F343295

General Info

Members Datasets Scaffolds Average Seq Length
230 140 230 219

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0172175|Ga0466957_0172175_365_1069
Length 234
Sequence VSADAERIDLNVVDSNEPAPDPGPVAPAPGAPDLEQLSAQEVVAYAVNEFAPRLTMACSFQKEESVLVHMLAQVTDTPRVFTIDTGVLFGETLTTWKAFEDRFGLKVDVMDASSPGAPWTAENCCGSAKVDALERALATDVDAWMTGIRRDQASTRAAAPKIERDERRGIWKLNPLADWSEKDVWRYIFKHDLPYHPLHDQGYASIGCAPCTLPGSGRDGRWAGQDKTECGIHE

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
41 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
87 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
88 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
100 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 5.22
Rhizosphere 93.91
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10014311 3300003203 Bacteria 3377
2 JGI25406J46586_10059428 3300003203 Bacteria 1241
3 Ga0070680_100428426 3300005336 Bacteria 1129
4 Ga0070682_100028170 3300005337 Bacteria 3377
5 Ga0070660_100002664 3300005339 Bacteria 12265
6 Ga0070660_100003783 3300005339 Bacteria 10457
7 Ga0070691_10236946 3300005341 Bacteria 973
8 Ga0070692_10082577 3300005345 Bacteria 1733
9 Ga0070674_100091174 3300005356 Bacteria 2200
10 Ga0070674_100324206 3300005356 Bacteria 1236
11 Ga0070659_100007192 3300005366 Bacteria 8077
12 Ga0070659_100185158 3300005366 Bacteria 1710
13 Ga0070701_10166839 3300005438 Bacteria 1279
14 Ga0070700_100540467 3300005441 Bacteria 903
15 Ga0070681_10011505 3300005458 Bacteria 8761
16 Ga0070681_10679774 3300005458 Bacteria 945
17 Ga0068867_100161005 3300005459 Bacteria 1770
18 Ga0070679_100136753 3300005530 Bacteria 2431
19 Ga0068853_100017704 3300005539 Bacteria 5881
20 Ga0070696_100216741 3300005546 Bacteria 1435
21 Ga0070665_100000312 3300005548 Bacteria 75711
22 Ga0068855_100093892 3300005563 Bacteria 3460
23 Ga0070664_100200709 3300005564 Bacteria 1780
24 Ga0070664_100501296 3300005564 Bacteria 1119
25 Ga0068856_100070637 3300005614 Bacteria 3454
26 Ga0068856_100545258 3300005614 Bacteria 1181
27 Ga0068852_100004550 3300005616 Bacteria 9818
28 Ga0068864_100299973 3300005618 Bacteria 1504
29 Ga0081455_10191892 3300005937 Bacteria 1537
30 Ga0081538_10001913 3300005981 Bacteria 20841
31 Ga0081538_10009321 3300005981 Bacteria 8209
32 Ga0081538_10021300 3300005981 Bacteria 4737
33 Ga0081538_10067867 3300005981 Bacteria 1987
34 Ga0081538_10107625 3300005981 Bacteria 1380
35 Ga0081538_10184496 3300005981 Bacteria 887
36 Ga0081539_10002904 3300005985 Bacteria 22668
37 Ga0081539_10009632 3300005985 Bacteria 8015
38 Ga0081539_10050056 3300005985 Bacteria 2366
39 Ga0075365_10028062 3300006038 Bacteria 3587
40 Ga0075432_10072398 3300006058 Bacteria 1240
41 Ga0075431_100320977 3300006847 Bacteria 1562
42 Ga0105240_10061134 3300009093 Bacteria 4695
43 Ga0111539_10021974 3300009094 Bacteria 7842
44 Ga0111539_10364118 3300009094 Bacteria 1683
45 Ga0111539_10407091 3300009094 Bacteria 1584
46 Ga0111539_11113095 3300009094 Unclassified 918
47 Ga0111539_11168193 3300009094 Bacteria 894
48 Ga0111539_11350712 3300009094 Bacteria 827
49 Ga0105245_10564589 3300009098 Bacteria 1161
50 Ga0114129_10066308 3300009147 Bacteria 5036
51 Ga0114129_10430876 3300009147 Bacteria 1733
52 Ga0114129_10785251 3300009147 Bacteria 1216
53 Ga0105237_10018979 3300009545 Bacteria 7106
54 Ga0105238_10034162 3300009551 Bacteria 5175
55 Ga0105239_10109203 3300010375 Bacteria 3065
56 Ga0157370_10042477 3300013104 Bacteria 4381
57 Ga0157372_10186719 3300013307 Bacteria 2400
58 Ga0157375_10675164 3300013308 Bacteria 1188
59 Ga0163163_10113706 3300014325 Bacteria 2737
60 Ga0157380_10278758 3300014326 Bacteria 1528
61 Ga0213874_10069186 3300021377 Bacteria 1122
62 Ga0207643_10106301 3300025908 Bacteria 1650
63 Ga0207705_10032701 3300025909 Bacteria 3718
64 Ga0207707_10010935 3300025912 Bacteria 7893
65 Ga0207707_10496043 3300025912 Bacteria 1042
66 Ga0207695_10075450 3300025913 Bacteria 3431
67 Ga0207671_10088016 3300025914 Bacteria 2336
68 Ga0207663_10350129 3300025916 Bacteria 1118
69 Ga0207660_10006676 3300025917 Bacteria 7479
70 Ga0207657_10012911 3300025919 Bacteria 8214
71 Ga0207657_10017080 3300025919 Bacteria 6977
72 Ga0207649_10005180 3300025920 Bacteria 7040
73 Ga0207646_10065468 3300025922 Bacteria 3245
74 Ga0207694_10046537 3300025924 Bacteria 3353
75 Ga0207687_10529821 3300025927 Bacteria 986
76 Ga0207690_10007386 3300025932 Bacteria 6525
77 Ga0207669_10144022 3300025937 Bacteria 1659
78 Ga0207661_10000257 3300025944 Bacteria 34367
79 Ga0207661_10356508 3300025944 Bacteria 1321
80 Ga0207661_10366621 3300025944 Bacteria 1302
81 Ga0207712_10333077 3300025961 Bacteria 1256
82 Ga0207677_10260856 3300026023 Bacteria 1412
83 Ga0207678_10212487 3300026067 Bacteria 1655
84 Ga0207708_10122193 3300026075 Bacteria 2029
85 Ga0207702_10042132 3300026078 Bacteria 3829
86 Ga0207702_10140545 3300026078 Bacteria 2184
87 Ga0207648_10281220 3300026089 Bacteria 1488
88 Ga0207675_100348927 3300026118 Bacteria 1450
89 Ga0207675_101217446 3300026118 Bacteria 773
90 Ga0207698_10102191 3300026142 Bacteria 2379
91 Ga0207428_10257989 3300027907 Bacteria 1299
92 Ga0207428_10413686 3300027907 Bacteria 986
93 Ga0207428_10609277 3300027907 Bacteria 786
94 Ga0268266_10013842 3300028379 Bacteria 6945
95 Ga0268265_10421173 3300028380 Bacteria 1240
96 Ga0265319_1020379 3300028563 Bacteria 2459
97 Ga0265338_10060791 3300028800 Bacteria 3315
98 Ga0265340_10040159 3300031247 Bacteria 2306
99 Ga0307408_100019186 3300031548 Bacteria 4602
100 Ga0307405_10043548 3300031731 Bacteria 2740
101 Ga0307405_10430904 3300031731 Bacteria 1040
102 Ga0307413_10045441 3300031824 Bacteria 2603
103 Ga0307413_10074880 3300031824 Bacteria 2146
104 Ga0307413_10150524 3300031824 Bacteria 1621
105 Ga0307413_10510246 3300031824 Bacteria 967
106 Ga0307410_10028533 3300031852 Bacteria 3542
107 Ga0307410_10217843 3300031852 Bacteria 1467
108 Ga0326468_10009913 3300031889 Bacteria 953
109 Ga0307406_10018824 3300031901 Bacteria 4042
110 Ga0307406_10040518 3300031901 Bacteria 2897
111 Ga0307406_10444021 3300031901 Bacteria 1039
112 Ga0307412_10043606 3300031911 Bacteria 2922
113 Ga0307412_10101283 3300031911 Bacteria 2038
114 Ga0307412_10228941 3300031911 Bacteria 1430
115 Ga0307409_100005209 3300031995 Bacteria 7443
116 Ga0307409_100011281 3300031995 Bacteria 5622
117 Ga0307409_100048169 3300031995 Bacteria 3240
118 Ga0307416_100053951 3300032002 Bacteria 3228
119 Ga0307416_100332626 3300032002 Bacteria 1527
120 Ga0307416_100998173 3300032002 Bacteria 940
121 Ga0307411_10031138 3300032005 Bacteria 3278
122 Ga0307415_100309244 3300032126 Bacteria 1313
123 Ga0373944_0069647 3300035089 Bacteria 1144
124 Ga0373935_0353393 3300035692 Bacteria 1048
125 Ga0395900_0031106 3300037418 Bacteria 5483
126 Ga0395898_0000333 3300037466 Bacteria 106932
127 Ga0395901_0352856 3300038443 Bacteria 1518
128 Ga0439448_0027003 3300042005 Bacteria 1808
129 Ga0450916_007983 3300042530 Bacteria 1280
130 Ga0466969_0018100 3300044656 Bacteria 3675
131 Ga0466969_0049433 3300044656 Bacteria 2075
132 Ga0466969_0083446 3300044656 Bacteria 1522
133 Ga0466966_0017712 3300044684 Bacteria 4704
134 Ga0466966_0252294 3300044684 Bacteria 1063
135 Ga0466966_0413051 3300044684 Bacteria 811
136 Ga0466961_0006657 3300044693 Bacteria 7349
137 Ga0466961_0022373 3300044693 Bacteria 4066
138 Ga0466961_0046026 3300044693 Bacteria 2791
139 Ga0466963_0001010 3300044694 Bacteria 14546
140 Ga0466963_0026924 3300044694 Bacteria 3678
141 Ga0466971_0016337 3300044719 Bacteria 3274
142 Ga0466971_0021280 3300044719 Bacteria 2887
143 Ga0466968_0024690 3300044735 Bacteria 2458
144 Ga0466970_0209748 3300044765 Bacteria 1085
145 Ga0466957_0026884 3300044842 Bacteria 3416
146 Ga0466957_0030540 3300044842 Bacteria 3218
147 Ga0466957_0095516 3300044842 Bacteria 1867
148 Ga0466957_0172175 3300044842 Bacteria 1411
149 Ga0466959_0005807 3300045049 Bacteria 8501
150 Ga0466959_0008093 3300045049 Bacteria 7414
151 Ga0466959_0014415 3300045049 Bacteria 5742
152 Ga0466958_0000727 3300045836 Bacteria 14397
153 Ga0466958_0008531 3300045836 Bacteria 5690
154 Ga0466958_0152018 3300045836 Bacteria 1460
155 Ga0466958_0220837 3300045836 Bacteria 1209
156 Ga0466958_0261782 3300045836 Bacteria 1107
157 Ga0466967_0049172 3300045976 Bacteria 3687
158 Ga0495620_0114469 3300046515 Bacteria 1067
159 Ga0495624_0135362 3300046690 Bacteria 1510
160 Ga0496102_0140075 3300048905 Bacteria 2268
161 Ga0496105_0488708 3300048908 Bacteria 968
162 Ga0496105_0593699 3300048908 Bacteria 860
163 Ga0496108_1065128 3300048911 Bacteria 688
164 Ga0496109_0034771 3300048912 Bacteria 4541
165 Ga0496109_0442547 3300048912 Bacteria 1228
166 Ga0496110_0171082 3300048913 Bacteria 1971
167 Ga0496111_0089550 3300048914 Bacteria 2254
168 Ga0496111_0104072 3300048914 Bacteria 2088
169 Ga0496112_0451552 3300048915 Bacteria 1223
170 Ga0496113_0026147 3300048916 Bacteria 4170
171 Ga0496115_0440880 3300048918 Bacteria 1053
172 Ga0501291_005039 3300049514 Bacteria 1710
173 Ga0501031_0143395 3300049568 Bacteria 1561
174 Ga0501031_0261565 3300049568 Bacteria 1124
175 Ga0501032_0375653 3300049569 Bacteria 914
176 Ga0501033_0338088 3300049570 Bacteria 1056
177 Ga0501036_0277197 3300049572 Bacteria 1403
178 Ga0501036_0358561 3300049572 Bacteria 1217
179 Ga0501037_0648761 3300049573 Bacteria 706
180 Ga0501038_0058641 3300049574 Bacteria 3300
181 Ga0501038_0132385 3300049574 Bacteria 2046
182 Ga0501038_0209502 3300049574 Bacteria 1560
183 Ga0501040_0040916 3300049576 Bacteria 3156
184 Ga0501040_0071261 3300049576 Bacteria 2399
185 Ga0501040_0271147 3300049576 Bacteria 1212
186 Ga0501041_0102981 3300049577 Bacteria 1768
187 Ga0501041_0165301 3300049577 Bacteria 1384
188 Ga0501041_0186684 3300049577 Bacteria 1298
189 Ga0501041_0295424 3300049577 Bacteria 1020
190 Ga0501042_0116073 3300049578 Bacteria 1927
191 Ga0501048_0058524 3300049582 Bacteria 2731
192 Ga0501048_0146488 3300049582 Bacteria 1670
193 Ga0501068_0336374 3300049584 Bacteria 969
194 Ga0501070_0362431 3300049586 Bacteria 1176
195 Ga0501071_0038465 3300049587 Bacteria 3419
196 Ga0501071_0078531 3300049587 Bacteria 2412
197 Ga0501071_0370346 3300049587 Bacteria 1092
198 Ga0501072_0014032 3300049588 Bacteria 6140
199 Ga0501072_0054541 3300049588 Bacteria 3149
200 Ga0501072_0276314 3300049588 Bacteria 1336
201 Ga0501074_0548431 3300049590 Bacteria 818
202 Ga0501075_0032473 3300049591 Bacteria 3879
203 Ga0501076_0137325 3300049592 Bacteria 1985
204 Ga0501076_0166179 3300049592 Bacteria 1798
205 Ga0501076_0414995 3300049592 Bacteria 1107
206 Ga0501079_0131473 3300049741 Bacteria 1948
207 Ga0501079_0203843 3300049741 Bacteria 1545
208 Ga0501079_0211377 3300049741 Bacteria 1515
209 Ga0501080_0097833 3300049742 Bacteria 2725
210 Ga0501081_0052467 3300049743 Bacteria 2814
211 Ga0501083_0157153 3300049744 Bacteria 1488
212 Ga0501044_0304193 3300049823 Bacteria 1523
213 Ga0501045_0466658 3300049824 Bacteria 938
214 nmdc:mga05p37_1248281_c1 3300050507 Bacteria 763
215 nmdc:mga05p37_25492_c1 3300050507 Bacteria 7192
216 nmdc:mga05p37_853472_c1 3300050507 Bacteria 988
217 nmdc:mga05p37_859083_c1 3300050507 Bacteria 984
218 nmdc:mga0qj67_508165_c1 3300050509 Bacteria 968
219 nmdc:mga08y16_1046064_c1 3300050511 Unclassified 794
220 nmdc:mga08y16_346105_c1 3300050511 Bacteria 1528
221 nmdc:mga08y16_593814_c1 3300050511 Bacteria 1117
222 nmdc:mga08y16_601100_c1 3300050511 Bacteria 1109
223 Ga0501084_0066415 3300054114 Bacteria 3018
224 Ga0501084_0098259 3300054114 Bacteria 2458
225 Ga0501084_0634727 3300054114 Bacteria 902
226 Ga0501082_0123155 3300060353 Bacteria 2248
227 Ga0501082_0155258 3300060353 Bacteria 1988
228 Ga0466962_0012146 3300061719 Bacteria 4140
229 Ga0530510_0013210 3300061734 Bacteria 5807
230 Ga0530510_0107704 3300061734 Bacteria 2040

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0171082 Ga0496110_0171082_129_722 163
2 3300044694 Ga0466963_0026924 Ga0466963_0026924_3090_3629 178
3 3300049576 Ga0501040_0271147 Ga0501040_0271147_18_611 197
4 3300005618 Ga0068864_100299973 Ga0068864_1002999732 200
5 3300014325 Ga0163163_10113706 Ga0163163_101137062 200
6 3300048911 Ga0496108_1065128 Ga0496108_1065128_44_652 200
7 3300048912 Ga0496109_0034771 Ga0496109_0034771_1403_2011 200
8 3300048914 Ga0496111_0089550 Ga0496111_0089550_1455_2063 200
9 3300048914 Ga0496111_0104072 Ga0496111_0104072_479_1087 200
10 3300048915 Ga0496112_0451552 Ga0496112_0451552_451_1059 200
11 3300048916 Ga0496113_0026147 Ga0496113_0026147_271_879 200
12 3300049577 Ga0501041_0165301 Ga0501041_0165301_714_1322 202
13 3300006038 Ga0075365_10028062 Ga0075365_100280621 203
14 3300005981 Ga0081538_10009321 Ga0081538_100093212 204
15 3300005614 Ga0068856_100545258 Ga0068856_1005452581 206
16 3300021377 Ga0213874_10069186 Ga0213874_100691862 206
17 3300026078 Ga0207702_10042132 Ga0207702_100421322 206
18 3300037418 Ga0395900_0031106 Ga0395900_0031106_2710_3333 206
19 3300037466 Ga0395898_0000333 Ga0395898_0000333_22211_22834 206
20 3300044656 Ga0466969_0049433 Ga0466969_0049433_500_1123 206
21 3300044656 Ga0466969_0083446 Ga0466969_0083446_319_945 206
22 3300044684 Ga0466966_0252294 Ga0466966_0252294_271_909 206
23 3300044684 Ga0466966_0413051 Ga0466966_0413051_135_758 206
24 3300044693 Ga0466961_0022373 Ga0466961_0022373_1404_2030 206
25 3300044693 Ga0466961_0046026 Ga0466961_0046026_94_720 206
26 3300044719 Ga0466971_0016337 Ga0466971_0016337_1562_2188 206
27 3300044719 Ga0466971_0021280 Ga0466971_0021280_1619_2242 206
28 3300044765 Ga0466970_0209748 Ga0466970_0209748_338_964 206
29 3300044842 Ga0466957_0026884 Ga0466957_0026884_1920_2546 206
30 3300044842 Ga0466957_0030540 Ga0466957_0030540_2190_2813 206
31 3300045049 Ga0466959_0008093 Ga0466959_0008093_6328_6954 206
32 3300045049 Ga0466959_0014415 Ga0466959_0014415_1388_2011 206
33 3300045836 Ga0466958_0008531 Ga0466958_0008531_3175_3801 206
34 3300045836 Ga0466958_0152018 Ga0466958_0152018_456_1082 206
35 3300045836 Ga0466958_0220837 Ga0466958_0220837_178_801 206
36 3300061719 Ga0466962_0012146 Ga0466962_0012146_1614_2240 206
37 3300044656 Ga0466969_0018100 Ga0466969_0018100_2589_3218 207
38 3300044684 Ga0466966_0017712 Ga0466966_0017712_3528_4157 207
39 3300044693 Ga0466961_0006657 Ga0466961_0006657_3589_4218 207
40 3300044694 Ga0466963_0001010 Ga0466963_0001010_8766_9395 207
41 3300044735 Ga0466968_0024690 Ga0466968_0024690_274_903 207
42 3300044842 Ga0466957_0095516 Ga0466957_0095516_28_657 207
43 3300045049 Ga0466959_0005807 Ga0466959_0005807_6393_7022 207
44 3300045836 Ga0466958_0000727 Ga0466958_0000727_10389_11018 207
45 3300048908 Ga0496105_0488708 Ga0496105_0488708_44_688 207
46 3300048918 Ga0496115_0440880 Ga0496115_0440880_267_899 207
47 3300005339 Ga0070660_100002664 Ga0070660_1000026647 209
48 3300009147 Ga0114129_10785251 Ga0114129_107852511 209
49 3300025919 Ga0207657_10017080 Ga0207657_100170805 209
50 3300050507 nmdc:mga05p37_859083_c1 nmdc:mga05p37_859083_c1_311_952 209
51 3300044842 Ga0466957_0172175 Ga0466957_0172175_365_1069 210
52 3300045836 Ga0466958_0261782 Ga0466958_0261782_11_721 210
53 3300005341 Ga0070691_10236946 Ga0070691_102369462 214
54 3300005356 Ga0070674_100324206 Ga0070674_1003242062 214
55 3300005366 Ga0070659_100185158 Ga0070659_1001851583 214
56 3300005459 Ga0068867_100161005 Ga0068867_1001610052 214
57 3300042530 Ga0450916_007983 Ga0450916_007983_41_685 214
58 3300049574 Ga0501038_0132385 Ga0501038_0132385_1353_1997 214
59 3300049741 Ga0501079_0203843 Ga0501079_0203843_726_1370 214
60 3300050509 nmdc:mga0qj67_508165_c1 nmdc:mga0qj67_508165_c1_226_870 214
61 3300025912 Ga0207707_10496043 Ga0207707_104960432 216
62 3300049587 Ga0501071_0038465 Ga0501071_0038465_84_737 216
63 3300025916 Ga0207663_10350129 Ga0207663_103501292 217
64 3300025922 Ga0207646_10065468 Ga0207646_100654684 217
65 3300028563 Ga0265319_1020379 Ga0265319_10203792 217
66 3300028800 Ga0265338_10060791 Ga0265338_100607913 217
67 3300031247 Ga0265340_10040159 Ga0265340_100401593 217
68 3300035089 Ga0373944_0069647 Ga0373944_0069647_213_869 217
69 3300035692 Ga0373935_0353393 Ga0373935_0353393_26_682 217
70 3300005356 Ga0070674_100091174 Ga0070674_1000911742 218
71 3300025937 Ga0207669_10144022 Ga0207669_101440222 218
72 3300032002 Ga0307416_100998173 Ga0307416_1009981732 218
73 3300046690 Ga0495624_0135362 Ga0495624_0135362_269_955 218
74 3300005563 Ga0068855_100093892 Ga0068855_1000938921 219
75 3300009098 Ga0105245_10564589 Ga0105245_105645892 219
76 3300013308 Ga0157375_10675164 Ga0157375_106751642 219
77 3300014326 Ga0157380_10278758 Ga0157380_102787582 219
78 3300025927 Ga0207687_10529821 Ga0207687_105298212 219
79 3300038443 Ga0395901_0352856 Ga0395901_0352856_317_976 219
80 3300048905 Ga0496102_0140075 Ga0496102_0140075_1117_1785 219
81 3300005336 Ga0070680_100428426 Ga0070680_1004284262 220
82 3300005438 Ga0070701_10166839 Ga0070701_101668392 220
83 3300005441 Ga0070700_100540467 Ga0070700_1005404672 220
84 3300005458 Ga0070681_10679774 Ga0070681_106797742 220
85 3300005546 Ga0070696_100216741 Ga0070696_1002167412 220
86 3300005937 Ga0081455_10191892 Ga0081455_101918922 220
87 3300005981 Ga0081538_10001913 Ga0081538_1000191315 220
88 3300005981 Ga0081538_10021300 Ga0081538_100213006 220
89 3300005981 Ga0081538_10067867 Ga0081538_100678673 220
90 3300005981 Ga0081538_10107625 Ga0081538_101076252 220
91 3300005981 Ga0081538_10184496 Ga0081538_101844961 220
92 3300005985 Ga0081539_10002904 Ga0081539_1000290424 220
93 3300006847 Ga0075431_100320977 Ga0075431_1003209772 220
94 3300009094 Ga0111539_10021974 Ga0111539_100219743 220
95 3300009094 Ga0111539_10364118 Ga0111539_103641182 220
96 3300009094 Ga0111539_10407091 Ga0111539_104070912 220
97 3300009094 Ga0111539_11113095 Ga0111539_111130952 220
98 3300009094 Ga0111539_11168193 Ga0111539_111681931 220
99 3300009094 Ga0111539_11350712 Ga0111539_113507121 220
100 3300009147 Ga0114129_10066308 Ga0114129_100663082 220
101 3300009147 Ga0114129_10430876 Ga0114129_104308762 220
102 3300025961 Ga0207712_10333077 Ga0207712_103330772 220
103 3300026067 Ga0207678_10212487 Ga0207678_102124872 220
104 3300026075 Ga0207708_10122193 Ga0207708_101221932 220
105 3300026118 Ga0207675_101217446 Ga0207675_1012174461 220
106 3300027907 Ga0207428_10257989 Ga0207428_102579892 220
107 3300027907 Ga0207428_10609277 Ga0207428_106092772 220
108 3300028380 Ga0268265_10421173 Ga0268265_104211732 220
109 3300031731 Ga0307405_10043548 Ga0307405_100435483 220
110 3300031824 Ga0307413_10074880 Ga0307413_100748802 220
111 3300031824 Ga0307413_10510246 Ga0307413_105102462 220
112 3300031852 Ga0307410_10217843 Ga0307410_102178431 220
113 3300031901 Ga0307406_10040518 Ga0307406_100405183 220
114 3300031901 Ga0307406_10444021 Ga0307406_104440212 220
115 3300031911 Ga0307412_10228941 Ga0307412_102289412 220
116 3300031995 Ga0307409_100011281 Ga0307409_1000112815 220
117 3300032002 Ga0307416_100053951 Ga0307416_1000539512 220
118 3300042005 Ga0439448_0027003 Ga0439448_0027003_194_856 220
119 3300049514 Ga0501291_005039 Ga0501291_005039_803_1474 220
120 3300049568 Ga0501031_0143395 Ga0501031_0143395_31_696 220
121 3300049568 Ga0501031_0261565 Ga0501031_0261565_380_1045 220
122 3300049569 Ga0501032_0375653 Ga0501032_0375653_215_880 220
123 3300049570 Ga0501033_0338088 Ga0501033_0338088_285_950 220
124 3300049572 Ga0501036_0277197 Ga0501036_0277197_714_1379 220
125 3300049572 Ga0501036_0358561 Ga0501036_0358561_116_781 220
126 3300049573 Ga0501037_0648761 Ga0501037_0648761_22_687 220
127 3300049574 Ga0501038_0058641 Ga0501038_0058641_2283_2948 220
128 3300049574 Ga0501038_0209502 Ga0501038_0209502_285_950 220
129 3300049576 Ga0501040_0040916 Ga0501040_0040916_849_1514 220
130 3300049576 Ga0501040_0071261 Ga0501040_0071261_1144_1809 220
131 3300049577 Ga0501041_0102981 Ga0501041_0102981_42_707 220
132 3300049577 Ga0501041_0186684 Ga0501041_0186684_435_1100 220
133 3300049577 Ga0501041_0295424 Ga0501041_0295424_325_990 220
134 3300049578 Ga0501042_0116073 Ga0501042_0116073_1229_1894 220
135 3300049582 Ga0501048_0058524 Ga0501048_0058524_247_912 220
136 3300049582 Ga0501048_0146488 Ga0501048_0146488_629_1294 220
137 3300049584 Ga0501068_0336374 Ga0501068_0336374_82_747 220
138 3300049586 Ga0501070_0362431 Ga0501070_0362431_487_1152 220
139 3300049587 Ga0501071_0078531 Ga0501071_0078531_200_865 220
140 3300049587 Ga0501071_0370346 Ga0501071_0370346_229_900 220
141 3300049588 Ga0501072_0014032 Ga0501072_0014032_352_1017 220
142 3300049588 Ga0501072_0054541 Ga0501072_0054541_691_1356 220
143 3300049588 Ga0501072_0276314 Ga0501072_0276314_578_1243 220
144 3300049590 Ga0501074_0548431 Ga0501074_0548431_117_782 220
145 3300049591 Ga0501075_0032473 Ga0501075_0032473_1019_1684 220
146 3300049592 Ga0501076_0137325 Ga0501076_0137325_623_1288 220
147 3300049592 Ga0501076_0166179 Ga0501076_0166179_1036_1701 220
148 3300049592 Ga0501076_0414995 Ga0501076_0414995_31_696 220
149 3300049741 Ga0501079_0131473 Ga0501079_0131473_897_1562 220
150 3300049741 Ga0501079_0211377 Ga0501079_0211377_647_1312 220
151 3300049742 Ga0501080_0097833 Ga0501080_0097833_107_772 220
152 3300049743 Ga0501081_0052467 Ga0501081_0052467_93_758 220
153 3300049744 Ga0501083_0157153 Ga0501083_0157153_611_1276 220
154 3300049823 Ga0501044_0304193 Ga0501044_0304193_280_954 220
155 3300049824 Ga0501045_0466658 Ga0501045_0466658_71_736 220
156 3300050507 nmdc:mga05p37_1248281_c1 nmdc:mga05p37_1248281_c1_82_753 220
157 3300050507 nmdc:mga05p37_25492_c1 nmdc:mga05p37_25492_c1_503_1174 220
158 3300050511 nmdc:mga08y16_1046064_c1 nmdc:mga08y16_1046064_c1_85_747 220
159 3300050511 nmdc:mga08y16_346105_c1 nmdc:mga08y16_346105_c1_41_712 220
160 3300050511 nmdc:mga08y16_593814_c1 nmdc:mga08y16_593814_c1_56_718 220
161 3300050511 nmdc:mga08y16_601100_c1 nmdc:mga08y16_601100_c1_41_712 220
162 3300054114 Ga0501084_0066415 Ga0501084_0066415_2038_2703 220
163 3300054114 Ga0501084_0098259 Ga0501084_0098259_37_702 220
164 3300054114 Ga0501084_0634727 Ga0501084_0634727_71_736 220
165 3300060353 Ga0501082_0123155 Ga0501082_0123155_634_1299 220
166 3300060353 Ga0501082_0155258 Ga0501082_0155258_965_1630 220
167 3300061734 Ga0530510_0013210 Ga0530510_0013210_4741_5406 220
168 3300061734 Ga0530510_0107704 Ga0530510_0107704_661_1326 220
169 3300005337 Ga0070682_100028170 Ga0070682_1000281703 221
170 3300005339 Ga0070660_100003783 Ga0070660_10000378310 221
171 3300005345 Ga0070692_10082577 Ga0070692_100825773 221
172 3300005366 Ga0070659_100007192 Ga0070659_1000071926 221
173 3300005458 Ga0070681_10011505 Ga0070681_100115058 221
174 3300005530 Ga0070679_100136753 Ga0070679_1001367532 221
175 3300005539 Ga0068853_100017704 Ga0068853_1000177043 221
176 3300005564 Ga0070664_100200709 Ga0070664_1002007091 221
177 3300005564 Ga0070664_100501296 Ga0070664_1005012962 221
178 3300005614 Ga0068856_100070637 Ga0068856_1000706372 221
179 3300005616 Ga0068852_100004550 Ga0068852_1000045503 221
180 3300006058 Ga0075432_10072398 Ga0075432_100723982 221
181 3300009093 Ga0105240_10061134 Ga0105240_100611343 221
182 3300009545 Ga0105237_10018979 Ga0105237_100189796 221
183 3300009551 Ga0105238_10034162 Ga0105238_100341624 221
184 3300010375 Ga0105239_10109203 Ga0105239_101092033 221
185 3300013104 Ga0157370_10042477 Ga0157370_100424775 221
186 3300013307 Ga0157372_10186719 Ga0157372_101867191 221
187 3300025908 Ga0207643_10106301 Ga0207643_101063013 221
188 3300025909 Ga0207705_10032701 Ga0207705_100327013 221
189 3300025912 Ga0207707_10010935 Ga0207707_100109356 221
190 3300025913 Ga0207695_10075450 Ga0207695_100754502 221
191 3300025914 Ga0207671_10088016 Ga0207671_100880164 221
192 3300025917 Ga0207660_10006676 Ga0207660_100066763 221
193 3300025919 Ga0207657_10012911 Ga0207657_100129119 221
194 3300025920 Ga0207649_10005180 Ga0207649_100051804 221
195 3300025924 Ga0207694_10046537 Ga0207694_100465371 221
196 3300025932 Ga0207690_10007386 Ga0207690_100073866 221
197 3300025944 Ga0207661_10000257 Ga0207661_1000025721 221
198 3300026023 Ga0207677_10260856 Ga0207677_102608563 221
199 3300026078 Ga0207702_10140545 Ga0207702_101405452 221
200 3300026089 Ga0207648_10281220 Ga0207648_102812202 221
201 3300026118 Ga0207675_100348927 Ga0207675_1003489273 221
202 3300026142 Ga0207698_10102191 Ga0207698_101021912 221
203 3300027907 Ga0207428_10413686 Ga0207428_104136862 221
204 3300031548 Ga0307408_100019186 Ga0307408_1000191863 221
205 3300031731 Ga0307405_10430904 Ga0307405_104309042 221
206 3300031824 Ga0307413_10045441 Ga0307413_100454412 221
207 3300031852 Ga0307410_10028533 Ga0307410_100285332 221
208 3300031889 Ga0326468_10009913 Ga0326468_100099132 221
209 3300031901 Ga0307406_10018824 Ga0307406_100188242 221
210 3300031911 Ga0307412_10043606 Ga0307412_100436063 221
211 3300031995 Ga0307409_100048169 Ga0307409_1000481693 221
212 3300032002 Ga0307416_100332626 Ga0307416_1003326262 221
213 3300032005 Ga0307411_10031138 Ga0307411_100311383 221
214 3300045976 Ga0466967_0049172 Ga0466967_0049172_1196_1867 221
215 3300003203 JGI25406J46586_10014311 JGI25406J46586_100143113 222
216 3300003203 JGI25406J46586_10059428 JGI25406J46586_100594282 222
217 3300005548 Ga0070665_100000312 Ga0070665_10000031264 222
218 3300005985 Ga0081539_10009632 Ga0081539_100096326 222
219 3300005985 Ga0081539_10050056 Ga0081539_100500562 222
220 3300025944 Ga0207661_10356508 Ga0207661_103565081 222
221 3300025944 Ga0207661_10366621 Ga0207661_103666212 222
222 3300028379 Ga0268266_10013842 Ga0268266_100138426 222
223 3300031824 Ga0307413_10150524 Ga0307413_101505242 222
224 3300031911 Ga0307412_10101283 Ga0307412_101012832 222
225 3300031995 Ga0307409_100005209 Ga0307409_1000052095 222
226 3300032126 Ga0307415_100309244 Ga0307415_1003092442 222
227 3300046515 Ga0495620_0114469 Ga0495620_0114469_21_692 222
228 3300048908 Ga0496105_0593699 Ga0496105_0593699_75_749 222
229 3300048912 Ga0496109_0442547 Ga0496109_0442547_39_710 222
230 3300050507 nmdc:mga05p37_853472_c1 nmdc:mga05p37_853472_c1_285_956 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01507

PAPS_reduct

Phosphoadenosine phosphosulfate reductase family

53

214

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lhu-assembly1.cif.gz_A crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp 0.9615 13 202
7lhs-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.94 13 204
7lhs-assembly1.cif.gz_A crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.9394 13 202
7lhu-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp 0.9339 13 204
6vpu-assembly8.cif.gz_H 1.90 angstrom resolution crystal structure phosphoadenosine phosphosulfate reductase (cysh) from vibrio vulnificus 0.9249 13 201
ID Description Score Start End Superfamily
af_P17854_2_216_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9264 13 198 3.40.50.620
2goyE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9213 13 202 3.40.50.620
4bwvB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8958 18 202 3.40.50.620
af_Q60377_225_441_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8928 17 200 3.40.50.620
af_P9WIK3_10_254_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8691 13 222 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A061NLW8-F1-model_v4 Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) 0.9804 13 201 GO:0004604
GO:0005737
GO:0019379
GO:0043866
GO:0046872
GO:0051539
GO:0070814
AF-A0A2T2SKD0-F1-model_v4 Phosphoadenylyl-sulfate reductase 0.9793 13 197 GO:0004604
GO:0005737
GO:0019379
AF-A0A838PTG6-F1-model_v4 Phosphoadenosine phosphosulfate reductase family protein 0.9788 10 170 GO:0004604
GO:0005737
GO:0019379
AF-A0A7V8YQ67-F1-model_v4 Phosphoadenosine phosphosulfate reductase family protein 0.9757 11 119 GO:0004604
GO:0005737
GO:0019379
AF-A0A2V9Q655-F1-model_v4 Phosphoadenosine phosphosulfate reductase 0.9679 54 160 GO:0004604
GO:0005737
GO:0019379

Feature Viewer

pLDDT pTM Quality
86.71 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map