F343735

General Info

Members Datasets Scaffolds Average Seq Length
231 191 216 166

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100059843|Ga0070680_1000598433
Length 187
Sequence LAISGPELLTAAHDLAEFSCGKPSLDRWLRTRALSNQERGFTAVLVVHEANRVIGYYGLAPTAIVPSMLPRSTRTGQPPDPVPCLMLGQLATDQNWIGKGIGTGLLKHALQRCVRAADLIGGRALVVNAVDVEAAGFWRRRGFIASRTIRSSCSGRSPTLQHHFAETKQPIDGKSRSYSIGSTREGM

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
3 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
4 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
5 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
6 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
7 2854911287 Brucella lupini LUP21 Isolate Unclassified
8 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
9 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
10 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
11 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
12 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
13 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
44 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
89 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
90 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
91 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
94 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
125 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
126 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
180 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
181 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
182 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
183 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
184 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
185 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
186 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
188 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
189 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
190 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
191 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.07
Metatranscriptomes 0.43
Isolates 6.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.66
Nodule 5.19
Rhizoplane 0.87
Rhizosphere 73.16
Stem 0
Stem Tuber 0
Unclassified 12.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10128561 3300003322 Bacteria 1327
2 rootH1_10230144 3300003323 Bacteria 1262
3 Ga0070658_10064119 3300005327 Bacteria 2997
4 Ga0070683_100026275 3300005329 Bacteria 5239
5 Ga0070683_100546733 3300005329 Bacteria 1107
6 Ga0070670_100028544 3300005331 Bacteria 4802
7 Ga0070680_100059843 3300005336 Bacteria 3117
8 Ga0070680_100277214 3300005336 Bacteria 1420
9 Ga0070660_100004175 3300005339 Bacteria 9974
10 Ga0070689_100139725 3300005340 Bacteria 1947
11 Ga0070691_10085257 3300005341 Bacteria 1552
12 Ga0070673_100171285 3300005364 Bacteria 1853
13 Ga0070667_100311692 3300005367 Bacteria 1418
14 Ga0070708_100490126 3300005445 Unclassified 1159
15 Ga0070681_10027876 3300005458 Bacteria 5678
16 Ga0070681_10391559 3300005458 Bacteria 1300
17 Ga0070707_101138454 3300005468 Bacteria 746
18 Ga0070684_100319217 3300005535 Bacteria 1427
19 Ga0068853_100007487 3300005539 Bacteria 8741
20 Ga0068853_100178410 3300005539 Bacteria 1925
21 Ga0068855_100076128 3300005563 Bacteria 3895
22 Ga0068855_100240622 3300005563 Bacteria 2023
23 Ga0068857_100036708 3300005577 Bacteria 4342
24 Ga0068854_100032236 3300005578 Bacteria 3644
25 Ga0068856_100251826 3300005614 Bacteria 1781
26 Ga0068852_100320201 3300005616 Bacteria 1506
27 Ga0068851_10335950 3300005834 Bacteria 876
28 Ga0081455_10128005 3300005937 Bacteria 1990
29 Ga0081455_10350867 3300005937 Bacteria 1041
30 Ga0081540_1000075 3300005983 Bacteria 106804
31 Ga0081540_1109847 3300005983 Bacteria 1168
32 Ga0081540_1135700 3300005983 Bacteria 996
33 Ga0081539_10000129 3300005985 Bacteria 178675
34 Ga0070717_10158401 3300006028 Bacteria 1963
35 Ga0075365_10167273 3300006038 Bacteria 1534
36 Ga0070712_100497870 3300006175 Bacteria 1021
37 Ga0075367_10009318 3300006178 Bacteria 5128
38 Ga0099825_1035180 3300006941 Bacteria 1808
39 Ga0099823_1015943 3300006944 Bacteria 7416
40 Ga0099794_10001057 3300007265 Bacteria 9396
41 Ga0099794_10007369 3300007265 Bacteria 4516
42 Ga0099794_10061842 3300007265 Bacteria 1820
43 Ga0105240_10023900 3300009093 Bacteria 8072
44 Ga0105247_10017241 3300009101 Bacteria 4335
45 Ga0105237_10011730 3300009545 Bacteria 9270
46 Ga0105238_10005877 3300009551 Bacteria 12154
47 Ga0105238_10901735 3300009551 Bacteria 902
48 Ga0105249_10209582 3300009553 Bacteria 1912
49 Ga0099796_10111960 3300010159 Bacteria 1040
50 Ga0099796_10120310 3300010159 Bacteria 1008
51 Ga0105239_10145473 3300010375 Bacteria 2643
52 Ga0157370_10355468 3300013104 Bacteria 1350
53 Ga0157369_10029458 3300013105 Bacteria 6065
54 Ga0171463_1024 3300013249 Bacteria 5936
55 Ga0157374_11184668 3300013296 Bacteria 785
56 Ga0157379_10410870 3300014968 Bacteria 1245
57 Ga0157376_12503875 3300014969 Bacteria 556
58 Ga0183363_1383 3300015690 Bacteria 4345
59 Ga0213871_10015357 3300021441 Bacteria 1830
60 Ga0209564_1000163 3300025295 Bacteria 162077
61 Ga0209050_1032664 3300025298 Bacteria 1597
62 Ga0209256_1001964 3300025299 Bacteria 18566
63 Ga0209257_1000476 3300025304 Bacteria 72955
64 Ga0207643_10500861 3300025908 Unclassified 776
65 Ga0207654_10508662 3300025911 Bacteria 851
66 Ga0207707_10113627 3300025912 Bacteria 2366
67 Ga0207707_10193654 3300025912 Bacteria 1773
68 Ga0207695_10274787 3300025913 Bacteria 1580
69 Ga0207671_10083428 3300025914 Bacteria 2399
70 Ga0207660_10421089 3300025917 Bacteria 1077
71 Ga0207657_10048582 3300025919 Bacteria 3704
72 Ga0207652_10111954 3300025921 Bacteria 2421
73 Ga0207681_10147195 3300025923 Bacteria 1761
74 Ga0207694_10034434 3300025924 Bacteria 3883
75 Ga0207694_10548835 3300025924 Bacteria 970
76 Ga0207650_10279415 3300025925 Bacteria 1359
77 Ga0207659_10243613 3300025926 Bacteria 1456
78 Ga0207691_10330757 3300025940 Bacteria 1306
79 Ga0207661_10049902 3300025944 Bacteria 3333
80 Ga0207667_10014880 3300025949 Bacteria 8848
81 Ga0207667_10042982 3300025949 Bacteria 4798
82 Ga0207667_10182949 3300025949 Bacteria 2152
83 Ga0207651_10025446 3300025960 Bacteria 3678
84 Ga0207712_10422444 3300025961 Bacteria 1125
85 Ga0207658_10365195 3300025986 Bacteria 1261
86 Ga0207703_10582416 3300026035 Bacteria 1057
87 Ga0207639_10002021 3300026041 Bacteria 13671
88 Ga0207639_10061611 3300026041 Bacteria 2898
89 Ga0207702_10833294 3300026078 Bacteria 912
90 Ga0207674_10016772 3300026116 Bacteria 8006
91 Ga0207674_10429097 3300026116 Bacteria 1277
92 Ga0207698_10037399 3300026142 Bacteria 3574
93 Ga0207698_10272309 3300026142 Bacteria 1561
94 Ga0209389_1007463 3300027296 Bacteria 9632
95 Ga0209489_110935 3300027361 Bacteria 9722
96 Ga0209700_102860 3300027363 Bacteria 34208
97 Ga0209588_1001138 3300027671 Bacteria 6848
98 Ga0209588_1035057 3300027671 Bacteria 1613
99 Ga0268266_10349147 3300028379 Bacteria 1390
100 Ga0265328_10000903 3300031239 Bacteria 13697
101 Ga0265328_10003566 3300031239 Bacteria 6859
102 Ga0265329_10006047 3300031242 Bacteria 4835
103 Ga0265339_10172824 3300031249 Unclassified 1080
104 Ga0265331_10004258 3300031250 Bacteria 8960
105 Ga0265331_10006285 3300031250 Bacteria 7041
106 Ga0265327_10018538 3300031251 Bacteria 4309
107 Ga0265316_10193550 3300031344 Bacteria 1509
108 Ga0307509_10005515 3300031507 Bacteria 17569
109 Ga0307509_10322878 3300031507 Bacteria 1279
110 Ga0265313_10000045 3300031595 Bacteria 114646
111 Ga0307508_10000468 3300031616 Bacteria 48784
112 Ga0307508_10073738 3300031616 Bacteria 2989
113 Ga0265314_10021244 3300031711 Bacteria 4996
114 Ga0265342_10207549 3300031712 Bacteria 1061
115 Ga0307516_10127236 3300031730 Bacteria 2331
116 Ga0307516_10279595 3300031730 Bacteria 1351
117 Ga0307516_10400843 3300031730 Bacteria 1031
118 Ga0307409_100116822 3300031995 Unclassified 2250
119 Ga0307409_100549025 3300031995 Bacteria 1134
120 Ga0307507_10134431 3300033179 Bacteria 1922
121 Ga0307507_10147789 3300033179 Bacteria 1779
122 Ga0307510_10531282 3300033180 Bacteria 621
123 Ga0373944_0006597 3300035089 Bacteria 3083
124 Ga0373923_0045800 3300035111 Bacteria 1817
125 Ga0373936_0051788 3300035113 Bacteria 1662
126 Ga0373954_0275555 3300035118 Bacteria 829
127 Ga0373946_0039956 3300035171 Bacteria 1917
128 Ga0373946_0564133 3300035171 Unclassified 588
129 Ga0373955_0131814 3300035172 Bacteria 1459
130 Ga0373935_0052122 3300035692 Bacteria 2600
131 Ga0373935_0215773 3300035692 Bacteria 1331
132 Ga0373927_0007706 3300035695 Bacteria 7286
133 Ga0373927_0060945 3300035695 Bacteria 2441
134 Ga0373927_0141365 3300035695 Bacteria 1574
135 Ga0373933_0027987 3300035724 Bacteria 3249
136 Ga0373933_0071103 3300035724 Bacteria 2118
137 Ga0373937_0074871 3300036401 Bacteria 3125
138 Ga0372808_040269 3300036459 Bacteria 670
139 Ga0373925_0013180 3300037068 Bacteria 5984
140 Ga0373925_0295758 3300037068 Bacteria 1306
141 Ga0373925_0438825 3300037068 Bacteria 1068
142 Ga0395898_0080155 3300037466 Bacteria 3149
143 Ga0395901_0108426 3300038443 Bacteria 2915
144 Ga0436365_0089514 3300039437 Bacteria 2120
145 Ga0436361_0516081 3300039447 Bacteria 1861
146 Ga0439431_0007020 3300041997 Bacteria 2506
147 Ga0439434_0173664 3300042435 Unclassified 720
148 Ga0466972_0018374 3300044658 Bacteria 3494
149 Ga0466964_0019406 3300044706 Bacteria 2613
150 Ga0466968_0002901 3300044735 Bacteria 6334
151 Ga0466968_0504147 3300044735 Bacteria 603
152 Ga0466970_0205547 3300044765 Bacteria 1096
153 Ga0466960_0009417 3300044901 Bacteria 4026
154 Ga0466960_0288691 3300044901 Bacteria 921
155 Ga0466959_0006671 3300045049 Bacteria 8024
156 Ga0466967_0457223 3300045976 Bacteria 1248
157 Ga0495592_0222517 3300046454 Bacteria 1261
158 Ga0495580_0217507 3300046472 Bacteria 1313
159 Ga0495639_0150263 3300046475 Bacteria 1123
160 Ga0495664_0032686 3300046477 Bacteria 3054
161 Ga0495606_0299430 3300046507 Bacteria 872
162 Ga0495610_0019014 3300046512 Bacteria 3858
163 Ga0495628_0469870 3300046516 Bacteria 911
164 Ga0495648_0066014 3300046524 Bacteria 2123
165 Ga0495652_0016685 3300046529 Bacteria 6564
166 Ga0495640_0365940 3300046533 Bacteria 888
167 Ga0495645_0022922 3300046543 Bacteria 4519
168 Ga0495645_0080985 3300046543 Bacteria 2330
169 Ga0495622_0046080 3300046557 Bacteria 2026
170 Ga0495634_0089605 3300046642 Bacteria 1999
171 Ga0495635_0114639 3300046663 Bacteria 1840
172 Ga0495647_0018541 3300046681 Bacteria 2480
173 Ga0495624_0246362 3300046690 Bacteria 1081
174 Ga0495674_0036928 3300047319 Bacteria 4392
175 Ga0495676_0090936 3300047321 Bacteria 2283
176 Ga0495685_096418 3300047447 Bacteria 978
177 Ga0495684_0052776 3300047471 Bacteria 3102
178 Ga0495614_0247772 3300048089 Bacteria 814
179 Ga0496103_0428331 3300048906 Bacteria 849
180 Ga0496106_0043504 3300048909 Bacteria 3370
181 Ga0496117_0010789 3300048920 Bacteria 8252
182 Ga0496118_0004863 3300048921 Bacteria 15642
183 Ga0496119_0230512 3300048922 Bacteria 943
184 Ga0496121_0000602 3300048924 Bacteria 67586
185 Ga0496124_0001669 3300048927 Bacteria 31555
186 Ga0496126_0012965 3300048929 Bacteria 8509
187 Ga0501031_0024098 3300049568 Bacteria 3968
188 Ga0501032_0009811 3300049569 Bacteria 6926
189 Ga0501033_0000048 3300049570 Bacteria 120958
190 Ga0501034_0000452 3300049571 Bacteria 67967
191 Ga0501034_0000702 3300049571 Bacteria 50840
192 Ga0501036_0000092 3300049572 Bacteria 56405
193 Ga0501037_0001392 3300049573 Bacteria 17737
194 Ga0501038_0000123 3300049574 Bacteria 65136
195 Ga0501043_0002051 3300049579 Bacteria 17189
196 Ga0501047_0016122 3300049581 Bacteria 7127
197 Ga0501224_004581 3300049664 Bacteria 1966
198 Ga0501080_0410230 3300049742 Bacteria 1218
199 Ga0501035_0000076 3300049822 Bacteria 121548
200 Ga0501044_0000075 3300049823 Bacteria 120819
201 Ga0501044_0534579 3300049823 Bacteria 1071
202 nmdc:mga0yw44_35160_c1 3300050492 Bacteria 2942
203 nmdc:mga06z11_6692_c1 3300050494 Bacteria 4710
204 nmdc:mga07m45_95952_c1 3300050496 Bacteria 1701
205 Ga0495601_0072251 3300053077 Bacteria 2204
206 Ga0500635_0166564 3300053080 Bacteria 847
207 Ga0500578_0162245 3300053086 Bacteria 1386
208 Ga0500647_0093356 3300053091 Bacteria 1440
209 Ga0500566_0108279 3300053094 Bacteria 1514
210 Ga0500559_0000779 3300053136 Bacteria 20861
211 Ga0500568_0046331 3300053139 Bacteria 1726
212 Ga0500588_0039893 3300053146 Bacteria 1408
213 Ga0500590_093061 3300053148 Bacteria 1461
214 Ga0500616_0294651 3300053153 Bacteria 676
215 Ga0500639_162043 3300053163 Bacteria 1016
216 Ga0500637_0012327 3300053178 Bacteria 4452

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0108426 Ga0395901_0108426_1681_2148 154
2 3300035724 Ga0373933_0071103 Ga0373933_0071103_802_1272 156
3 3300048909 Ga0496106_0043504 Ga0496106_0043504_10_483 157
4 3300053163 Ga0500639_162043 Ga0500639_162043_429_902 157
5 3300021441 Ga0213871_10015357 Ga0213871_100153574 158
6 3300039447 Ga0436361_0516081 Ga0436361_0516081_652_1128 158
7 3300035089 Ga0373944_0006597 Ga0373944_0006597_1586_2086 160
8 3300035171 Ga0373946_0564133 Ga0373946_0564133_28_528 160
9 3300035695 Ga0373927_0007706 Ga0373927_0007706_1479_1979 160
10 3300037068 Ga0373925_0013180 Ga0373925_0013180_2910_3410 160
11 3300049823 Ga0501044_0534579 Ga0501044_0534579_343_828 161
12 iso_pu_bacteria 2508501128 2509154310 161
13 iso_pu_bacteria 2513237104 2513722070 161
14 iso_pu_bacteria 2847930680 2847932473 161
15 iso_pu_bacteria 2874628541 2874631073 161
16 iso_pu_bacteria 2879083081 2879090289 161
17 iso_pu_bacteria 2885383462 2885384021 161
18 iso_pu_bacteria 8002060224 8002062135 161
19 iso_pu_bacteria 2523231067 2523470759 164
20 iso_pu_bacteria 2842509118 2842515738 164
21 iso_pu_bacteria 2852387548 2852393770 164
22 iso_pu_bacteria 2854911287 2854911340 164
23 iso_pu_bacteria 2881147464 2881147586 164
24 iso_pu_bacteria 2904690495 2904694470 164
25 iso_pu_bacteria 2908756301 2908763394 164
26 iso_pu_bacteria 8024486573 8024490260 164
27 3300005327 Ga0070658_10064119 Ga0070658_100641193 165
28 3300005329 Ga0070683_100026275 Ga0070683_1000262751 165
29 3300005329 Ga0070683_100546733 Ga0070683_1005467332 165
30 3300005336 Ga0070680_100277214 Ga0070680_1002772142 165
31 3300005339 Ga0070660_100004175 Ga0070660_1000041751 165
32 3300005341 Ga0070691_10085257 Ga0070691_100852573 165
33 3300005458 Ga0070681_10027876 Ga0070681_100278762 165
34 3300005458 Ga0070681_10391559 Ga0070681_103915592 165
35 3300005535 Ga0070684_100319217 Ga0070684_1003192173 165
36 3300005539 Ga0068853_100178410 Ga0068853_1001784102 165
37 3300005563 Ga0068855_100076128 Ga0068855_1000761283 165
38 3300005563 Ga0068855_100240622 Ga0068855_1002406223 165
39 3300005577 Ga0068857_100036708 Ga0068857_1000367083 165
40 3300005616 Ga0068852_100320201 Ga0068852_1003202011 165
41 3300005834 Ga0068851_10335950 Ga0068851_103359501 165
42 3300005983 Ga0081540_1109847 Ga0081540_11098471 165
43 3300006038 Ga0075365_10167273 Ga0075365_101672732 165
44 3300006175 Ga0070712_100497870 Ga0070712_1004978703 165
45 3300006941 Ga0099825_1035180 Ga0099825_10351804 165
46 3300006944 Ga0099823_1015943 Ga0099823_10159435 165
47 3300007265 Ga0099794_10001057 Ga0099794_100010574 165
48 3300007265 Ga0099794_10007369 Ga0099794_100073694 165
49 3300007265 Ga0099794_10061842 Ga0099794_100618422 165
50 3300009093 Ga0105240_10023900 Ga0105240_100239001 165
51 3300009101 Ga0105247_10017241 Ga0105247_100172412 165
52 3300009545 Ga0105237_10011730 Ga0105237_1001173011 165
53 3300009551 Ga0105238_10005877 Ga0105238_100058774 165
54 3300009551 Ga0105238_10901735 Ga0105238_109017352 165
55 3300010159 Ga0099796_10111960 Ga0099796_101119601 165
56 3300010159 Ga0099796_10120310 Ga0099796_101203101 165
57 3300010375 Ga0105239_10145473 Ga0105239_101454733 165
58 3300013104 Ga0157370_10355468 Ga0157370_103554681 165
59 3300013105 Ga0157369_10029458 Ga0157369_100294584 165
60 3300013296 Ga0157374_11184668 Ga0157374_111846681 165
61 3300014968 Ga0157379_10410870 Ga0157379_104108702 165
62 3300014969 Ga0157376_12503875 Ga0157376_125038751 165
63 3300025911 Ga0207654_10508662 Ga0207654_105086621 165
64 3300025912 Ga0207707_10113627 Ga0207707_101136273 165
65 3300025912 Ga0207707_10193654 Ga0207707_101936542 165
66 3300025913 Ga0207695_10274787 Ga0207695_102747872 165
67 3300025914 Ga0207671_10083428 Ga0207671_100834282 165
68 3300025917 Ga0207660_10421089 Ga0207660_104210891 165
69 3300025919 Ga0207657_10048582 Ga0207657_100485821 165
70 3300025921 Ga0207652_10111954 Ga0207652_101119542 165
71 3300025924 Ga0207694_10034434 Ga0207694_100344343 165
72 3300025924 Ga0207694_10548835 Ga0207694_105488352 165
73 3300025944 Ga0207661_10049902 Ga0207661_100499024 165
74 3300025949 Ga0207667_10014880 Ga0207667_100148802 165
75 3300025949 Ga0207667_10042982 Ga0207667_100429822 165
76 3300026035 Ga0207703_10582416 Ga0207703_105824162 165
77 3300026041 Ga0207639_10061611 Ga0207639_100616112 165
78 3300026116 Ga0207674_10429097 Ga0207674_104290972 165
79 3300026142 Ga0207698_10037399 Ga0207698_100373992 165
80 3300027296 Ga0209389_1007463 Ga0209389_10074635 165
81 3300027361 Ga0209489_110935 Ga0209489_1109355 165
82 3300027363 Ga0209700_102860 Ga0209700_1028605 165
83 3300027671 Ga0209588_1001138 Ga0209588_10011385 165
84 3300027671 Ga0209588_1035057 Ga0209588_10350572 165
85 3300031507 Ga0307509_10005515 Ga0307509_1000551516 165
86 3300031507 Ga0307509_10322878 Ga0307509_103228782 165
87 3300031616 Ga0307508_10000468 Ga0307508_1000046827 165
88 3300031616 Ga0307508_10073738 Ga0307508_100737382 165
89 3300031730 Ga0307516_10127236 Ga0307516_101272362 165
90 3300031730 Ga0307516_10279595 Ga0307516_102795952 165
91 3300031730 Ga0307516_10400843 Ga0307516_104008432 165
92 3300033179 Ga0307507_10134431 Ga0307507_101344312 165
93 3300033179 Ga0307507_10147789 Ga0307507_101477893 165
94 3300033180 Ga0307510_10531282 Ga0307510_105312821 165
95 3300035111 Ga0373923_0045800 Ga0373923_0045800_1067_1564 165
96 3300035113 Ga0373936_0051788 Ga0373936_0051788_641_1138 165
97 3300035118 Ga0373954_0275555 Ga0373954_0275555_269_766 165
98 3300035171 Ga0373946_0039956 Ga0373946_0039956_189_686 165
99 3300035172 Ga0373955_0131814 Ga0373955_0131814_449_946 165
100 3300035692 Ga0373935_0052122 Ga0373935_0052122_271_768 165
101 3300035695 Ga0373927_0060945 Ga0373927_0060945_1292_1789 165
102 3300035695 Ga0373927_0141365 Ga0373927_0141365_366_863 165
103 3300035724 Ga0373933_0027987 Ga0373933_0027987_1686_2183 165
104 3300036401 Ga0373937_0074871 Ga0373937_0074871_1679_2176 165
105 3300036459 Ga0372808_040269 Ga0372808_040269_57_554 165
106 3300037068 Ga0373925_0295758 Ga0373925_0295758_666_1163 165
107 3300037068 Ga0373925_0438825 Ga0373925_0438825_356_853 165
108 3300037466 Ga0395898_0080155 Ga0395898_0080155_1818_2315 165
109 3300039437 Ga0436365_0089514 Ga0436365_0089514_1370_1867 165
110 3300044658 Ga0466972_0018374 Ga0466972_0018374_2603_3100 165
111 3300044706 Ga0466964_0019406 Ga0466964_0019406_1037_1534 165
112 3300044735 Ga0466968_0002901 Ga0466968_0002901_4097_4594 165
113 3300044735 Ga0466968_0504147 Ga0466968_0504147_50_547 165
114 3300044765 Ga0466970_0205547 Ga0466970_0205547_179_676 165
115 3300044901 Ga0466960_0009417 Ga0466960_0009417_2490_2987 165
116 3300044901 Ga0466960_0288691 Ga0466960_0288691_342_839 165
117 3300046454 Ga0495592_0222517 Ga0495592_0222517_357_854 165
118 3300046472 Ga0495580_0217507 Ga0495580_0217507_658_1155 165
119 3300046475 Ga0495639_0150263 Ga0495639_0150263_244_741 165
120 3300046477 Ga0495664_0032686 Ga0495664_0032686_1444_1941 165
121 3300046516 Ga0495628_0469870 Ga0495628_0469870_256_753 165
122 3300046529 Ga0495652_0016685 Ga0495652_0016685_5922_6419 165
123 3300046533 Ga0495640_0365940 Ga0495640_0365940_315_812 165
124 3300046543 Ga0495645_0080985 Ga0495645_0080985_144_641 165
125 3300046557 Ga0495622_0046080 Ga0495622_0046080_1082_1579 165
126 3300046642 Ga0495634_0089605 Ga0495634_0089605_597_1094 165
127 3300046663 Ga0495635_0114639 Ga0495635_0114639_523_1020 165
128 3300046681 Ga0495647_0018541 Ga0495647_0018541_1706_2203 165
129 3300046690 Ga0495624_0246362 Ga0495624_0246362_365_862 165
130 3300047319 Ga0495674_0036928 Ga0495674_0036928_2221_2718 165
131 3300047321 Ga0495676_0090936 Ga0495676_0090936_1703_2200 165
132 3300047471 Ga0495684_0052776 Ga0495684_0052776_400_897 165
133 3300048089 Ga0495614_0247772 Ga0495614_0247772_79_576 165
134 3300048906 Ga0496103_0428331 Ga0496103_0428331_234_731 165
135 3300048920 Ga0496117_0010789 Ga0496117_0010789_6363_6860 165
136 3300048921 Ga0496118_0004863 Ga0496118_0004863_8533_9030 165
137 3300048922 Ga0496119_0230512 Ga0496119_0230512_236_733 165
138 3300048924 Ga0496121_0000602 Ga0496121_0000602_66783_67280 165
139 3300048927 Ga0496124_0001669 Ga0496124_0001669_3874_4371 165
140 3300048929 Ga0496126_0012965 Ga0496126_0012965_3840_4337 165
141 3300050492 nmdc:mga0yw44_35160_c1 nmdc:mga0yw44_35160_c1_1817_2314 165
142 3300053077 Ga0495601_0072251 Ga0495601_0072251_1246_1743 165
143 3300053080 Ga0500635_0166564 Ga0500635_0166564_168_665 165
144 3300053091 Ga0500647_0093356 Ga0500647_0093356_690_1187 165
145 3300053094 Ga0500566_0108279 Ga0500566_0108279_733_1230 165
146 3300053178 Ga0500637_0012327 Ga0500637_0012327_3475_3972 165
147 3300045976 Ga0466967_0457223 Ga0466967_0457223_460_960 166
148 3300049742 Ga0501080_0410230 Ga0501080_0410230_181_681 166
149 3300005336 Ga0070680_100059843 Ga0070680_1000598433 167
150 3300005445 Ga0070708_100490126 Ga0070708_1004901262 167
151 3300005937 Ga0081455_10350867 Ga0081455_103508672 167
152 3300009553 Ga0105249_10209582 Ga0105249_102095823 167
153 3300013249 Ga0171463_1024 Ga0171463_10247 167
154 3300015690 Ga0183363_1383 Ga0183363_13836 167
155 3300025961 Ga0207712_10422444 Ga0207712_104224442 167
156 3300031239 Ga0265328_10000903 Ga0265328_1000090311 167
157 3300031239 Ga0265328_10003566 Ga0265328_100035661 167
158 3300031242 Ga0265329_10006047 Ga0265329_100060471 167
159 3300031250 Ga0265331_10006285 Ga0265331_1000628512 167
160 3300031251 Ga0265327_10018538 Ga0265327_100185386 167
161 3300031344 Ga0265316_10193550 Ga0265316_101935501 167
162 3300031712 Ga0265342_10207549 Ga0265342_102075493 167
163 3300035692 Ga0373935_0215773 Ga0373935_0215773_287_799 167
164 3300053086 Ga0500578_0162245 Ga0500578_0162245_532_1035 167
165 3300003322 rootL2_10128561 rootL2_101285611 168
166 3300003323 rootH1_10230144 rootH1_102301443 168
167 3300005331 Ga0070670_100028544 Ga0070670_1000285445 168
168 3300005340 Ga0070689_100139725 Ga0070689_1001397252 168
169 3300005364 Ga0070673_100171285 Ga0070673_1001712853 168
170 3300005367 Ga0070667_100311692 Ga0070667_1003116922 168
171 3300005468 Ga0070707_101138454 Ga0070707_1011384542 168
172 3300005539 Ga0068853_100007487 Ga0068853_1000074875 168
173 3300005578 Ga0068854_100032236 Ga0068854_1000322365 168
174 3300005614 Ga0068856_100251826 Ga0068856_1002518262 168
175 3300005937 Ga0081455_10128005 Ga0081455_101280053 168
176 3300005983 Ga0081540_1000075 Ga0081540_1000075103 168
177 3300005983 Ga0081540_1135700 Ga0081540_11357002 168
178 3300005985 Ga0081539_10000129 Ga0081539_10000129156 168
179 3300006028 Ga0070717_10158401 Ga0070717_101584012 168
180 3300006178 Ga0075367_10009318 Ga0075367_100093188 168
181 3300025295 Ga0209564_1000163 Ga0209564_100016341 168
182 3300025298 Ga0209050_1032664 Ga0209050_10326642 168
183 3300025299 Ga0209256_1001964 Ga0209256_10019644 168
184 3300025304 Ga0209257_1000476 Ga0209257_100047639 168
185 3300025908 Ga0207643_10500861 Ga0207643_105008612 168
186 3300025923 Ga0207681_10147195 Ga0207681_101471952 168
187 3300025925 Ga0207650_10279415 Ga0207650_102794153 168
188 3300025926 Ga0207659_10243613 Ga0207659_102436133 168
189 3300025940 Ga0207691_10330757 Ga0207691_103307572 168
190 3300025949 Ga0207667_10182949 Ga0207667_101829492 168
191 3300025960 Ga0207651_10025446 Ga0207651_100254465 168
192 3300025986 Ga0207658_10365195 Ga0207658_103651953 168
193 3300026041 Ga0207639_10002021 Ga0207639_100020215 168
194 3300026078 Ga0207702_10833294 Ga0207702_108332942 168
195 3300026116 Ga0207674_10016772 Ga0207674_100167723 168
196 3300026142 Ga0207698_10272309 Ga0207698_102723094 168
197 3300028379 Ga0268266_10349147 Ga0268266_103491473 168
198 3300031249 Ga0265339_10172824 Ga0265339_101728242 168
199 3300031250 Ga0265331_10004258 Ga0265331_100042585 168
200 3300031595 Ga0265313_10000045 Ga0265313_1000004593 168
201 3300031711 Ga0265314_10021244 Ga0265314_100212444 168
202 3300031995 Ga0307409_100116822 Ga0307409_1001168223 168
203 3300031995 Ga0307409_100549025 Ga0307409_1005490252 168
204 3300041997 Ga0439431_0007020 Ga0439431_0007020_1340_1849 168
205 3300042435 Ga0439434_0173664 Ga0439434_0173664_128_637 168
206 3300045049 Ga0466959_0006671 Ga0466959_0006671_3888_4394 168
207 3300046507 Ga0495606_0299430 Ga0495606_0299430_316_831 168
208 3300046512 Ga0495610_0019014 Ga0495610_0019014_2951_3460 168
209 3300046524 Ga0495648_0066014 Ga0495648_0066014_388_897 168
210 3300046543 Ga0495645_0022922 Ga0495645_0022922_817_1329 168
211 3300047447 Ga0495685_096418 Ga0495685_096418_64_570 168
212 3300049568 Ga0501031_0024098 Ga0501031_0024098_3119_3628 168
213 3300049569 Ga0501032_0009811 Ga0501032_0009811_2645_3154 168
214 3300049570 Ga0501033_0000048 Ga0501033_0000048_2659_3168 168
215 3300049571 Ga0501034_0000452 Ga0501034_0000452_2631_3140 168
216 3300049571 Ga0501034_0000702 Ga0501034_0000702_50165_50674 168
217 3300049572 Ga0501036_0000092 Ga0501036_0000092_2631_3140 168
218 3300049573 Ga0501037_0001392 Ga0501037_0001392_14577_15086 168
219 3300049574 Ga0501038_0000123 Ga0501038_0000123_61996_62505 168
220 3300049579 Ga0501043_0002051 Ga0501043_0002051_14022_14531 168
221 3300049581 Ga0501047_0016122 Ga0501047_0016122_2651_3160 168
222 3300049664 Ga0501224_004581 Ga0501224_004581_1102_1608 168
223 3300049822 Ga0501035_0000076 Ga0501035_0000076_2659_3168 168
224 3300049823 Ga0501044_0000075 Ga0501044_0000075_2632_3141 168
225 3300050494 nmdc:mga06z11_6692_c1 nmdc:mga06z11_6692_c1_3958_4467 168
226 3300050496 nmdc:mga07m45_95952_c1 nmdc:mga07m45_95952_c1_287_799 168
227 3300053136 Ga0500559_0000779 Ga0500559_0000779_10797_11318 168
228 3300053139 Ga0500568_0046331 Ga0500568_0046331_618_1127 168
229 3300053146 Ga0500588_0039893 Ga0500588_0039893_435_944 168
230 3300053148 Ga0500590_093061 Ga0500590_093061_337_858 168
231 3300053153 Ga0500616_0294651 Ga0500616_0294651_126_635 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

40

145

0.78

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

9

143

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f36-assembly1.cif.gz_D tact complexed with acetyl-glycyl-trnagly 0.9525 1 156
7ak8-assembly1.cif.gz_A structure of salmonella tact1 toxin bound to taca1 antitoxin c-terminal peptide 0.9308 2 157
7f36-assembly1.cif.gz_D tact complexed with acetyl-glycyl-trnagly 0.9293 1 156
6g96-assembly1.cif.gz_B crystal structure of tact3 (trna acetylating toxin) from salmonella 0.9237 6 167
7ak9-assembly1.cif.gz_A structure of salmonella tact3 toxin bound to taca3 antitoxin c-terminal peptide 0.9226 6 167
ID Description Score Start End Superfamily
af_I6XA42_1_159_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9633 3 158 3.40.630.30
5fvjB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9526 4 156 3.40.630.30
af_I6XA42_1_159_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9341 3 158 3.40.630.30
5fvjB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9178 4 156 3.40.630.30
af_A0A1D6LYK2_621_771_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7884 42 129 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A442SY37-F1-model_v4 N-acetyltransferase 0.9947 3 167 GO:0016747
AF-A0A7W9D1P0-F1-model_v4 GNAT family N-acetyltransferase 0.9932 107 168
AF-A0A0D6PNB1-F1-model_v4 Acetyltransferase 0.9919 2 165 GO:0016740
AF-A0A0D6PFQ4-F1-model_v4 Acetyltransferase 0.9916 1 167 GO:0016747
AF-A0A0U5M9X8-F1-model_v4 N-acetyltransferase domain-containing protein 0.99 54 166 GO:0016747

Feature Viewer

pLDDT pTM Quality
92.9 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map