F343379

General Info

Members Datasets Scaffolds Average Seq Length
230 149 460 206

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0005418|Ga0495686_0005418_4357_5064
Length 235
Sequence LPSNLNNDHTLRQPTQRFENPVGCVKPPGMTLRPLFVTPIYEATLTTNRSFENFNGEILEACQELAAEDQAGRAWCREHGYGGYTSYASLDDLPTRMSVFADLKAMLDKHAKAFAADLSLDLRGGKLRLDSLWVNILKPGAAHSGHIHPHSVISGTVYVATPPGASALKLEDPRLPLMMAAPPRLADAPEAAQAFVYLQPEPGTVYMWESWLRHEVPANRAKTPRVSISFNYGWR

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
40 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
41 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
70 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
75 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
76 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
77 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
100 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
101 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
102 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
103 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
117 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
136 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
137 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
138 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
139 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
140 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
141 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
144 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
145 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
146 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
147 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
148 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
149 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.39
Metatranscriptomes 0
Isolates 2.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.91
Nodule 0
Rhizoplane 3.48
Rhizosphere 75.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0005418 3300047472 Bacteria 10079
2 Ga0055530_10000008 3300003791 Bacteria 174217
3 Ga0055531_10026689 3300003794 Bacteria 2051
4 Ga0055531_10068306 3300003794 Bacteria 831
5 Ga0055543_1018176 3300004625 Bacteria 1314
6 Ga0065165_1000222 3300005262 Bacteria 99737
7 Ga0065165_1023015 3300005262 Bacteria 2122
8 Ga0065165_1041537 3300005262 Bacteria 1365
9 Ga0065165_1058743 3300005262 Bacteria 1061
10 Ga0070658_10126601 3300005327 Bacteria 2127
11 Ga0068869_100313605 3300005334 Bacteria 1270
12 Ga0070691_10002541 3300005341 Bacteria 8128
13 Ga0070668_100000191 3300005347 Bacteria 40174
14 Ga0070668_100008796 3300005347 Bacteria 7500
15 Ga0070669_100399497 3300005353 Bacteria 1124
16 Ga0070671_100006880 3300005355 Bacteria 9106
17 Ga0070659_100075802 3300005366 Bacteria 2681
18 Ga0070667_100000078 3300005367 Bacteria 119527
19 Ga0070667_100017048 3300005367 Bacteria 6015
20 Ga0070681_10104927 3300005458 Bacteria 2768
21 Ga0068853_100222160 3300005539 Bacteria 1726
22 Ga0070665_100000584 3300005548 Bacteria 50864
23 Ga0070665_100002379 3300005548 Bacteria 20778
24 Ga0070665_100565055 3300005548 Bacteria 1150
25 Ga0068859_100000305 3300005617 Bacteria 48843
26 Ga0068859_100026607 3300005617 Bacteria 5801
27 Ga0068859_100092887 3300005617 Bacteria 3069
28 Ga0068859_100267302 3300005617 Bacteria 1802
29 Ga0068864_100000052 3300005618 Bacteria 133777
30 Ga0068864_100006213 3300005618 Bacteria 9794
31 Ga0068861_100049244 3300005719 Bacteria 3189
32 Ga0068863_100000207 3300005841 Bacteria 62761
33 Ga0068863_100006994 3300005841 Bacteria 11059
34 Ga0068858_100000511 3300005842 Bacteria 40771
35 Ga0068858_100001420 3300005842 Bacteria 24630
36 Ga0068860_100000292 3300005843 Bacteria 70893
37 Ga0068860_100000651 3300005843 Bacteria 40516
38 Ga0068860_100010095 3300005843 Bacteria 9356
39 Ga0068860_100103601 3300005843 Bacteria 2716
40 Ga0068860_100335060 3300005843 Bacteria 1487
41 Ga0068862_100003472 3300005844 Bacteria 13555
42 Ga0068862_100012650 3300005844 Bacteria 6984
43 Ga0068862_100016012 3300005844 Bacteria 6235
44 Ga0068862_100031757 3300005844 Bacteria 4461
45 Ga0081539_10013073 3300005985 Bacteria 6294
46 Ga0075363_100094132 3300006048 Bacteria 1652
47 Ga0075367_10413109 3300006178 Bacteria 854
48 Ga0097620_100000305 3300006931 Bacteria 48843
49 Ga0097620_100026607 3300006931 Bacteria 5801
50 Ga0097620_100092887 3300006931 Bacteria 3069
51 Ga0097620_100267270 3300006931 Bacteria 1802
52 Ga0105240_10019041 3300009093 Bacteria 9182
53 Ga0105240_10215687 3300009093 Bacteria 2239
54 Ga0105241_10482493 3300009174 Bacteria 1102
55 Ga0105248_10085777 3300009177 Bacteria 3543
56 Ga0105248_10194252 3300009177 Bacteria 2287
57 Ga0105237_10895722 3300009545 Bacteria 894
58 Ga0105238_10031235 3300009551 Bacteria 5422
59 Ga0105249_10000306 3300009553 Bacteria 49970
60 Ga0157373_10001308 3300013100 Bacteria 19025
61 Ga0157373_10045958 3300013100 Bacteria 3116
62 Ga0157373_10424778 3300013100 Bacteria 954
63 Ga0163162_11033999 3300013306 Bacteria 929
64 Ga0163163_10017315 3300014325 Bacteria 6720
65 Ga0163163_10032382 3300014325 Bacteria 5048
66 Ga0157379_10000663 3300014968 Bacteria 27864
67 Ga0157379_10023651 3300014968 Bacteria 5454
68 Ga0213876_10065299 3300021384 Bacteria 1921
69 Ga0209026_1000525 3300025250 Bacteria 26985
70 Ga0209758_1000215 3300025297 Bacteria 125461
71 Ga0209050_1000049 3300025298 Bacteria 364096
72 Ga0209257_1000924 3300025304 Bacteria 40835
73 Ga0209257_1002694 3300025304 Bacteria 16967
74 Ga0207710_10335668 3300025900 Bacteria 768
75 Ga0207680_10323424 3300025903 Bacteria 1079
76 Ga0207705_10001004 3300025909 Bacteria 22921
77 Ga0207707_10027542 3300025912 Bacteria 4969
78 Ga0207695_10001725 3300025913 Bacteria 34948
79 Ga0207695_10043701 3300025913 Bacteria 4774
80 Ga0207695_10138316 3300025913 Bacteria 2387
81 Ga0207660_10072258 3300025917 Bacteria 2512
82 Ga0207657_10047908 3300025919 Bacteria 3733
83 Ga0207681_10118675 3300025923 Bacteria 1936
84 Ga0207694_10025402 3300025924 Bacteria 4503
85 Ga0207694_10425647 3300025924 Bacteria 1106
86 Ga0207650_10000014 3300025925 Bacteria 398063
87 Ga0207650_10096424 3300025925 Bacteria 2269
88 Ga0207650_10192087 3300025925 Bacteria 1632
89 Ga0207644_10039397 3300025931 Bacteria 3335
90 Ga0207644_10168962 3300025931 Bacteria 1706
91 Ga0207690_10000407 3300025932 Bacteria 28231
92 Ga0207690_10059444 3300025932 Bacteria 2590
93 Ga0207690_10089891 3300025932 Bacteria 2166
94 Ga0207711_10002889 3300025941 Bacteria 15050
95 Ga0207711_10112223 3300025941 Bacteria 2426
96 Ga0207661_10928393 3300025944 Bacteria 802
97 Ga0207667_10037670 3300025949 Bacteria 5168
98 Ga0207667_10423553 3300025949 Bacteria 1354
99 Ga0207712_10000441 3300025961 Bacteria 35316
100 Ga0207668_10000073 3300025972 Bacteria 76313
101 Ga0207668_10013876 3300025972 Bacteria 4974
102 Ga0207668_10083848 3300025972 Bacteria 2320
103 Ga0207668_10596849 3300025972 Bacteria 961
104 Ga0207658_10000485 3300025986 Bacteria 36718
105 Ga0207658_10013714 3300025986 Bacteria 5542
106 Ga0207677_10170419 3300026023 Bacteria 1702
107 Ga0207703_10014046 3300026035 Bacteria 6241
108 Ga0207641_10000976 3300026088 Bacteria 29280
109 Ga0207641_10001099 3300026088 Bacteria 27170
110 Ga0207641_10109339 3300026088 Bacteria 2448
111 Ga0207676_10000069 3300026095 Bacteria 104526
112 Ga0207676_10141832 3300026095 Bacteria 2058
113 Ga0207675_100047205 3300026118 Bacteria 4021
114 Ga0207675_100283610 3300026118 Bacteria 1610
115 Ga0268266_10000003 3300028379 Bacteria 1701703
116 Ga0268266_10003212 3300028379 Bacteria 16527
117 Ga0268266_10257222 3300028379 Bacteria 1617
118 Ga0268265_10001070 3300028380 Bacteria 24422
119 Ga0268265_10001825 3300028380 Bacteria 17013
120 Ga0268265_10052451 3300028380 Bacteria 3085
121 Ga0268265_10069669 3300028380 Bacteria 2732
122 Ga0268265_10455941 3300028380 Bacteria 1195
123 Ga0268264_10000055 3300028381 Bacteria 314947
124 Ga0268264_10000199 3300028381 Bacteria 122707
125 Ga0268264_10017051 3300028381 Bacteria 5947
126 Ga0268264_10069773 3300028381 Bacteria 2973
127 Ga0265337_1018131 3300028556 Bacteria 2242
128 Ga0265319_1000250 3300028563 Bacteria 40447
129 Ga0265318_10000040 3300028577 Bacteria 135603
130 Ga0307517_10000710 3300028786 Bacteria 57392
131 Ga0307517_10309923 3300028786 Bacteria 880
132 Ga0265338_10035680 3300028800 Bacteria 4772
133 Ga0265338_10449739 3300028800 Bacteria 912
134 Ga0307511_10191690 3300030521 Bacteria 1079
135 Ga0307511_10195516 3300030521 Bacteria 1060
136 Ga0265330_10000363 3300031235 Bacteria 32033
137 Ga0265332_10000387 3300031238 Bacteria 32115
138 Ga0265328_10001297 3300031239 Bacteria 11542
139 Ga0265320_10000162 3300031240 Bacteria 55761
140 Ga0265325_10013755 3300031241 Bacteria 4596
141 Ga0265329_10000074 3300031242 Bacteria 44879
142 Ga0265340_10000707 3300031247 Bacteria 18854
143 Ga0265339_10024024 3300031249 Bacteria 3517
144 Ga0265331_10000320 3300031250 Bacteria 52244
145 Ga0265331_10046671 3300031250 Bacteria 2087
146 Ga0265327_10002306 3300031251 Bacteria 20397
147 Ga0265316_10000339 3300031344 Bacteria 52555
148 Ga0307513_10000276 3300031456 Bacteria 74546
149 Ga0265313_10000108 3300031595 Bacteria 83518
150 Ga0265314_10000117 3300031711 Bacteria 122918
151 Ga0265314_10008946 3300031711 Bacteria 8528
152 Ga0265342_10000209 3300031712 Bacteria 66041
153 Ga0307411_10076838 3300032005 Bacteria 2284
154 Ga0373943_0346313 3300035170 Bacteria 851
155 Ga0373935_0387498 3300035692 Bacteria 1002
156 Ga0373927_0001781 3300035695 Bacteria 16070
157 Ga0373937_0671957 3300036401 Bacteria 982
158 Ga0373925_0000050 3300037068 Bacteria 127678
159 Ga0395905_0129253 3300037471 Bacteria 2376
160 Ga0395905_0264370 3300037471 Bacteria 1606
161 Ga0436364_1362946 3300037853 Bacteria 2398
162 Ga0436365_1336552 3300039437 Bacteria 2084
163 Ga0436360_0373395 3300039438 Bacteria 3451
164 Ga0439439_0059360 3300041406 Bacteria 1013
165 Ga0439431_0065209 3300041997 Bacteria 963
166 Ga0450898_050671 3300042134 Bacteria 802
167 Ga0439434_0005743 3300042435 Bacteria 3621
168 Ga0453684_0195211 3300044712 Bacteria 2365
169 Ga0495638_0062624 3300046460 Bacteria 2296
170 Ga0495638_0088811 3300046460 Bacteria 1865
171 Ga0495606_0181105 3300046507 Bacteria 1215
172 Ga0495648_0128189 3300046524 Bacteria 1353
173 Ga0495642_0197771 3300046528 Bacteria 876
174 Ga0495668_0055426 3300046616 Bacteria 2189
175 Ga0495669_0006312 3300046684 Bacteria 4950
176 Ga0495672_0056948 3300047320 Bacteria 2272
177 Ga0496102_0095932 3300048905 Bacteria 2749
178 Ga0496106_0198891 3300048909 Bacteria 1595
179 Ga0496106_0468975 3300048909 Bacteria 1011
180 Ga0496107_0000888 3300048910 Bacteria 17610
181 Ga0496107_0073974 3300048910 Bacteria 2479
182 Ga0496107_0271895 3300048910 Bacteria 1261
183 Ga0496115_0060022 3300048918 Bacteria 3064
184 Ga0496115_0696056 3300048918 Bacteria 799
185 Ga0496121_0044508 3300048924 Bacteria 3827
186 Ga0496125_0108311 3300048928 Bacteria 2021
187 Ga0501033_0007090 3300049570 Bacteria 8750
188 Ga0501034_0007468 3300049571 Bacteria 11633
189 Ga0501037_0006001 3300049573 Bacteria 8871
190 Ga0501037_0043103 3300049573 Bacteria 3316
191 Ga0501038_0074678 3300049574 Bacteria 2868
192 Ga0501039_0332870 3300049575 Bacteria 1193
193 Ga0501043_0004427 3300049579 Bacteria 11410
194 Ga0501046_0346932 3300049580 Bacteria 1078
195 Ga0501047_0004491 3300049581 Bacteria 13126
196 Ga0501067_0073662 3300049583 Bacteria 1892
197 Ga0501073_0011483 3300049589 Bacteria 6477
198 Ga0501074_0118376 3300049590 Bacteria 1895
199 Ga0501257_005067 3300049686 Bacteria 2892
200 Ga0501080_0006312 3300049742 Bacteria 10637
201 Ga0501035_0192759 3300049822 Bacteria 1751
202 Ga0501035_0495547 3300049822 Bacteria 1006
203 Ga0501035_0636219 3300049822 Bacteria 866
204 Ga0501044_0006738 3300049823 Bacteria 12663
205 Ga0501044_0025511 3300049823 Bacteria 6266
206 Ga0501044_0073632 3300049823 Bacteria 3471
207 nmdc:mga03683_114989_c1 3300050489 Bacteria 1193
208 nmdc:mga07m45_37524_c1 3300050496 Bacteria 2702
209 Ga0500643_007233 3300053087 Bacteria 4518
210 Ga0500643_018718 3300053087 Bacteria 2292
211 Ga0500643_026299 3300053087 Bacteria 1823
212 Ga0500643_026379 3300053087 Bacteria 1820
213 Ga0500641_0010827 3300053096 Bacteria 3304
214 Ga0500641_0052058 3300053096 Bacteria 1686
215 Ga0500556_0001292 3300053104 Bacteria 11313
216 Ga0500562_000336 3300053108 Bacteria 11294
217 Ga0500562_001232 3300053108 Bacteria 6306
218 Ga0500562_002413 3300053108 Bacteria 4692
219 Ga0500572_001911 3300053111 Bacteria 5228
220 Ga0500595_013797 3300053119 Bacteria 3087
221 Ga0500608_110542 3300053122 Bacteria 1261
222 Ga0500559_0000010 3300053136 Bacteria 165569
223 Ga0500645_005104 3300053730 Bacteria 4897
224 Ga0500645_005839 3300053730 Bacteria 4472
225 2643747085 2643221545 Bacteria 5083237
226 2643999032 2643221598 Bacteria 4578346
227 2644086325 2643221614 Bacteria 4260023
228 2644344823 2643221661 Bacteria 4267604
229 2644367566 2643221666 Bacteria 4265935
230 2644507716 2643221691 Bacteria 5093099
231 Ga0495686_0005418
232 Ga0055530_10000008
233 Ga0055531_10026689
234 Ga0055531_10068306
235 Ga0055543_1018176
236 Ga0065165_1000222
237 Ga0065165_1023015
238 Ga0065165_1041537
239 Ga0065165_1058743
240 Ga0070658_10126601
241 Ga0068869_100313605
242 Ga0070691_10002541
243 Ga0070668_100000191
244 Ga0070668_100008796
245 Ga0070669_100399497
246 Ga0070671_100006880
247 Ga0070659_100075802
248 Ga0070667_100000078
249 Ga0070667_100017048
250 Ga0070681_10104927
251 Ga0068853_100222160
252 Ga0070665_100000584
253 Ga0070665_100002379
254 Ga0070665_100565055
255 Ga0068859_100000305
256 Ga0068859_100026607
257 Ga0068859_100092887
258 Ga0068859_100267302
259 Ga0068864_100000052
260 Ga0068864_100006213
261 Ga0068861_100049244
262 Ga0068863_100000207
263 Ga0068863_100006994
264 Ga0068858_100000511
265 Ga0068858_100001420
266 Ga0068860_100000292
267 Ga0068860_100000651
268 Ga0068860_100010095
269 Ga0068860_100103601
270 Ga0068860_100335060
271 Ga0068862_100003472
272 Ga0068862_100012650
273 Ga0068862_100016012
274 Ga0068862_100031757
275 Ga0081539_10013073
276 Ga0075363_100094132
277 Ga0075367_10413109
278 Ga0097620_100000305
279 Ga0097620_100026607
280 Ga0097620_100092887
281 Ga0097620_100267270
282 Ga0105240_10019041
283 Ga0105240_10215687
284 Ga0105241_10482493
285 Ga0105248_10085777
286 Ga0105248_10194252
287 Ga0105237_10895722
288 Ga0105238_10031235
289 Ga0105249_10000306
290 Ga0157373_10001308
291 Ga0157373_10045958
292 Ga0157373_10424778
293 Ga0163162_11033999
294 Ga0163163_10017315
295 Ga0163163_10032382
296 Ga0157379_10000663
297 Ga0157379_10023651
298 Ga0213876_10065299
299 Ga0209026_1000525
300 Ga0209758_1000215
301 Ga0209050_1000049
302 Ga0209257_1000924
303 Ga0209257_1002694
304 Ga0207710_10335668
305 Ga0207680_10323424
306 Ga0207705_10001004
307 Ga0207707_10027542
308 Ga0207695_10001725
309 Ga0207695_10043701
310 Ga0207695_10138316
311 Ga0207660_10072258
312 Ga0207657_10047908
313 Ga0207681_10118675
314 Ga0207694_10025402
315 Ga0207694_10425647
316 Ga0207650_10000014
317 Ga0207650_10096424
318 Ga0207650_10192087
319 Ga0207644_10039397
320 Ga0207644_10168962
321 Ga0207690_10000407
322 Ga0207690_10059444
323 Ga0207690_10089891
324 Ga0207711_10002889
325 Ga0207711_10112223
326 Ga0207661_10928393
327 Ga0207667_10037670
328 Ga0207667_10423553
329 Ga0207712_10000441
330 Ga0207668_10000073
331 Ga0207668_10013876
332 Ga0207668_10083848
333 Ga0207668_10596849
334 Ga0207658_10000485
335 Ga0207658_10013714
336 Ga0207677_10170419
337 Ga0207703_10014046
338 Ga0207641_10000976
339 Ga0207641_10001099
340 Ga0207641_10109339
341 Ga0207676_10000069
342 Ga0207676_10141832
343 Ga0207675_100047205
344 Ga0207675_100283610
345 Ga0268266_10000003
346 Ga0268266_10003212
347 Ga0268266_10257222
348 Ga0268265_10001070
349 Ga0268265_10001825
350 Ga0268265_10052451
351 Ga0268265_10069669
352 Ga0268265_10455941
353 Ga0268264_10000055
354 Ga0268264_10000199
355 Ga0268264_10017051
356 Ga0268264_10069773
357 Ga0265337_1018131
358 Ga0265319_1000250
359 Ga0265318_10000040
360 Ga0307517_10000710
361 Ga0307517_10309923
362 Ga0265338_10035680
363 Ga0265338_10449739
364 Ga0307511_10191690
365 Ga0307511_10195516
366 Ga0265330_10000363
367 Ga0265332_10000387
368 Ga0265328_10001297
369 Ga0265320_10000162
370 Ga0265325_10013755
371 Ga0265329_10000074
372 Ga0265340_10000707
373 Ga0265339_10024024
374 Ga0265331_10000320
375 Ga0265331_10046671
376 Ga0265327_10002306
377 Ga0265316_10000339
378 Ga0307513_10000276
379 Ga0265313_10000108
380 Ga0265314_10000117
381 Ga0265314_10008946
382 Ga0265342_10000209
383 Ga0307411_10076838
384 Ga0373943_0346313
385 Ga0373935_0387498
386 Ga0373927_0001781
387 Ga0373937_0671957
388 Ga0373925_0000050
389 Ga0395905_0129253
390 Ga0395905_0264370
391 Ga0436364_1362946
392 Ga0436365_1336552
393 Ga0436360_0373395
394 Ga0439439_0059360
395 Ga0439431_0065209
396 Ga0450898_050671
397 Ga0439434_0005743
398 Ga0453684_0195211
399 Ga0495638_0062624
400 Ga0495638_0088811
401 Ga0495606_0181105
402 Ga0495648_0128189
403 Ga0495642_0197771
404 Ga0495668_0055426
405 Ga0495669_0006312
406 Ga0495672_0056948
407 Ga0496102_0095932
408 Ga0496106_0198891
409 Ga0496106_0468975
410 Ga0496107_0000888
411 Ga0496107_0073974
412 Ga0496107_0271895
413 Ga0496115_0060022
414 Ga0496115_0696056
415 Ga0496121_0044508
416 Ga0496125_0108311
417 Ga0501033_0007090
418 Ga0501034_0007468
419 Ga0501037_0006001
420 Ga0501037_0043103
421 Ga0501038_0074678
422 Ga0501039_0332870
423 Ga0501043_0004427
424 Ga0501046_0346932
425 Ga0501047_0004491
426 Ga0501067_0073662
427 Ga0501073_0011483
428 Ga0501074_0118376
429 Ga0501257_005067
430 Ga0501080_0006312
431 Ga0501035_0192759
432 Ga0501035_0495547
433 Ga0501035_0636219
434 Ga0501044_0006738
435 Ga0501044_0025511
436 Ga0501044_0073632
437 nmdc:mga03683_114989_c1
438 nmdc:mga07m45_37524_c1
439 Ga0500643_007233
440 Ga0500643_018718
441 Ga0500643_026299
442 Ga0500643_026379
443 Ga0500641_0010827
444 Ga0500641_0052058
445 Ga0500556_0001292
446 Ga0500562_000336
447 Ga0500562_001232
448 Ga0500562_002413
449 Ga0500572_001911
450 Ga0500595_013797
451 Ga0500608_110542
452 Ga0500559_0000010
453 Ga0500645_005104
454 Ga0500645_005839
455 2643747085
456 2643999032
457 2644086325
458 2644344823
459 2644367566
460 2644507716

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13759

2OG-FeII_Oxy_5

Putative 2OG-Fe(II) oxygenase

131

231

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bvc-assembly1.cif.gz_A crystal structure of uncharacterized protein ism_01780 from roseovarius nubinhibens ism 0.9451 6 206
3bvc-assembly1.cif.gz_A crystal structure of uncharacterized protein ism_01780 from roseovarius nubinhibens ism 0.9271 6 206
2rg4-assembly1.cif.gz_A crystal structure of the uncharacterized protein q2cbj1_9rhob from oceanicola granulosus htcc2516 0.9042 1 205
3dkq-assembly1.cif.gz_B-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.8522 99 202
6n1f-assembly5.cif.gz_B crystal structure of oxidoreductase, 2og-fe(ii) oxygenase family, from burkholderia pseudomallei 0.8373 97 206
ID Description Score Start End Superfamily
2rg4B01 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.9298 12 205 2.60.120.620
2rg4B01 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.9205 12 205 2.60.120.620
af_A0A1D6QI94_1_177_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.843 98 206 2.60.120.10
1e5sA01 Mainly Beta;Sandwich;Jelly Rolls;B-lactam Antibiotic, Isopenicillin N Synthase; Chain 0.8268 100 204 2.60.120.330
af_F1LVA4_66_267_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8223 102 205 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7Y7DRK8-F1-model_v4 deleted 0.9963 106 206
AF-A0A4Q3DL76-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9908 74 203
AF-A0A7Y7DRK8-F1-model_v4 deleted 0.9866 106 206
AF-A0A1Y5H7F6-F1-model_v4 2OG-Fe(II) oxygenase 0.9815 39 206
AF-A0A4Q5T8P3-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9795 57 203

Map