F343433

General Info

Members Datasets Scaffolds Average Seq Length
230 146 196 220

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0006649|Ga0501033_0006649_7518_8273
Length 251
Sequence VPYEEAGRLVRTAGHAGQLVATPEDAREGDPVVTAPIRVLVCDDQMLIRTGLVTIIDAQPDMEVVGECGDGSNAVELAGTLRPDVVVMDVRMPVLDGIEATRRLAGAGVRHPVKVLVVTTFNLDEYVYEALRAGASGFLLKDAPPSQLLHGIRTVASGAALLDPEVTRRLVGRFATRIRPVESAPDDIPLTTRELEVLRLIADGMSNSEIAAALVISQETVKTFVSRILTKLNLRDRVQAVIYAYRHGLAV

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
3 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
4 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
5 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
6 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
7 2808606448 Streptomyces sp. 193411 Isolate Unclassified
8 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
9 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
10 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
11 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
12 2867369537 Streptomyces sp. Z26 Isolate Unclassified
13 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
14 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
15 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
16 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
17 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
18 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
19 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
20 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
21 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
22 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
23 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
24 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
66 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
67 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
68 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
77 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
83 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
84 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
85 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
86 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
87 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
88 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
89 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
90 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
91 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
132 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
133 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
138 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
139 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
140 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
141 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
142 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
143 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
144 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
145 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
146 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.22
Metatranscriptomes 0
Isolates 14.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.61
Nodule 0
Rhizoplane 2.17
Rhizosphere 72.17
Stem 0
Stem Tuber 0
Unclassified 23.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001428 3300003203 Bacteria 11267
2 rootH2_10090369 3300003320 Bacteria 4944
3 rootH2_10107402 3300003320 Bacteria 1810
4 rootH1_10092987 3300003323 Bacteria 6704
5 Ga0070658_10045999 3300005327 Bacteria 3531
6 Ga0070680_100133873 3300005336 Bacteria 2075
7 Ga0068868_100433035 3300005338 Bacteria 1141
8 Ga0070668_100005622 3300005347 Bacteria 9294
9 Ga0070675_100362642 3300005354 Bacteria 1287
10 Ga0070659_100320892 3300005366 Bacteria 1295
11 Ga0070714_100001176 3300005435 Bacteria 18843
12 Ga0070714_100010226 3300005435 Bacteria 7407
13 Ga0070714_100393182 3300005435 Bacteria 1309
14 Ga0070713_100674002 3300005436 Bacteria 986
15 Ga0070710_10001340 3300005437 Bacteria 11623
16 Ga0070700_100258822 3300005441 Bacteria 1252
17 Ga0070663_100000606 3300005455 Bacteria 19194
18 Ga0070681_10037075 3300005458 Bacteria 4893
19 Ga0070706_100484913 3300005467 Bacteria 1150
20 Ga0081538_10000522 3300005981 Bacteria 42868
21 Ga0081538_10007144 3300005981 Bacteria 9696
22 Ga0081539_10000562 3300005985 Bacteria 76587
23 Ga0081539_10001176 3300005985 Bacteria 47379
24 Ga0070717_10002849 3300006028 Bacteria 12265
25 Ga0075428_100036134 3300006844 Bacteria 5444
26 Ga0105035_107588 3300009988 Bacteria 915
27 Ga0157372_10429492 3300013307 Bacteria 1540
28 Ga0163163_10691547 3300014325 Bacteria 1083
29 Ga0213875_10002376 3300021388 Bacteria 11323
30 Ga0213875_10005680 3300021388 Bacteria 6655
31 Ga0213875_10033481 3300021388 Bacteria 2427
32 Ga0207692_10000729 3300025898 Bacteria 11592
33 Ga0207705_10200840 3300025909 Bacteria 1510
34 Ga0207684_10084590 3300025910 Bacteria 2702
35 Ga0207707_10101848 3300025912 Bacteria 2510
36 Ga0207695_10639473 3300025913 Bacteria 945
37 Ga0207700_10091093 3300025928 Bacteria 2408
38 Ga0207664_10003528 3300025929 Bacteria 10447
39 Ga0207664_10012938 3300025929 Bacteria 5979
40 Ga0207664_10417408 3300025929 Bacteria 1195
41 Ga0207679_10229918 3300025945 Bacteria 1565
42 Ga0207668_10175633 3300025972 Bacteria 1684
43 Ga0207677_10854711 3300026023 Bacteria 818
44 Ga0207703_10682584 3300026035 Bacteria 976
45 Ga0207678_10000377 3300026067 Bacteria 40712
46 Ga0307517_10209848 3300028786 Bacteria 1202
47 Ga0307515_10000044 3300028794 Bacteria 303041
48 Ga0307515_10028947 3300028794 Bacteria 9388
49 Ga0307515_10068603 3300028794 Bacteria 4868
50 Ga0307515_10109702 3300028794 Bacteria 3238
51 Ga0307512_10002113 3300030522 Bacteria 26083
52 Ga0307512_10010879 3300030522 Bacteria 8653
53 Ga0307513_10000005 3300031456 Bacteria 553227
54 Ga0307513_10105766 3300031456 Bacteria 2822
55 Ga0307513_10421404 3300031456 Bacteria 1065
56 Ga0307509_10198605 3300031507 Bacteria 1846
57 Ga0307508_10158270 3300031616 Bacteria 1868
58 Ga0307514_10005058 3300031649 Bacteria 11911
59 Ga0307514_10025036 3300031649 Bacteria 4826
60 Ga0307514_10226019 3300031649 Bacteria 1141
61 Ga0307514_10269452 3300031649 Bacteria 987
62 Ga0307516_10000741 3300031730 Bacteria 44424
63 Ga0307516_10008741 3300031730 Bacteria 11387
64 Ga0307516_10119499 3300031730 Bacteria 2428
65 Ga0307405_10912180 3300031731 Bacteria 744
66 Ga0307518_10004273 3300031838 Bacteria 10253
67 Ga0307410_10073777 3300031852 Bacteria 2374
68 Ga0307407_10156573 3300031903 Bacteria 1487
69 Ga0307409_100239527 3300031995 Bacteria 1651
70 Ga0307416_100809935 3300032002 Bacteria 1033
71 Ga0307415_100008729 3300032126 Bacteria 5637
72 Ga0307415_100297755 3300032126 Bacteria 1335
73 Ga0307510_10015976 3300033180 Bacteria 8870
74 Ga0373951_0000110 3300035091 Bacteria 31731
75 Ga0395900_0839541 3300037418 Bacteria 845
76 Ga0395898_0240991 3300037466 Bacteria 1725
77 Ga0436364_0182053 3300037853 Bacteria 33672
78 Ga0436364_0858446 3300037853 Unclassified 3632
79 Ga0436364_1317646 3300037853 Bacteria 21682
80 Ga0436365_1207417 3300039437 Bacteria 1454
81 Ga0439438_047243 3300041405 Bacteria 1104
82 Ga0439439_0005388 3300041406 Bacteria 2920
83 Ga0451797_1020340 3300041453 Bacteria 722
84 Ga0451837_0298897 3300041494 Bacteria 1618
85 Ga0451837_1093907 3300041494 Bacteria 3882
86 Ga0451837_1470578 3300041494 Bacteria 2013
87 Ga0451841_1409592 3300041498 Bacteria 1664
88 Ga0451843_0903517 3300041509 Bacteria 1060
89 Ga0439449_0006101 3300042007 Bacteria 4605
90 Ga0439457_001431 3300042014 Bacteria 7183
91 Ga0450903_009923 3300042138 Bacteria 1547
92 Ga0450918_046042 3300042531 Bacteria 789
93 Ga0466969_0019102 3300044656 Bacteria 3566
94 Ga0466969_0069241 3300044656 Bacteria 1699
95 Ga0466972_0012734 3300044658 Bacteria 4223
96 Ga0466972_0023312 3300044658 Bacteria 3078
97 Ga0466965_0002834 3300044683 Bacteria 7472
98 Ga0466961_0004500 3300044693 Bacteria 8738
99 Ga0466970_0008534 3300044765 Bacteria 5160
100 Ga0466970_0014487 3300044765 Bacteria 4049
101 Ga0466970_0028063 3300044765 Bacteria 2956
102 Ga0466957_0024801 3300044842 Bacteria 3552
103 Ga0466957_0029860 3300044842 Bacteria 3253
104 Ga0466959_0000135 3300045049 Bacteria 48068
105 Ga0466967_0009835 3300045976 Bacteria 7132
106 Ga0466967_0159846 3300045976 Bacteria 2114
107 Ga0466967_0190911 3300045976 Bacteria 1936
108 Ga0466967_0447557 3300045976 Bacteria 1262
109 Ga0495638_0325487 3300046460 Bacteria 820
110 Ga0495632_0232633 3300046519 Bacteria 831
111 Ga0495589_0173665 3300046794 Bacteria 1024
112 Ga0496108_0060357 3300048911 Bacteria 3191
113 Ga0496111_0046827 3300048914 Bacteria 3114
114 Ga0496112_0269620 3300048915 Bacteria 1651
115 Ga0496124_0209194 3300048927 Bacteria 1477
116 Ga0496126_0282674 3300048929 Bacteria 1374
117 Ga0501031_0072729 3300049568 Bacteria 2238
118 Ga0501031_0231540 3300049568 Bacteria 1202
119 Ga0501032_0002897 3300049569 Bacteria 13339
120 Ga0501032_0034438 3300049569 Bacteria 3467
121 Ga0501033_0006649 3300049570 Bacteria 9041
122 Ga0501033_0021772 3300049570 Bacteria 4838
123 Ga0501033_0361284 3300049570 Bacteria 1016
124 Ga0501034_0014315 3300049571 Bacteria 8174
125 Ga0501034_0040124 3300049571 Bacteria 4740
126 Ga0501034_0202686 3300049571 Bacteria 1941
127 Ga0501034_0279431 3300049571 Bacteria 1609
128 Ga0501036_0002535 3300049572 Bacteria 14354
129 Ga0501036_0205992 3300049572 Bacteria 1653
130 Ga0501037_0056393 3300049573 Bacteria 2869
131 Ga0501037_0162946 3300049573 Bacteria 1589
132 Ga0501037_0254842 3300049573 Bacteria 1227
133 Ga0501037_0356572 3300049573 Bacteria 1008
134 Ga0501037_0611431 3300049573 Bacteria 731
135 Ga0501038_0001730 3300049574 Bacteria 20309
136 Ga0501038_0013523 3300049574 Bacteria 7439
137 Ga0501038_0017865 3300049574 Bacteria 6408
138 Ga0501039_0004873 3300049575 Bacteria 10161
139 Ga0501039_0090830 3300049575 Bacteria 2380
140 Ga0501039_0432450 3300049575 Bacteria 1034
141 Ga0501039_0785544 3300049575 Bacteria 743
142 Ga0501042_0117333 3300049578 Bacteria 1916
143 Ga0501043_0001270 3300049579 Bacteria 22150
144 Ga0501043_0013405 3300049579 Bacteria 6410
145 Ga0501043_0036609 3300049579 Bacteria 3862
146 Ga0501043_0047714 3300049579 Bacteria 3367
147 Ga0501046_0017381 3300049580 Bacteria 6005
148 Ga0501046_0029950 3300049580 Bacteria 4422
149 Ga0501046_0140296 3300049580 Bacteria 1829
150 Ga0501046_0273955 3300049580 Bacteria 1237
151 Ga0501047_0008696 3300049581 Bacteria 9585
152 Ga0501047_0012628 3300049581 Bacteria 8003
153 Ga0501047_0012680 3300049581 Bacteria 7984
154 Ga0501047_0055474 3300049581 Bacteria 3832
155 Ga0501047_0101207 3300049581 Bacteria 2761
156 Ga0501047_0119249 3300049581 Bacteria 2520
157 Ga0501047_0138334 3300049581 Bacteria 2314
158 Ga0501048_0025353 3300049582 Bacteria 4321
159 Ga0501048_0114177 3300049582 Bacteria 1908
160 Ga0501048_0359661 3300049582 Bacteria 1038
161 Ga0501067_0010903 3300049583 Bacteria 5031
162 Ga0501068_0267626 3300049584 Bacteria 1091
163 Ga0501069_0342592 3300049585 Bacteria 880
164 Ga0501070_0004445 3300049586 Bacteria 12040
165 Ga0501070_0052402 3300049586 Bacteria 3387
166 Ga0501070_0200562 3300049586 Bacteria 1639
167 Ga0501073_0070128 3300049589 Bacteria 2442
168 Ga0501073_0464425 3300049589 Bacteria 875
169 Ga0501074_0003577 3300049590 Bacteria 11022
170 Ga0501074_0026289 3300049590 Bacteria 4220
171 Ga0501074_0218823 3300049590 Bacteria 1356
172 Ga0501083_0004633 3300049744 Bacteria 9710
173 Ga0501083_0097316 3300049744 Bacteria 1942
174 Ga0501035_0002572 3300049822 Bacteria 17736
175 Ga0501035_0030446 3300049822 Bacteria 4919
176 Ga0501035_0101317 3300049822 Bacteria 2527
177 Ga0501035_0151574 3300049822 Bacteria 2011
178 Ga0501035_0275621 3300049822 Bacteria 1423
179 Ga0501035_0888446 3300049822 Bacteria 706
180 Ga0501044_0021317 3300049823 Bacteria 6915
181 Ga0501044_0038747 3300049823 Bacteria 4976
182 Ga0501044_0121032 3300049823 Bacteria 2618
183 Ga0501044_0139239 3300049823 Bacteria 2416
184 Ga0501044_0253921 3300049823 Bacteria 1698
185 Ga0501044_0306258 3300049823 Bacteria 1516
186 Ga0501044_0420531 3300049823 Bacteria 1246
187 Ga0501045_0074205 3300049824 Bacteria 2505
188 Ga0500644_0027429 3300053088 Bacteria 1772
189 Ga0500577_0127287 3300053142 Bacteria 1064
190 Ga0500600_0099772 3300053149 Bacteria 1534
191 Ga0500616_0000103 3300053153 Bacteria 162529
192 Ga0500616_0001800 3300053153 Bacteria 19514
193 Ga0500616_0008719 3300053153 Bacteria 6257
194 Ga0501084_0162008 3300054114 Bacteria 1887
195 Ga0501084_0200044 3300054114 Bacteria 1686
196 Ga0501082_0011489 3300060353 Bacteria 7621

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025945 Ga0207679_10229918 Ga0207679_102299182 173
2 3300032126 Ga0307415_100008729 Ga0307415_1000087295 183
3 3300006028 Ga0070717_10002849 Ga0070717_100028492 187
4 3300035091 Ga0373951_0000110 Ga0373951_0000110_12177_12821 188
5 3300028794 Ga0307515_10068603 Ga0307515_100686034 194
6 3300031903 Ga0307407_10156573 Ga0307407_101565732 194
7 3300031852 Ga0307410_10073777 Ga0307410_100737772 195
8 3300005354 Ga0070675_100362642 Ga0070675_1003626422 197
9 3300005467 Ga0070706_100484913 Ga0070706_1004849131 197
10 3300025910 Ga0207684_10084590 Ga0207684_100845901 197
11 3300031730 Ga0307516_10119499 Ga0307516_101194992 197
12 3300032126 Ga0307415_100297755 Ga0307415_1002977551 197
13 3300028786 Ga0307517_10209848 Ga0307517_102098482 201
14 3300028794 Ga0307515_10000044 Ga0307515_100000446 201
15 3300031456 Ga0307513_10421404 Ga0307513_104214042 201
16 3300031730 Ga0307516_10000741 Ga0307516_1000074143 201
17 3300021388 Ga0213875_10005680 Ga0213875_100056806 204
18 3300037853 Ga0436364_0858446 Ga0436364_0858446_1453_2100 204
19 3300005366 Ga0070659_100320892 Ga0070659_1003208921 208
20 3300005458 Ga0070681_10037075 Ga0070681_100370752 208
21 3300025912 Ga0207707_10101848 Ga0207707_101018482 208
22 3300025913 Ga0207695_10639473 Ga0207695_106394731 208
23 3300037418 Ga0395900_0839541 Ga0395900_0839541_121_774 208
24 3300037466 Ga0395898_0240991 Ga0395898_0240991_994_1647 208
25 3300041405 Ga0439438_047243 Ga0439438_047243_44_679 208
26 3300041406 Ga0439439_0005388 Ga0439439_0005388_1681_2316 208
27 3300041509 Ga0451843_0903517 Ga0451843_0903517_239_904 208
28 3300042007 Ga0439449_0006101 Ga0439449_0006101_325_960 208
29 3300042014 Ga0439457_001431 Ga0439457_001431_4918_5553 208
30 3300042531 Ga0450918_046042 Ga0450918_046042_33_668 208
31 3300045976 Ga0466967_0009835 Ga0466967_0009835_1823_2476 208
32 3300053153 Ga0500616_0008719 Ga0500616_0008719_4361_5026 208
33 iso_pu_bacteria 8056054917 8056059725 208
34 3300041453 Ga0451797_1020340 Ga0451797_1020340_28_696 209
35 3300041494 Ga0451837_0298897 Ga0451837_0298897_267_935 209
36 3300005981 Ga0081538_10000522 Ga0081538_100005223 211
37 3300005981 Ga0081538_10007144 Ga0081538_100071442 211
38 3300003320 rootH2_10090369 rootH2_100903695 212
39 3300031456 Ga0307513_10000005 Ga0307513_10000005217 212
40 3300049568 Ga0501031_0072729 Ga0501031_0072729_417_1055 212
41 3300049569 Ga0501032_0034438 Ga0501032_0034438_449_1087 212
42 3300049570 Ga0501033_0021772 Ga0501033_0021772_3739_4377 212
43 3300049571 Ga0501034_0202686 Ga0501034_0202686_302_940 212
44 3300049572 Ga0501036_0205992 Ga0501036_0205992_60_698 212
45 3300049573 Ga0501037_0056393 Ga0501037_0056393_2031_2669 212
46 3300049575 Ga0501039_0432450 Ga0501039_0432450_241_879 212
47 3300049578 Ga0501042_0117333 Ga0501042_0117333_1051_1689 212
48 3300049582 Ga0501048_0025353 Ga0501048_0025353_2530_3168 212
49 3300049586 Ga0501070_0200562 Ga0501070_0200562_762_1400 212
50 3300049744 Ga0501083_0097316 Ga0501083_0097316_181_819 212
51 3300049822 Ga0501035_0151574 Ga0501035_0151574_473_1111 212
52 3300049824 Ga0501045_0074205 Ga0501045_0074205_95_733 212
53 iso_pu_bacteria 2866612099 2866614364 212
54 3300005336 Ga0070680_100133873 Ga0070680_1001338732 213
55 3300042138 Ga0450903_009923 Ga0450903_009923_483_1136 213
56 3300048914 Ga0496111_0046827 Ga0496111_0046827_1703_2344 213
57 3300048927 Ga0496124_0209194 Ga0496124_0209194_796_1437 213
58 3300049573 Ga0501037_0254842 Ga0501037_0254842_50_691 213
59 3300049573 Ga0501037_0356572 Ga0501037_0356572_325_966 213
60 3300049580 Ga0501046_0029950 Ga0501046_0029950_1537_2178 213
61 3300049581 Ga0501047_0138334 Ga0501047_0138334_1399_2040 213
62 3300049582 Ga0501048_0114177 Ga0501048_0114177_889_1530 213
63 3300049822 Ga0501035_0888446 Ga0501035_0888446_52_693 213
64 3300049823 Ga0501044_0038747 Ga0501044_0038747_842_1483 213
65 3300005435 Ga0070714_100393182 Ga0070714_1003931822 214
66 3300025929 Ga0207664_10417408 Ga0207664_104174081 214
67 3300032002 Ga0307416_100809935 Ga0307416_1008099352 214
68 3300044765 Ga0466970_0008534 Ga0466970_0008534_1761_2408 214
69 iso_pu_bacteria 2547132111 2547407569 215
70 iso_pu_bacteria 2751185734 2753076384 215
71 iso_pu_bacteria 2784132148 2784591294 215
72 iso_pu_bacteria 2791355406 2793975422 215
73 iso_pu_bacteria 2808606375 2808913177 215
74 iso_pu_bacteria 2808606448 2809234872 215
75 iso_pu_bacteria 2818991463 2819698081 215
76 iso_pu_bacteria 2856741275 2856746897 215
77 iso_pu_bacteria 2862290372 2862296159 215
78 iso_pu_bacteria 2870721527 2870723195 215
79 iso_pu_bacteria 2873151551 2873153262 215
80 iso_pu_bacteria 2912723979 2912727545 215
81 iso_pu_bacteria 2917736166 2917740349 215
82 iso_pu_bacteria 2966598605 2966602563 215
83 iso_pu_bacteria 3002998708 3003002495 215
84 iso_pu_bacteria 8003314358 8003320388 215
85 iso_pu_bacteria 8025530807 8025530876 215
86 iso_pu_bacteria 8033684223 8033689034 215
87 iso_pu_bacteria 8047710418 8047710835 215
88 iso_pu_bacteria 8047893842 8047902713 215
89 iso_pu_bacteria 8048127548 8048134403 215
90 iso_pu_bacteria 8048369669 8048370511 215
91 iso_pu_bacteria 8048379754 8048388911 215
92 iso_pu_bacteria 8056060235 8056064962 215
93 3300005437 Ga0070710_10001340 Ga0070710_100013406 216
94 3300025898 Ga0207692_10000729 Ga0207692_100007297 216
95 3300030522 Ga0307512_10002113 Ga0307512_100021139 216
96 3300044658 Ga0466972_0023312 Ga0466972_0023312_1245_1895 216
97 3300053088 Ga0500644_0027429 Ga0500644_0027429_972_1628 216
98 3300053142 Ga0500577_0127287 Ga0500577_0127287_371_1027 216
99 3300003323 rootH1_10092987 rootH1_100929872 217
100 3300005435 Ga0070714_100001176 Ga0070714_10000117610 217
101 3300005436 Ga0070713_100674002 Ga0070713_1006740021 217
102 3300009988 Ga0105035_107588 Ga0105035_1075882 217
103 3300025928 Ga0207700_10091093 Ga0207700_100910932 217
104 3300025929 Ga0207664_10003528 Ga0207664_100035284 217
105 3300044683 Ga0466965_0002834 Ga0466965_0002834_6060_6713 217
106 3300044842 Ga0466957_0029860 Ga0466957_0029860_1378_2049 217
107 3300048929 Ga0496126_0282674 Ga0496126_0282674_537_1208 217
108 iso_pu_bacteria 2867369537 2867371127 217
109 3300013307 Ga0157372_10429492 Ga0157372_104294922 218
110 3300014325 Ga0163163_10691547 Ga0163163_106915472 218
111 3300044658 Ga0466972_0012734 Ga0466972_0012734_650_1306 218
112 3300044765 Ga0466970_0028063 Ga0466970_0028063_102_758 218
113 3300046519 Ga0495632_0232633 Ga0495632_0232633_113_787 218
114 3300049580 Ga0501046_0273955 Ga0501046_0273955_411_1097 218
115 3300049822 Ga0501035_0275621 Ga0501035_0275621_132_818 218
116 3300053153 Ga0500616_0001800 Ga0500616_0001800_5994_6668 218
117 3300003203 JGI25406J46586_10001428 JGI25406J46586_100014288 219
118 3300003320 rootH2_10107402 rootH2_101074023 219
119 3300005327 Ga0070658_10045999 Ga0070658_100459993 219
120 3300005338 Ga0068868_100433035 Ga0068868_1004330352 219
121 3300005347 Ga0070668_100005622 Ga0070668_1000056224 219
122 3300005435 Ga0070714_100010226 Ga0070714_1000102264 219
123 3300005441 Ga0070700_100258822 Ga0070700_1002588222 219
124 3300005455 Ga0070663_100000606 Ga0070663_10000060620 219
125 3300005985 Ga0081539_10000562 Ga0081539_1000056268 219
126 3300005985 Ga0081539_10001176 Ga0081539_1000117628 219
127 3300006844 Ga0075428_100036134 Ga0075428_1000361344 219
128 3300021388 Ga0213875_10002376 Ga0213875_100023763 219
129 3300021388 Ga0213875_10033481 Ga0213875_100334812 219
130 3300025909 Ga0207705_10200840 Ga0207705_102008401 219
131 3300025929 Ga0207664_10012938 Ga0207664_100129384 219
132 3300025972 Ga0207668_10175633 Ga0207668_101756333 219
133 3300026023 Ga0207677_10854711 Ga0207677_108547112 219
134 3300026035 Ga0207703_10682584 Ga0207703_106825842 219
135 3300026067 Ga0207678_10000377 Ga0207678_1000037718 219
136 3300028794 Ga0307515_10028947 Ga0307515_100289476 219
137 3300028794 Ga0307515_10109702 Ga0307515_101097025 219
138 3300030522 Ga0307512_10010879 Ga0307512_100108791 219
139 3300031456 Ga0307513_10105766 Ga0307513_101057662 219
140 3300031507 Ga0307509_10198605 Ga0307509_101986052 219
141 3300031616 Ga0307508_10158270 Ga0307508_101582702 219
142 3300031649 Ga0307514_10005058 Ga0307514_100050588 219
143 3300031649 Ga0307514_10025036 Ga0307514_100250365 219
144 3300031649 Ga0307514_10226019 Ga0307514_102260191 219
145 3300031649 Ga0307514_10269452 Ga0307514_102694522 219
146 3300031730 Ga0307516_10008741 Ga0307516_100087412 219
147 3300031731 Ga0307405_10912180 Ga0307405_109121801 219
148 3300031838 Ga0307518_10004273 Ga0307518_100042736 219
149 3300031995 Ga0307409_100239527 Ga0307409_1002395272 219
150 3300033180 Ga0307510_10015976 Ga0307510_100159763 219
151 3300037853 Ga0436364_0182053 Ga0436364_0182053_3692_4369 219
152 3300037853 Ga0436364_1317646 Ga0436364_1317646_13910_14623 219
153 3300039437 Ga0436365_1207417 Ga0436365_1207417_342_1019 219
154 3300041494 Ga0451837_1093907 Ga0451837_1093907_282_959 219
155 3300041494 Ga0451837_1470578 Ga0451837_1470578_24_710 219
156 3300041498 Ga0451841_1409592 Ga0451841_1409592_165_824 219
157 3300044656 Ga0466969_0019102 Ga0466969_0019102_2385_3086 219
158 3300044656 Ga0466969_0069241 Ga0466969_0069241_676_1335 219
159 3300044693 Ga0466961_0004500 Ga0466961_0004500_5718_6377 219
160 3300044765 Ga0466970_0014487 Ga0466970_0014487_919_1578 219
161 3300044842 Ga0466957_0024801 Ga0466957_0024801_92_763 219
162 3300045049 Ga0466959_0000135 Ga0466959_0000135_37491_38150 219
163 3300045976 Ga0466967_0159846 Ga0466967_0159846_1421_2080 219
164 3300045976 Ga0466967_0190911 Ga0466967_0190911_746_1408 219
165 3300045976 Ga0466967_0447557 Ga0466967_0447557_400_1059 219
166 3300046460 Ga0495638_0325487 Ga0495638_0325487_99_773 219
167 3300046794 Ga0495589_0173665 Ga0495589_0173665_112_804 219
168 3300048911 Ga0496108_0060357 Ga0496108_0060357_501_1193 219
169 3300048915 Ga0496112_0269620 Ga0496112_0269620_558_1220 219
170 3300049568 Ga0501031_0231540 Ga0501031_0231540_507_1190 219
171 3300049569 Ga0501032_0002897 Ga0501032_0002897_9241_9951 219
172 3300049570 Ga0501033_0006649 Ga0501033_0006649_7518_8273 219
173 3300049570 Ga0501033_0361284 Ga0501033_0361284_209_919 219
174 3300049571 Ga0501034_0014315 Ga0501034_0014315_5056_5811 219
175 3300049571 Ga0501034_0040124 Ga0501034_0040124_3046_3756 219
176 3300049571 Ga0501034_0279431 Ga0501034_0279431_454_1179 219
177 3300049572 Ga0501036_0002535 Ga0501036_0002535_218_973 219
178 3300049573 Ga0501037_0162946 Ga0501037_0162946_39_698 219
179 3300049573 Ga0501037_0611431 Ga0501037_0611431_15_698 219
180 3300049574 Ga0501038_0001730 Ga0501038_0001730_14363_15073 219
181 3300049574 Ga0501038_0013523 Ga0501038_0013523_1162_1821 219
182 3300049574 Ga0501038_0017865 Ga0501038_0017865_2790_3545 219
183 3300049575 Ga0501039_0004873 Ga0501039_0004873_6343_7098 219
184 3300049575 Ga0501039_0090830 Ga0501039_0090830_512_1171 219
185 3300049575 Ga0501039_0785544 Ga0501039_0785544_44_727 219
186 3300049579 Ga0501043_0001270 Ga0501043_0001270_18467_19222 219
187 3300049579 Ga0501043_0013405 Ga0501043_0013405_2972_3682 219
188 3300049579 Ga0501043_0036609 Ga0501043_0036609_777_1436 219
189 3300049579 Ga0501043_0047714 Ga0501043_0047714_2621_3304 219
190 3300049580 Ga0501046_0017381 Ga0501046_0017381_1822_2481 219
191 3300049580 Ga0501046_0140296 Ga0501046_0140296_1091_1801 219
192 3300049581 Ga0501047_0008696 Ga0501047_0008696_802_1512 219
193 3300049581 Ga0501047_0012628 Ga0501047_0012628_4251_4910 219
194 3300049581 Ga0501047_0012680 Ga0501047_0012680_2038_2721 219
195 3300049581 Ga0501047_0055474 Ga0501047_0055474_905_1660 219
196 3300049581 Ga0501047_0101207 Ga0501047_0101207_921_1580 219
197 3300049581 Ga0501047_0119249 Ga0501047_0119249_1309_1992 219
198 3300049582 Ga0501048_0359661 Ga0501048_0359661_272_931 219
199 3300049583 Ga0501067_0010903 Ga0501067_0010903_459_1169 219
200 3300049584 Ga0501068_0267626 Ga0501068_0267626_71_754 219
201 3300049585 Ga0501069_0342592 Ga0501069_0342592_134_817 219
202 3300049586 Ga0501070_0004445 Ga0501070_0004445_6524_7279 219
203 3300049586 Ga0501070_0052402 Ga0501070_0052402_662_1372 219
204 3300049589 Ga0501073_0070128 Ga0501073_0070128_471_1181 219
205 3300049589 Ga0501073_0464425 Ga0501073_0464425_22_681 219
206 3300049590 Ga0501074_0003577 Ga0501074_0003577_905_1660 219
207 3300049590 Ga0501074_0026289 Ga0501074_0026289_1432_2091 219
208 3300049590 Ga0501074_0218823 Ga0501074_0218823_633_1316 219
209 3300049744 Ga0501083_0004633 Ga0501083_0004633_5139_5849 219
210 3300049822 Ga0501035_0002572 Ga0501035_0002572_14744_15499 219
211 3300049822 Ga0501035_0030446 Ga0501035_0030446_3818_4519 219
212 3300049822 Ga0501035_0101317 Ga0501035_0101317_269_952 219
213 3300049823 Ga0501044_0021317 Ga0501044_0021317_487_1197 219
214 3300049823 Ga0501044_0121032 Ga0501044_0121032_938_1597 219
215 3300049823 Ga0501044_0139239 Ga0501044_0139239_360_1019 219
216 3300049823 Ga0501044_0253921 Ga0501044_0253921_20_682 219
217 3300049823 Ga0501044_0306258 Ga0501044_0306258_518_1177 219
218 3300049823 Ga0501044_0420531 Ga0501044_0420531_130_813 219
219 3300053149 Ga0500600_0099772 Ga0500600_0099772_421_1080 219
220 3300053153 Ga0500616_0000103 Ga0500616_0000103_1922_2638 219
221 3300054114 Ga0501084_0162008 Ga0501084_0162008_331_1041 219
222 3300054114 Ga0501084_0200044 Ga0501084_0200044_774_1433 219
223 3300060353 Ga0501082_0011489 Ga0501082_0011489_3118_3828 219
224 iso_pu_bacteria 2643221678 2644442860 219
225 iso_pu_bacteria 2954711539 2954719714 219
226 iso_pu_bacteria 2954721474 2954729749 219
227 iso_pu_bacteria 2954731030 2954732030 219
228 iso_pu_bacteria 2954740390 2954748655 219
229 iso_pu_bacteria 2954749733 2954750999 219
230 iso_pu_bacteria 2954759201 2954767772 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

188

244

0.98

PF00072

Response_reg

Response regulator receiver domain

39

153

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9955 157 218
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9949 158 218
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.991 157 218
4wul-assembly1.cif.gz_B crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9901 158 218
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9866 157 219
ID Description Score Start End Superfamily
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9804 158 217 1.10.10.10
4if4D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9789 157 217 1.10.10.10
4hyeB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9729 157 216 1.10.10.10
4if4B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9722 157 219 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9634 158 212 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6L7LCM3-F1-model_v4 Response regulator transcription factor 0.9963 4 106 GO:0000160
GO:0003677
AF-A0A022MGP4-F1-model_v4 LuxR family transcriptional regulator 0.9759 4 138 GO:0000160
GO:0003677
AF-A0A5N8WA06-F1-model_v4 Response regulator transcription factor 0.9665 2 126 GO:0000160
GO:0003677
AF-A0A4R4ZHZ6-F1-model_v4 Response regulator transcription factor 0.9638 4 219 GO:0000160
GO:0003677
GO:0006355
AF-A0A6L7LCM3-F1-model_v4 Response regulator transcription factor 0.9591 4 106 GO:0000160
GO:0003677

Feature Viewer

pLDDT pTM Quality
84.45 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map