F343432

General Info

Members Datasets Scaffolds Average Seq Length
230 174 460 208

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0002068|Ga0501033_0002068_14835_15524
Length 229
Sequence MNPKPIEIDPRPSALIRVQRALVPTTHHTTKGHRMKLVLASSNVGKLAELRELLGSDFELHAQSEFGVDDAEETGLSFIENAILKARHAARATGLPALGDDSGLCVDALHGAPGLYSARYAGRHGDSEANIDKLLHELDRVSDDARDARFVCVLALVRHADDPMPLVAEGTWEGRILRERRGDNGFGYDPVFFSPAHGCGAAELPADVKNRDSHRGVALAKLRDRLRQS

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
116 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
123 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
126 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
127 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
132 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
133 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
134 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
135 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
137 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
164 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.3
Nodule 0
Rhizoplane 6.96
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0002068 3300049570 Bacteria 17441
2 MRS1b_contig_4219571 2162886011 Bacteria 1817
3 MBSR1b_contig_40899 2162886012 Bacteria 1214
4 JGI25162J39368_1001653 3300002737 Bacteria 11062
5 JGI25164J39214_1000739 3300002772 Bacteria 12179
6 JGI25165J46597_1001586 3300003214 Bacteria 11066
7 Ga0055524_1014975 3300003775 Bacteria 2849
8 Ga0055536_1014757 3300003781 Bacteria 2717
9 Ga0055531_10012887 3300003794 Bacteria 3894
10 Ga0055531_10020641 3300003794 Bacteria 2596
11 Ga0055531_10022851 3300003794 Bacteria 2367
12 Ga0065712_10086618 3300005290 Bacteria 2625
13 Ga0070676_10016378 3300005328 Bacteria 4098
14 Ga0070690_100113661 3300005330 Bacteria 1810
15 Ga0070670_100378752 3300005331 Bacteria 1246
16 Ga0070677_10006428 3300005333 Bacteria 3904
17 Ga0068869_100566928 3300005334 Bacteria 956
18 Ga0070680_100045327 3300005336 Bacteria 3575
19 Ga0070680_100261930 3300005336 Bacteria 1463
20 Ga0070680_100729655 3300005336 Bacteria 853
21 Ga0070682_100011618 3300005337 Bacteria 5035
22 Ga0068868_100051161 3300005338 Bacteria 3248
23 Ga0070687_100208930 3300005343 Bacteria 1188
24 Ga0070687_100230493 3300005343 Bacteria 1139
25 Ga0070669_100109133 3300005353 Bacteria 2098
26 Ga0070669_100477011 3300005353 Bacteria 1032
27 Ga0070671_100012622 3300005355 Bacteria 6809
28 Ga0070674_100205019 3300005356 Bacteria 1525
29 Ga0070673_100100947 3300005364 Bacteria 2376
30 Ga0070688_100077804 3300005365 Bacteria 2138
31 Ga0070659_100279752 3300005366 Bacteria 1388
32 Ga0070709_10006890 3300005434 Bacteria 6205
33 Ga0070710_10007842 3300005437 Bacteria 5182
34 Ga0070700_100029014 3300005441 Bacteria 3295
35 Ga0070694_100200117 3300005444 Bacteria 1488
36 Ga0070708_100000190 3300005445 Bacteria 44442
37 Ga0070678_100174646 3300005456 Bacteria 1753
38 Ga0070678_100977681 3300005456 Bacteria 777
39 Ga0070662_100007745 3300005457 Bacteria 6975
40 Ga0070662_100362226 3300005457 Bacteria 1190
41 Ga0070662_100627132 3300005457 Bacteria 906
42 Ga0070662_100637660 3300005457 Bacteria 898
43 Ga0070681_10023540 3300005458 Bacteria 6195
44 Ga0070681_10210432 3300005458 Bacteria 1861
45 Ga0070681_10343941 3300005458 Bacteria 1402
46 Ga0068867_100401153 3300005459 Bacteria 1157
47 Ga0070706_100076377 3300005467 Bacteria 3100
48 Ga0070707_100009409 3300005468 Bacteria 9070
49 Ga0070707_100101418 3300005468 Bacteria 2789
50 Ga0070699_100039726 3300005518 Bacteria 4074
51 Ga0070679_100072425 3300005530 Bacteria 3438
52 Ga0070679_100941256 3300005530 Bacteria 808
53 Ga0070697_100041735 3300005536 Bacteria 3714
54 Ga0070697_100147044 3300005536 Bacteria 1984
55 Ga0068853_100001088 3300005539 Bacteria 19232
56 Ga0070686_100627505 3300005544 Bacteria 850
57 Ga0070695_100028055 3300005545 Bacteria 3492
58 Ga0070693_100042728 3300005547 Bacteria 2555
59 Ga0070665_100021004 3300005548 Bacteria 6563
60 Ga0070704_100119343 3300005549 Bacteria 2022
61 Ga0070704_100422705 3300005549 Bacteria 1142
62 Ga0068855_100004411 3300005563 Bacteria 17201
63 Ga0068855_100027753 3300005563 Bacteria 6773
64 Ga0068857_100192922 3300005577 Bacteria 1855
65 Ga0070702_100420311 3300005615 Bacteria 962
66 Ga0068863_100006847 3300005841 Bacteria 11175
67 Ga0068858_100519711 3300005842 Bacteria 1151
68 Ga0070716_100134135 3300006173 Bacteria 1570
69 Ga0070716_100469415 3300006173 Bacteria 922
70 Ga0075369_10107515 3300006186 Bacteria 1255
71 Ga0068871_100620703 3300006358 Bacteria 984
72 Ga0075428_100000078 3300006844 Bacteria 80448
73 Ga0075431_100357103 3300006847 Bacteria 1468
74 Ga0075433_10012740 3300006852 Bacteria 6807
75 Ga0075434_100019696 3300006871 Bacteria 6531
76 Ga0068865_100016969 3300006881 Bacteria 4673
77 Ga0075435_100063705 3300007076 Bacteria 2994
78 Ga0105240_10111198 3300009093 Bacteria 3314
79 Ga0111539_10003898 3300009094 Bacteria 19617
80 Ga0111539_10016710 3300009094 Bacteria 9094
81 Ga0105245_10028557 3300009098 Bacteria 4922
82 Ga0114129_11949809 3300009147 Unclassified 711
83 Ga0105237_10049834 3300009545 Bacteria 4208
84 Ga0105249_10027717 3300009553 Bacteria 5112
85 Ga0105239_10039510 3300010375 Bacteria 5170
86 Ga0157373_10519804 3300013100 Bacteria 861
87 Ga0157369_10283091 3300013105 Bacteria 1727
88 Ga0157374_10359345 3300013296 Bacteria 1448
89 Ga0157374_11506875 3300013296 Bacteria 696
90 Ga0157378_10136681 3300013297 Bacteria 2273
91 Ga0157378_10226953 3300013297 Bacteria 1778
92 Ga0157378_10358234 3300013297 Bacteria 1427
93 Ga0157378_10460738 3300013297 Bacteria 1263
94 Ga0157372_10003020 3300013307 Bacteria 18141
95 Ga0157375_10398583 3300013308 Bacteria 1543
96 Ga0163161_10285044 3300017792 Bacteria 1297
97 Ga0163161_10346777 3300017792 Bacteria 1179
98 Ga0213875_10243395 3300021388 Bacteria 848
99 Ga0207427_100340 3300025231 Bacteria 30498
100 Ga0209437_100303 3300025233 Bacteria 68428
101 Ga0209233_1000379 3300025261 Bacteria 38943
102 Ga0209675_1020554 3300025291 Bacteria 1785
103 Ga0209676_1009537 3300025292 Bacteria 4175
104 Ga0209676_1012157 3300025292 Bacteria 3411
105 Ga0209025_1002899 3300025294 Bacteria 17122
106 Ga0209564_1011871 3300025295 Bacteria 3858
107 Ga0209564_1014075 3300025295 Bacteria 3351
108 Ga0209256_1004465 3300025299 Bacteria 8756
109 Ga0209051_1005290 3300025303 Bacteria 7608
110 Ga0209257_1001577 3300025304 Bacteria 26294
111 Ga0209257_1001627 3300025304 Bacteria 25721
112 Ga0209257_1016283 3300025304 Bacteria 3018
113 Ga0207682_10000440 3300025893 Bacteria 19222
114 Ga0207642_10036405 3300025899 Bacteria 2111
115 Ga0207688_10082050 3300025901 Bacteria 1842
116 Ga0207680_10396187 3300025903 Bacteria 975
117 Ga0207699_10013947 3300025906 Bacteria 4128
118 Ga0207645_10031476 3300025907 Bacteria 3412
119 Ga0207645_10272929 3300025907 Bacteria 1122
120 Ga0207707_10020437 3300025912 Bacteria 5782
121 Ga0207707_10557935 3300025912 Bacteria 973
122 Ga0207671_10103841 3300025914 Bacteria 2155
123 Ga0207660_10063382 3300025917 Bacteria 2665
124 Ga0207662_10067880 3300025918 Bacteria 2152
125 Ga0207662_10530865 3300025918 Bacteria 813
126 Ga0207646_10003945 3300025922 Bacteria 16453
127 Ga0207681_10004808 3300025923 Bacteria 8310
128 Ga0207681_10039918 3300025923 Bacteria 3120
129 Ga0207659_10209826 3300025926 Bacteria 1560
130 Ga0207687_10170922 3300025927 Bacteria 1676
131 Ga0207644_10288213 3300025931 Bacteria 1320
132 Ga0207690_10186117 3300025932 Bacteria 1567
133 Ga0207706_10039732 3300025933 Bacteria 4172
134 Ga0207706_10065326 3300025933 Bacteria 3204
135 Ga0207706_10624702 3300025933 Bacteria 924
136 Ga0207669_10283409 3300025937 Bacteria 1251
137 Ga0207669_10286381 3300025937 Bacteria 1245
138 Ga0207665_10004505 3300025939 Bacteria 9241
139 Ga0207691_10014641 3300025940 Bacteria 7478
140 Ga0207667_10012628 3300025949 Bacteria 9709
141 Ga0207667_10014680 3300025949 Bacteria 8915
142 Ga0207658_10048479 3300025986 Bacteria 3115
143 Ga0207677_10145943 3300026023 Bacteria 1818
144 Ga0207677_10186100 3300026023 Bacteria 1638
145 Ga0207639_10006479 3300026041 Bacteria 7961
146 Ga0207641_10049278 3300026088 Bacteria 3558
147 Ga0207648_10021074 3300026089 Bacteria 5862
148 Ga0207648_10051813 3300026089 Bacteria 3587
149 Ga0207674_10257481 3300026116 Bacteria 1692
150 Ga0207675_100128539 3300026118 Bacteria 2401
151 Ga0207675_100149893 3300026118 Bacteria 2219
152 Ga0207683_10001286 3300026121 Bacteria 22707
153 Ga0207683_10025247 3300026121 Bacteria 5124
154 Ga0207683_10658882 3300026121 Bacteria 970
155 Ga0207428_10027981 3300027907 Bacteria 4688
156 Ga0316177_1041140 3300030731 Bacteria 1048
157 Ga0314311_1041235 3300030733 Bacteria 5501
158 Ga0265327_10063538 3300031251 Bacteria 1874
159 Ga0307410_10621745 3300031852 Bacteria 903
160 Ga0307414_10118267 3300032004 Bacteria 2032
161 Ga0307414_10282318 3300032004 Bacteria 1396
162 Ga0307411_10642405 3300032005 Bacteria 918
163 Ga0316593_10089832 3300032168 Bacteria 1081
164 Ga0373948_0063846 3300034817 Bacteria 813
165 Ga0373959_0022743 3300034820 Bacteria 1214
166 Ga0373943_0345404 3300035170 Bacteria 852
167 Ga0316574_0515030 3300035398 Bacteria 745
168 Ga0316582_0109968 3300036647 Bacteria 1833
169 Ga0316584_0314925 3300036712 Bacteria 1130
170 Ga0436364_0397428 3300037853 Bacteria 1853
171 Ga0439439_0116021 3300041406 Bacteria 745
172 Ga0451807_1818941 3300041486 Bacteria 1554
173 Ga0451843_0046603 3300041509 Bacteria 3009
174 Ga0495590_0083993 3300046457 Bacteria 1123
175 Ga0495598_0030518 3300046537 Bacteria 1511
176 Ga0495598_0071953 3300046537 Bacteria 1091
177 Ga0495598_0186721 3300046537 Bacteria 742
178 Ga0495621_0241016 3300046539 Bacteria 736
179 Ga0495656_0003767 3300046615 Bacteria 5151
180 Ga0495636_0019605 3300047318 Bacteria 2720
181 Ga0495685_040281 3300047447 Bacteria 1598
182 Ga0496100_0017312 3300048903 Bacteria 4252
183 Ga0496100_0223862 3300048903 Bacteria 1382
184 Ga0496101_0281270 3300048904 Bacteria 1300
185 Ga0496106_0021366 3300048909 Bacteria 4806
186 Ga0496107_0421745 3300048910 Bacteria 992
187 Ga0496108_0137092 3300048911 Bacteria 2106
188 Ga0496109_0390634 3300048912 Bacteria 1314
189 Ga0496110_0078731 3300048913 Bacteria 2935
190 Ga0496111_0132580 3300048914 Bacteria 1844
191 Ga0496111_0424175 3300048914 Bacteria 982
192 Ga0496112_0070170 3300048915 Bacteria 3462
193 Ga0496112_0826758 3300048915 Bacteria 850
194 Ga0496113_0183178 3300048916 Bacteria 1660
195 Ga0496113_0221353 3300048916 Bacteria 1508
196 Ga0496114_0101763 3300048917 Bacteria 2453
197 Ga0496124_0083933 3300048927 Bacteria 2613
198 Ga0501031_0019915 3300049568 Bacteria 4374
199 Ga0501032_0153237 3300049569 Bacteria 1515
200 Ga0501032_0163206 3300049569 Bacteria 1462
201 Ga0501034_0016441 3300049571 Bacteria 7593
202 Ga0501034_0527352 3300049571 Bacteria 1092
203 Ga0501034_0572645 3300049571 Bacteria 1037
204 Ga0501036_0011821 3300049572 Bacteria 7236
205 Ga0501037_0005912 3300049573 Bacteria 8934
206 Ga0501037_0411559 3300049573 Bacteria 926
207 Ga0501038_0009864 3300049574 Bacteria 8740
208 Ga0501039_0092338 3300049575 Bacteria 2359
209 Ga0501043_0044158 3300049579 Bacteria 3504
210 Ga0501043_0167002 3300049579 Bacteria 1718
211 Ga0501047_0018068 3300049581 Bacteria 6758
212 Ga0501068_0074577 3300049584 Bacteria 2074
213 Ga0501070_0019913 3300049586 Bacteria 5626
214 Ga0501073_0246562 3300049589 Bacteria 1233
215 Ga0501080_0012112 3300049742 Bacteria 7901
216 Ga0501265_004054 3300049762 Bacteria 1665
217 Ga0501275_000244 3300049772 Bacteria 6360
218 Ga0501035_0011237 3300049822 Bacteria 8294
219 Ga0501044_0012502 3300049823 Bacteria 9191
220 nmdc:mga00v17_123617_c1 3300050491 Bacteria 1650
221 nmdc:mga06z11_38810_c1 3300050494 Bacteria 2366
222 nmdc:mga05p37_1014558_c1 3300050507 Bacteria 880
223 nmdc:mga09592_1968_c1 3300050508 Bacteria 16572
224 nmdc:mga06r32_240804_c1 3300050510 Bacteria 1797
225 nmdc:mga06r32_455_c1 3300050510 Bacteria 34902
226 nmdc:mga08y16_230491_c1 3300050511 Bacteria 1915
227 nmdc:mga08y16_4582_c1 3300050511 Bacteria 14411
228 nmdc:mga08y16_5621_c1 3300050511 Bacteria 13132
229 nmdc:mga0rr50_121981_c1 3300050513 Bacteria 2076
230 nmdc:mga0sz30_218464_c1 3300050516 Bacteria 847
231 Ga0501033_0002068
232 MRS1b_contig_4219571
233 MBSR1b_contig_40899
234 JGI25162J39368_1001653
235 JGI25164J39214_1000739
236 JGI25165J46597_1001586
237 Ga0055524_1014975
238 Ga0055536_1014757
239 Ga0055531_10012887
240 Ga0055531_10020641
241 Ga0055531_10022851
242 Ga0065712_10086618
243 Ga0070676_10016378
244 Ga0070690_100113661
245 Ga0070670_100378752
246 Ga0070677_10006428
247 Ga0068869_100566928
248 Ga0070680_100045327
249 Ga0070680_100261930
250 Ga0070680_100729655
251 Ga0070682_100011618
252 Ga0068868_100051161
253 Ga0070687_100208930
254 Ga0070687_100230493
255 Ga0070669_100109133
256 Ga0070669_100477011
257 Ga0070671_100012622
258 Ga0070674_100205019
259 Ga0070673_100100947
260 Ga0070688_100077804
261 Ga0070659_100279752
262 Ga0070709_10006890
263 Ga0070710_10007842
264 Ga0070700_100029014
265 Ga0070694_100200117
266 Ga0070708_100000190
267 Ga0070678_100174646
268 Ga0070678_100977681
269 Ga0070662_100007745
270 Ga0070662_100362226
271 Ga0070662_100627132
272 Ga0070662_100637660
273 Ga0070681_10023540
274 Ga0070681_10210432
275 Ga0070681_10343941
276 Ga0068867_100401153
277 Ga0070706_100076377
278 Ga0070707_100009409
279 Ga0070707_100101418
280 Ga0070699_100039726
281 Ga0070679_100072425
282 Ga0070679_100941256
283 Ga0070697_100041735
284 Ga0070697_100147044
285 Ga0068853_100001088
286 Ga0070686_100627505
287 Ga0070695_100028055
288 Ga0070693_100042728
289 Ga0070665_100021004
290 Ga0070704_100119343
291 Ga0070704_100422705
292 Ga0068855_100004411
293 Ga0068855_100027753
294 Ga0068857_100192922
295 Ga0070702_100420311
296 Ga0068863_100006847
297 Ga0068858_100519711
298 Ga0070716_100134135
299 Ga0070716_100469415
300 Ga0075369_10107515
301 Ga0068871_100620703
302 Ga0075428_100000078
303 Ga0075431_100357103
304 Ga0075433_10012740
305 Ga0075434_100019696
306 Ga0068865_100016969
307 Ga0075435_100063705
308 Ga0105240_10111198
309 Ga0111539_10003898
310 Ga0111539_10016710
311 Ga0105245_10028557
312 Ga0114129_11949809
313 Ga0105237_10049834
314 Ga0105249_10027717
315 Ga0105239_10039510
316 Ga0157373_10519804
317 Ga0157369_10283091
318 Ga0157374_10359345
319 Ga0157374_11506875
320 Ga0157378_10136681
321 Ga0157378_10226953
322 Ga0157378_10358234
323 Ga0157378_10460738
324 Ga0157372_10003020
325 Ga0157375_10398583
326 Ga0163161_10285044
327 Ga0163161_10346777
328 Ga0213875_10243395
329 Ga0207427_100340
330 Ga0209437_100303
331 Ga0209233_1000379
332 Ga0209675_1020554
333 Ga0209676_1009537
334 Ga0209676_1012157
335 Ga0209025_1002899
336 Ga0209564_1011871
337 Ga0209564_1014075
338 Ga0209256_1004465
339 Ga0209051_1005290
340 Ga0209257_1001577
341 Ga0209257_1001627
342 Ga0209257_1016283
343 Ga0207682_10000440
344 Ga0207642_10036405
345 Ga0207688_10082050
346 Ga0207680_10396187
347 Ga0207699_10013947
348 Ga0207645_10031476
349 Ga0207645_10272929
350 Ga0207707_10020437
351 Ga0207707_10557935
352 Ga0207671_10103841
353 Ga0207660_10063382
354 Ga0207662_10067880
355 Ga0207662_10530865
356 Ga0207646_10003945
357 Ga0207681_10004808
358 Ga0207681_10039918
359 Ga0207659_10209826
360 Ga0207687_10170922
361 Ga0207644_10288213
362 Ga0207690_10186117
363 Ga0207706_10039732
364 Ga0207706_10065326
365 Ga0207706_10624702
366 Ga0207669_10283409
367 Ga0207669_10286381
368 Ga0207665_10004505
369 Ga0207691_10014641
370 Ga0207667_10012628
371 Ga0207667_10014680
372 Ga0207658_10048479
373 Ga0207677_10145943
374 Ga0207677_10186100
375 Ga0207639_10006479
376 Ga0207641_10049278
377 Ga0207648_10021074
378 Ga0207648_10051813
379 Ga0207674_10257481
380 Ga0207675_100128539
381 Ga0207675_100149893
382 Ga0207683_10001286
383 Ga0207683_10025247
384 Ga0207683_10658882
385 Ga0207428_10027981
386 Ga0316177_1041140
387 Ga0314311_1041235
388 Ga0265327_10063538
389 Ga0307410_10621745
390 Ga0307414_10118267
391 Ga0307414_10282318
392 Ga0307411_10642405
393 Ga0316593_10089832
394 Ga0373948_0063846
395 Ga0373959_0022743
396 Ga0373943_0345404
397 Ga0316574_0515030
398 Ga0316582_0109968
399 Ga0316584_0314925
400 Ga0436364_0397428
401 Ga0439439_0116021
402 Ga0451807_1818941
403 Ga0451843_0046603
404 Ga0495590_0083993
405 Ga0495598_0030518
406 Ga0495598_0071953
407 Ga0495598_0186721
408 Ga0495621_0241016
409 Ga0495656_0003767
410 Ga0495636_0019605
411 Ga0495685_040281
412 Ga0496100_0017312
413 Ga0496100_0223862
414 Ga0496101_0281270
415 Ga0496106_0021366
416 Ga0496107_0421745
417 Ga0496108_0137092
418 Ga0496109_0390634
419 Ga0496110_0078731
420 Ga0496111_0132580
421 Ga0496111_0424175
422 Ga0496112_0070170
423 Ga0496112_0826758
424 Ga0496113_0183178
425 Ga0496113_0221353
426 Ga0496114_0101763
427 Ga0496124_0083933
428 Ga0501031_0019915
429 Ga0501032_0153237
430 Ga0501032_0163206
431 Ga0501034_0016441
432 Ga0501034_0527352
433 Ga0501034_0572645
434 Ga0501036_0011821
435 Ga0501037_0005912
436 Ga0501037_0411559
437 Ga0501038_0009864
438 Ga0501039_0092338
439 Ga0501043_0044158
440 Ga0501043_0167002
441 Ga0501047_0018068
442 Ga0501068_0074577
443 Ga0501070_0019913
444 Ga0501073_0246562
445 Ga0501080_0012112
446 Ga0501265_004054
447 Ga0501275_000244
448 Ga0501035_0011237
449 Ga0501044_0012502
450 nmdc:mga00v17_123617_c1
451 nmdc:mga06z11_38810_c1
452 nmdc:mga05p37_1014558_c1
453 nmdc:mga09592_1968_c1
454 nmdc:mga06r32_240804_c1
455 nmdc:mga06r32_455_c1
456 nmdc:mga08y16_230491_c1
457 nmdc:mga08y16_4582_c1
458 nmdc:mga08y16_5621_c1
459 nmdc:mga0rr50_121981_c1
460 nmdc:mga0sz30_218464_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01725

Ham1p_like

Ham1 family

37

225

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.9282 1 192
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.9126 4 189
2pyu-assembly1.cif.gz_A-2 structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with imp 0.912 1 190
1k7k-assembly1.cif.gz_A crystal structure of rdgb- inosine triphosphate pyrophosphatase from e. coli 0.9109 1 189
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.91 1 192
ID Description Score Start End Superfamily
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9331 1 192 3.90.950.10
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9148 1 192 3.90.950.10
3s86D00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8984 1 192 3.90.950.10
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8947 1 195 3.90.950.10
1b78B00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8946 4 191 3.90.950.10
ID Description Score Start End GO Terms
AF-X1HZP5-F1-model_v4 Non-canonical purine NTP pyrophosphatase 0.9792 92 191 GO:0005829
GO:0009143
GO:0047429
AF-A0A6L8BB64-F1-model_v4 Non-canonical purine NTP pyrophosphatase 0.9782 73 192 GO:0005829
GO:0009117
GO:0009143
GO:0047429
AF-A0A2N2JQW4-F1-model_v4 Non-canonical purine NTP pyrophosphatase 0.9733 90 191 GO:0005829
GO:0009143
GO:0047429
AF-A0A1E7GQ60-F1-model_v4 Non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family 0.9715 34 192 GO:0000166
GO:0005829
GO:0009117
GO:0009143
GO:0017111
GO:0046872
GO:0047429
AF-A0A1V4XH31-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9715 33 192 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872

Map