A355T3B8-F1-model_v4 Glutamate 5-kinase 0.9933 290 378 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561
AF-A0A5C7SBL3-F1-model_v4 Glutamate 5-kinase (EC 2.7.2.11) 0.989 284 378 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561
AF-A0A2M7JRI8-F1-model_v4 Glutamate 5-kinase (EC 2.7.2.11) 0.989 288 378 GO:0003723
GO:0004349
GO:0005524
GO:0005829
GO:0006561

Map