F343305

General Info

Members Datasets Scaffolds Average Seq Length
230 114 460 312

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0209836|Ga0466967_0209836_771_1775
Length 334
Sequence VVGDDHEEAGMARDIDEQLTKYLADAHSIEVQALAQLKKAPDLAGAPALAEAFRAHLEETEGHERLTRELLERRDAQPSKVKDVVMGVGGKGFLLFARIQPDTPGKVFAHALSYEGLEYASYELLRRVAERAGEDDVVETARRIAGEERAMMETLEAHVDAAVNAALEAHPRDELETLLKKYLADAHAIEEQAIALLERAPKLVEDKGLETTFDDHLSETREHAELIQTRLTALGGDASSFKDAAMRLGALNWGAFFQGHPDTPGKLVAFAYAFEHLENGGYEQLKRVASAAGDEETVRVVETILGEERHAAEQLAGAFDIGAAEALRAVGVSA

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
50 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
51 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
52 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
55 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
56 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
57 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
58 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
59 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
62 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
63 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
64 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
70 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
71 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
72 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
73 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
74 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
75 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
76 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
77 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
78 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
79 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
80 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
81 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
82 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
83 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
84 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
111 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
112 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
114 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.91
Metatranscriptomes 6.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 16.96
Rhizosphere 81.3
Stem 0
Stem Tuber 0
Unclassified 6.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0209836 3300045976 Bacteria 1847
2 Ga0070683_100019603 3300005329 Bacteria 6009
3 Ga0070683_100114780 3300005329 Bacteria 2542
4 Ga0070683_100298712 3300005329 Bacteria 1532
5 Ga0070680_100174735 3300005336 Bacteria 1808
6 Ga0070680_100200050 3300005336 Unclassified 1685
7 Ga0070692_10026273 3300005345 Bacteria 2876
8 Ga0070671_100032246 3300005355 Bacteria 4332
9 Ga0070659_100156561 3300005366 Bacteria 1861
10 Ga0070713_100013779 3300005436 Bacteria 5981
11 Ga0070713_100042333 3300005436 Bacteria 3717
12 Ga0070678_100533058 3300005456 Bacteria 1040
13 Ga0070681_10036395 3300005458 Bacteria 4943
14 Ga0070679_100087022 3300005530 Bacteria 3111
15 Ga0070679_100336597 3300005530 Unclassified 1457
16 Ga0070684_100008357 3300005535 Bacteria 8085
17 Ga0070684_100158670 3300005535 Bacteria 2051
18 Ga0068853_100270139 3300005539 Bacteria 1566
19 Ga0070695_100244923 3300005545 Bacteria 1302
20 Ga0070664_100054328 3300005564 Bacteria 3398
21 Ga0068856_100011064 3300005614 Bacteria 8760
22 Ga0068856_100037705 3300005614 Bacteria 4743
23 Ga0068856_100051445 3300005614 Bacteria 4061
24 Ga0081455_10006328 3300005937 Bacteria 12713
25 Ga0081539_10002283 3300005985 Bacteria 27787
26 Ga0081539_10007013 3300005985 Bacteria 10452
27 Ga0081539_10019270 3300005985 Bacteria 4680
28 Ga0075433_10003895 3300006852 Bacteria 11553
29 Ga0075434_100004444 3300006871 Bacteria 12640
30 Ga0075434_100035492 3300006871 Bacteria 4929
31 Ga0105240_10027208 3300009093 Bacteria 7491
32 Ga0105240_10080295 3300009093 Bacteria 4011
33 Ga0105245_10012284 3300009098 Bacteria 7451
34 Ga0114129_10006452 3300009147 Bacteria 16632
35 Ga0105237_10179151 3300009545 Bacteria 2120
36 Ga0105238_10159164 3300009551 Bacteria 2234
37 Ga0105239_10238265 3300010375 Bacteria 2042
38 Ga0157369_10013706 3300013105 Bacteria 9166
39 Ga0157369_10357084 3300013105 Bacteria 1517
40 Ga0157369_10644483 3300013105 Bacteria 1093
41 Ga0157374_10013583 3300013296 Bacteria 7112
42 Ga0157374_10127037 3300013296 Bacteria 2465
43 Ga0157372_10033480 3300013307 Bacteria 5645
44 Ga0157372_10092978 3300013307 Bacteria 3431
45 Ga0182008_10046242 3300014497 Bacteria 2163
46 Ga0157376_10326238 3300014969 Bacteria 1461
47 Ga0206356_11015889 3300020070 Bacteria 1386
48 Ga0206356_11160260 3300020070 Bacteria 2040
49 Ga0206356_11346834 3300020070 Bacteria 1182
50 Ga0206356_11574025 3300020070 Bacteria 4455
51 Ga0206350_11517994 3300020080 Bacteria 1486
52 Ga0206354_10033240 3300020081 Unclassified 1600
53 Ga0206354_11278801 3300020081 Bacteria 2897
54 Ga0206354_11590100 3300020081 Bacteria 2512
55 Ga0206353_11396466 3300020082 Bacteria 9336
56 Ga0206353_11471437 3300020082 Bacteria 1615
57 Ga0206353_11888787 3300020082 Bacteria 2992
58 Ga0213876_10096809 3300021384 Bacteria 1563
59 Ga0224712_10014741 3300022467 Bacteria 2525
60 Ga0224712_10024763 3300022467 Unclassified 2101
61 Ga0224712_10139715 3300022467 Bacteria 1065
62 Ga0207654_10146086 3300025911 Bacteria 1513
63 Ga0207707_10021020 3300025912 Bacteria 5700
64 Ga0207707_10031286 3300025912 Bacteria 4656
65 Ga0207707_10071928 3300025912 Bacteria 3014
66 Ga0207695_10067242 3300025913 Bacteria 3677
67 Ga0207660_10120622 3300025917 Bacteria 1986
68 Ga0207657_10411115 3300025919 Bacteria 1064
69 Ga0207652_10091518 3300025921 Bacteria 2675
70 Ga0207687_10004782 3300025927 Bacteria 9011
71 Ga0207711_10312886 3300025941 Bacteria 1450
72 Ga0207661_10021654 3300025944 Bacteria 4820
73 Ga0207661_10368481 3300025944 Bacteria 1298
74 Ga0207702_10020367 3300026078 Bacteria 5495
75 Ga0207702_10272425 3300026078 Bacteria 1597
76 Ga0307405_10017255 3300031731 Bacteria 3957
77 Ga0307409_100203807 3300031995 Bacteria 1772
78 Ga0307409_100420654 3300031995 Bacteria 1282
79 Ga0395899_0063708 3300037312 Bacteria 2711
80 Ga0395900_0010201 3300037418 Bacteria 9607
81 Ga0395900_0200904 3300037418 Bacteria 2017
82 Ga0395900_0212982 3300037418 Unclassified 1950
83 Ga0395900_0297923 3300037418 Bacteria 1600
84 Ga0395898_0023647 3300037466 Bacteria 6205
85 Ga0395898_0044681 3300037466 Unclassified 4358
86 Ga0395898_0299534 3300037466 Bacteria 1534
87 Ga0395905_0026764 3300037471 Bacteria 5438
88 Ga0395905_0364724 3300037471 Bacteria 1337
89 Ga0395901_0044973 3300038443 Bacteria 4581
90 Ga0395901_0169764 3300038443 Bacteria 2289
91 Ga0395901_0246109 3300038443 Bacteria 1864
92 Ga0395901_0378688 3300038443 Bacteria 1457
93 Ga0395901_0435989 3300038443 Bacteria 1342
94 Ga0436365_1884607 3300039437 Bacteria 6213
95 Ga0436363_0415644 3300039450 Bacteria 8278
96 Ga0436363_0561678 3300039450 Bacteria 3270
97 Ga0436362_0286859 3300039453 Bacteria 1323
98 Ga0439460_0007169 3300042461 Bacteria 2781
99 Ga0466969_0157895 3300044656 Bacteria 1043
100 Ga0466966_0020918 3300044684 Bacteria 4302
101 Ga0466966_0021456 3300044684 Bacteria 4241
102 Ga0466961_0033143 3300044693 Unclassified 3319
103 Ga0466963_0001493 3300044694 Bacteria 12641
104 Ga0466963_0002407 3300044694 Bacteria 10466
105 Ga0466963_0005507 3300044694 Bacteria 7410
106 Ga0466963_0007225 3300044694 Bacteria 6622
107 Ga0466963_0012278 3300044694 Bacteria 5238
108 Ga0466963_0017762 3300044694 Bacteria 4437
109 Ga0466963_0018487 3300044694 Bacteria 4359
110 Ga0466963_0028633 3300044694 Unclassified 3579
111 Ga0466963_0071676 3300044694 Bacteria 2333
112 Ga0466963_0127001 3300044694 Bacteria 1758
113 Ga0466964_0002755 3300044706 Bacteria 6307
114 Ga0466964_0035410 3300044706 Bacteria 1996
115 Ga0466964_0158761 3300044706 Bacteria 1055
116 Ga0466971_0013556 3300044719 Bacteria 3582
117 Ga0466971_0034230 3300044719 Bacteria 2277
118 Ga0466968_0045862 3300044735 Unclassified 1856
119 Ga0466968_0117835 3300044735 Unclassified 1199
120 Ga0466968_0137867 3300044735 Unclassified 1114
121 Ga0466957_0006448 3300044842 Bacteria 6626
122 Ga0466957_0025556 3300044842 Bacteria 3501
123 Ga0466957_0068283 3300044842 Bacteria 2194
124 Ga0466960_0071548 3300044901 Bacteria 1727
125 Ga0466959_0058574 3300045049 Bacteria 2805
126 Ga0466958_0003447 3300045836 Bacteria 8206
127 Ga0466958_0069495 3300045836 Bacteria 2153
128 Ga0466958_0088793 3300045836 Bacteria 1910
129 Ga0466958_0203148 3300045836 Bacteria 1261
130 Ga0466958_0301714 3300045836 Unclassified 1028
131 Ga0466967_0000221 3300045976 Bacteria 24435
132 Ga0466967_0001522 3300045976 Bacteria 13555
133 Ga0466967_0003634 3300045976 Bacteria 10136
134 Ga0466967_0008403 3300045976 Bacteria 7558
135 Ga0466967_0009948 3300045976 Bacteria 7101
136 Ga0466967_0022448 3300045976 Bacteria 5150
137 Ga0466967_0028696 3300045976 Bacteria 4649
138 Ga0466967_0040909 3300045976 Unclassified 3993
139 Ga0466967_0042979 3300045976 Bacteria 3910
140 Ga0466967_0088749 3300045976 Bacteria 2806
141 Ga0466967_0142312 3300045976 Bacteria 2235
142 Ga0466967_0142326 3300045976 Bacteria 2235
143 Ga0466967_0207336 3300045976 Bacteria 1858
144 Ga0466967_0212666 3300045976 Bacteria 1834
145 Ga0495586_0185762 3300046535 Bacteria 1177
146 Ga0496100_0043083 3300048903 Bacteria 2885
147 Ga0496100_0198400 3300048903 Bacteria 1461
148 Ga0496100_0318669 3300048903 Bacteria 1167
149 Ga0496101_0004528 3300048904 Bacteria 8775
150 Ga0496101_0014756 3300048904 Bacteria 5256
151 Ga0496101_0016892 3300048904 Bacteria 4940
152 Ga0496102_0025986 3300048905 Bacteria 5218
153 Ga0496102_0184358 3300048905 Bacteria 1967
154 Ga0496104_0007084 3300048907 Bacteria 9888
155 Ga0496104_0020713 3300048907 Bacteria 6030
156 Ga0496104_0039579 3300048907 Bacteria 4414
157 Ga0496105_0001458 3300048908 Bacteria 16664
158 Ga0496105_0002226 3300048908 Bacteria 14052
159 Ga0496106_0044363 3300048909 Bacteria 3337
160 Ga0496107_0024705 3300048910 Bacteria 4251
161 Ga0496107_0025584 3300048910 Bacteria 4179
162 Ga0496108_0009025 3300048911 Bacteria 8079
163 Ga0496108_0009823 3300048911 Bacteria 7754
164 Ga0496108_0021074 3300048911 Bacteria 5355
165 Ga0496109_0001541 3300048912 Bacteria 19158
166 Ga0496109_0008339 3300048912 Bacteria 8801
167 Ga0496109_0264729 3300048912 Bacteria 1620
168 Ga0496109_0325256 3300048912 Unclassified 1451
169 Ga0496109_0588507 3300048912 Bacteria 1048
170 Ga0496110_0001589 3300048913 Bacteria 16599
171 Ga0496110_0022683 3300048913 Bacteria 5334
172 Ga0496110_0368961 3300048913 Bacteria 1308
173 Ga0496111_0001995 3300048914 Bacteria 12140
174 Ga0496112_0001883 3300048915 Bacteria 16533
175 Ga0496112_0228744 3300048915 Bacteria 1814
176 Ga0496114_0033600 3300048917 Bacteria 4227
177 Ga0496114_0082311 3300048917 Bacteria 2720
178 Ga0496114_0084078 3300048917 Bacteria 2694
179 Ga0496114_0087150 3300048917 Bacteria 2647
180 Ga0496114_0464183 3300048917 Unclassified 1121
181 Ga0496115_0004198 3300048918 Bacteria 10418
182 Ga0496115_0041554 3300048918 Bacteria 3660
183 Ga0496115_0150296 3300048918 Bacteria 1923
184 Ga0496115_0207358 3300048918 Bacteria 1619
185 Ga0501031_0107030 3300049568 Bacteria 1825
186 Ga0501032_0007787 3300049569 Bacteria 7813
187 Ga0501033_0025334 3300049570 Bacteria 4467
188 Ga0501034_0107495 3300049571 Bacteria 2782
189 Ga0501034_0141484 3300049571 Bacteria 2385
190 Ga0501034_0240726 3300049571 Unclassified 1755
191 Ga0501036_0082719 3300049572 Bacteria 2713
192 Ga0501037_0042476 3300049573 Bacteria 3340
193 Ga0501038_0039211 3300049574 Bacteria 4144
194 Ga0501039_0038947 3300049575 Bacteria 3671
195 Ga0501042_0091369 3300049578 Bacteria 2185
196 Ga0501046_0005873 3300049580 Bacteria 10943
197 Ga0501046_0196876 3300049580 Bacteria 1501
198 Ga0501047_0050585 3300049581 Bacteria 4013
199 Ga0501047_0233486 3300049581 Bacteria 1692
200 Ga0501047_0392845 3300049581 Bacteria 1220
201 Ga0501047_0463933 3300049581 Bacteria 1095
202 Ga0501048_0036522 3300049582 Bacteria 3531
203 Ga0501067_0003835 3300049583 Bacteria 8299
204 Ga0501067_0004338 3300049583 Bacteria 7808
205 Ga0501067_0034542 3300049583 Bacteria 2806
206 Ga0501068_0019401 3300049584 Bacteria 3948
207 Ga0501068_0062088 3300049584 Bacteria 2271
208 Ga0501069_0003400 3300049585 Bacteria 8170
209 Ga0501069_0012702 3300049585 Bacteria 4482
210 Ga0501069_0033748 3300049585 Bacteria 2819
211 Ga0501069_0043071 3300049585 Bacteria 2498
212 Ga0501069_0090845 3300049585 Bacteria 1727
213 Ga0501070_0001441 3300049586 Bacteria 21251
214 Ga0501071_0038522 3300049587 Bacteria 3416
215 Ga0501073_0042967 3300049589 Bacteria 3188
216 Ga0501074_0097926 3300049590 Bacteria 2099
217 Ga0501079_0028023 3300049741 Bacteria 4321
218 Ga0501080_0025225 3300049742 Bacteria 5517
219 Ga0501080_0357881 3300049742 Bacteria 1317
220 Ga0501083_0012565 3300049744 Bacteria 5923
221 Ga0501035_0073767 3300049822 Bacteria 3019
222 Ga0501044_0095079 3300049823 Bacteria 3003
223 Ga0501045_0128418 3300049824 Bacteria 1884
224 nmdc:mga05p37_12936_c1 3300050507 Bacteria 9982
225 nmdc:mga0n895_2400_c1 3300050512 Bacteria 14603
226 nmdc:mga0rr50_30379_c1 3300050513 Bacteria 3825
227 nmdc:mga0a205_5235_c1 3300050515 Bacteria 11671
228 Ga0501082_0044171 3300060353 Bacteria 3844
229 Ga0501082_0198560 3300060353 Bacteria 1745
230 Ga0466962_0021773 3300061719 Bacteria 3078
231 Ga0466967_0209836
232 Ga0070683_100019603
233 Ga0070683_100114780
234 Ga0070683_100298712
235 Ga0070680_100174735
236 Ga0070680_100200050
237 Ga0070692_10026273
238 Ga0070671_100032246
239 Ga0070659_100156561
240 Ga0070713_100013779
241 Ga0070713_100042333
242 Ga0070678_100533058
243 Ga0070681_10036395
244 Ga0070679_100087022
245 Ga0070679_100336597
246 Ga0070684_100008357
247 Ga0070684_100158670
248 Ga0068853_100270139
249 Ga0070695_100244923
250 Ga0070664_100054328
251 Ga0068856_100011064
252 Ga0068856_100037705
253 Ga0068856_100051445
254 Ga0081455_10006328
255 Ga0081539_10002283
256 Ga0081539_10007013
257 Ga0081539_10019270
258 Ga0075433_10003895
259 Ga0075434_100004444
260 Ga0075434_100035492
261 Ga0105240_10027208
262 Ga0105240_10080295
263 Ga0105245_10012284
264 Ga0114129_10006452
265 Ga0105237_10179151
266 Ga0105238_10159164
267 Ga0105239_10238265
268 Ga0157369_10013706
269 Ga0157369_10357084
270 Ga0157369_10644483
271 Ga0157374_10013583
272 Ga0157374_10127037
273 Ga0157372_10033480
274 Ga0157372_10092978
275 Ga0182008_10046242
276 Ga0157376_10326238
277 Ga0206356_11015889
278 Ga0206356_11160260
279 Ga0206356_11346834
280 Ga0206356_11574025
281 Ga0206350_11517994
282 Ga0206354_10033240
283 Ga0206354_11278801
284 Ga0206354_11590100
285 Ga0206353_11396466
286 Ga0206353_11471437
287 Ga0206353_11888787
288 Ga0213876_10096809
289 Ga0224712_10014741
290 Ga0224712_10024763
291 Ga0224712_10139715
292 Ga0207654_10146086
293 Ga0207707_10021020
294 Ga0207707_10031286
295 Ga0207707_10071928
296 Ga0207695_10067242
297 Ga0207660_10120622
298 Ga0207657_10411115
299 Ga0207652_10091518
300 Ga0207687_10004782
301 Ga0207711_10312886
302 Ga0207661_10021654
303 Ga0207661_10368481
304 Ga0207702_10020367
305 Ga0207702_10272425
306 Ga0307405_10017255
307 Ga0307409_100203807
308 Ga0307409_100420654
309 Ga0395899_0063708
310 Ga0395900_0010201
311 Ga0395900_0200904
312 Ga0395900_0212982
313 Ga0395900_0297923
314 Ga0395898_0023647
315 Ga0395898_0044681
316 Ga0395898_0299534
317 Ga0395905_0026764
318 Ga0395905_0364724
319 Ga0395901_0044973
320 Ga0395901_0169764
321 Ga0395901_0246109
322 Ga0395901_0378688
323 Ga0395901_0435989
324 Ga0436365_1884607
325 Ga0436363_0415644
326 Ga0436363_0561678
327 Ga0436362_0286859
328 Ga0439460_0007169
329 Ga0466969_0157895
330 Ga0466966_0020918
331 Ga0466966_0021456
332 Ga0466961_0033143
333 Ga0466963_0001493
334 Ga0466963_0002407
335 Ga0466963_0005507
336 Ga0466963_0007225
337 Ga0466963_0012278
338 Ga0466963_0017762
339 Ga0466963_0018487
340 Ga0466963_0028633
341 Ga0466963_0071676
342 Ga0466963_0127001
343 Ga0466964_0002755
344 Ga0466964_0035410
345 Ga0466964_0158761
346 Ga0466971_0013556
347 Ga0466971_0034230
348 Ga0466968_0045862
349 Ga0466968_0117835
350 Ga0466968_0137867
351 Ga0466957_0006448
352 Ga0466957_0025556
353 Ga0466957_0068283
354 Ga0466960_0071548
355 Ga0466959_0058574
356 Ga0466958_0003447
357 Ga0466958_0069495
358 Ga0466958_0088793
359 Ga0466958_0203148
360 Ga0466958_0301714
361 Ga0466967_0000221
362 Ga0466967_0001522
363 Ga0466967_0003634
364 Ga0466967_0008403
365 Ga0466967_0009948
366 Ga0466967_0022448
367 Ga0466967_0028696
368 Ga0466967_0040909
369 Ga0466967_0042979
370 Ga0466967_0088749
371 Ga0466967_0142312
372 Ga0466967_0142326
373 Ga0466967_0207336
374 Ga0466967_0212666
375 Ga0495586_0185762
376 Ga0496100_0043083
377 Ga0496100_0198400
378 Ga0496100_0318669
379 Ga0496101_0004528
380 Ga0496101_0014756
381 Ga0496101_0016892
382 Ga0496102_0025986
383 Ga0496102_0184358
384 Ga0496104_0007084
385 Ga0496104_0020713
386 Ga0496104_0039579
387 Ga0496105_0001458
388 Ga0496105_0002226
389 Ga0496106_0044363
390 Ga0496107_0024705
391 Ga0496107_0025584
392 Ga0496108_0009025
393 Ga0496108_0009823
394 Ga0496108_0021074
395 Ga0496109_0001541
396 Ga0496109_0008339
397 Ga0496109_0264729
398 Ga0496109_0325256
399 Ga0496109_0588507
400 Ga0496110_0001589
401 Ga0496110_0022683
402 Ga0496110_0368961
403 Ga0496111_0001995
404 Ga0496112_0001883
405 Ga0496112_0228744
406 Ga0496114_0033600
407 Ga0496114_0082311
408 Ga0496114_0084078
409 Ga0496114_0087150
410 Ga0496114_0464183
411 Ga0496115_0004198
412 Ga0496115_0041554
413 Ga0496115_0150296
414 Ga0496115_0207358
415 Ga0501031_0107030
416 Ga0501032_0007787
417 Ga0501033_0025334
418 Ga0501034_0107495
419 Ga0501034_0141484
420 Ga0501034_0240726
421 Ga0501036_0082719
422 Ga0501037_0042476
423 Ga0501038_0039211
424 Ga0501039_0038947
425 Ga0501042_0091369
426 Ga0501046_0005873
427 Ga0501046_0196876
428 Ga0501047_0050585
429 Ga0501047_0233486
430 Ga0501047_0392845
431 Ga0501047_0463933
432 Ga0501048_0036522
433 Ga0501067_0003835
434 Ga0501067_0004338
435 Ga0501067_0034542
436 Ga0501068_0019401
437 Ga0501068_0062088
438 Ga0501069_0003400
439 Ga0501069_0012702
440 Ga0501069_0033748
441 Ga0501069_0043071
442 Ga0501069_0090845
443 Ga0501070_0001441
444 Ga0501071_0038522
445 Ga0501073_0042967
446 Ga0501074_0097926
447 Ga0501079_0028023
448 Ga0501080_0025225
449 Ga0501080_0357881
450 Ga0501083_0012565
451 Ga0501035_0073767
452 Ga0501044_0095079
453 Ga0501045_0128418
454 nmdc:mga05p37_12936_c1
455 nmdc:mga0n895_2400_c1
456 nmdc:mga0rr50_30379_c1
457 nmdc:mga0a205_5235_c1
458 Ga0501082_0044171
459 Ga0501082_0198560
460 Ga0466962_0021773

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05974

DUF892

Domain of unknown function (DUF892)

14

168

0.95

PF05974

DUF892

Domain of unknown function (DUF892)

174

327

0.91

PF00210

Ferritin

Ferritin-like domain

202

321

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cvp-assembly1.cif.gz_A-2 structure of apobacterioferritin 0.887 151 294
3hiu-assembly1.cif.gz_B the crystal structure of protein (xcc3681) from xanthomonas campestris pv. campestris str. atcc 33913 0.875 149 306
3hiu-assembly1.cif.gz_A the crystal structure of protein (xcc3681) from xanthomonas campestris pv. campestris str. atcc 33913 0.8733 148 306
3hiu-assembly2.cif.gz_D the crystal structure of protein (xcc3681) from xanthomonas campestris pv. campestris str. atcc 33913 0.8698 148 306
3hiu-assembly1.cif.gz_A the crystal structure of protein (xcc3681) from xanthomonas campestris pv. campestris str. atcc 33913 0.8675 148 306
ID Description Score Start End Superfamily
af_P21363_1_168_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8892 148 295 1.20.1260.10
4cvpA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.887 151 294 1.20.1260.10
3gvyB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8608 152 294 1.20.1260.10
1qghA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8548 153 282 1.20.1260.10
1n1qA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8472 149 293 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A7W0U9J9-F1-model_v4 DUF892 family protein 0.9228 149 305
AF-A0A423Q669-F1-model_v4 Uncharacterized protein 0.9045 149 301
AF-A0A292Z4B5-F1-model_v4 Ferritin-like domain-containing protein (Protein yciE) 0.9041 147 305
AF-A0A1V2BH31-F1-model_v4 deleted 0.9032 149 295
AF-A0A6J4SAD8-F1-model_v4 Uncharacterized protein 0.9026 149 301

Map