F343295
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 230 | 140 | 230 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300044842|Ga0466957_0172175|Ga0466957_0172175_365_1069 |
| Length | 234 |
| Sequence | VSADAERIDLNVVDSNEPAPDPGPVAPAPGAPDLEQLSAQEVVAYAVNEFAPRLTMACSFQKEESVLVHMLAQVTDTPRVFTIDTGVLFGETLTTWKAFEDRFGLKVDVMDASSPGAPWTAENCCGSAKVDALERALATDVDAWMTGIRRDQASTRAAAPKIERDERRGIWKLNPLADWSEKDVWRYIFKHDLPYHPLHDQGYASIGCAPCTLPGSGRDGRWAGQDKTECGIHE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 3 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 15 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 18 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 20 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 21 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 22 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 23 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 25 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 26 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 27 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 28 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 41 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 65 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 68 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 69 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 70 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 71 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 72 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 73 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 74 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 75 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 76 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 77 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 78 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 79 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 80 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 81 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 82 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 83 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 84 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 85 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 86 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 87 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 88 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 89 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 90 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 91 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 92 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 93 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 94 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 95 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 96 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 97 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 98 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 99 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 102 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 103 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 104 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 105 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 106 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 107 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 108 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 109 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 110 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 111 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 114 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 115 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 120 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 121 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 126 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 131 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 140 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.43 |
| Nodule | 0 |
| Rhizoplane | 5.22 |
| Rhizosphere | 93.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10014311 | 3300003203 | Bacteria | 3377 |
| 2 | JGI25406J46586_10059428 | 3300003203 | Bacteria | 1241 |
| 3 | Ga0070680_100428426 | 3300005336 | Bacteria | 1129 |
| 4 | Ga0070682_100028170 | 3300005337 | Bacteria | 3377 |
| 5 | Ga0070660_100002664 | 3300005339 | Bacteria | 12265 |
| 6 | Ga0070660_100003783 | 3300005339 | Bacteria | 10457 |
| 7 | Ga0070691_10236946 | 3300005341 | Bacteria | 973 |
| 8 | Ga0070692_10082577 | 3300005345 | Bacteria | 1733 |
| 9 | Ga0070674_100091174 | 3300005356 | Bacteria | 2200 |
| 10 | Ga0070674_100324206 | 3300005356 | Bacteria | 1236 |
| 11 | Ga0070659_100007192 | 3300005366 | Bacteria | 8077 |
| 12 | Ga0070659_100185158 | 3300005366 | Bacteria | 1710 |
| 13 | Ga0070701_10166839 | 3300005438 | Bacteria | 1279 |
| 14 | Ga0070700_100540467 | 3300005441 | Bacteria | 903 |
| 15 | Ga0070681_10011505 | 3300005458 | Bacteria | 8761 |
| 16 | Ga0070681_10679774 | 3300005458 | Bacteria | 945 |
| 17 | Ga0068867_100161005 | 3300005459 | Bacteria | 1770 |
| 18 | Ga0070679_100136753 | 3300005530 | Bacteria | 2431 |
| 19 | Ga0068853_100017704 | 3300005539 | Bacteria | 5881 |
| 20 | Ga0070696_100216741 | 3300005546 | Bacteria | 1435 |
| 21 | Ga0070665_100000312 | 3300005548 | Bacteria | 75711 |
| 22 | Ga0068855_100093892 | 3300005563 | Bacteria | 3460 |
| 23 | Ga0070664_100200709 | 3300005564 | Bacteria | 1780 |
| 24 | Ga0070664_100501296 | 3300005564 | Bacteria | 1119 |
| 25 | Ga0068856_100070637 | 3300005614 | Bacteria | 3454 |
| 26 | Ga0068856_100545258 | 3300005614 | Bacteria | 1181 |
| 27 | Ga0068852_100004550 | 3300005616 | Bacteria | 9818 |
| 28 | Ga0068864_100299973 | 3300005618 | Bacteria | 1504 |
| 29 | Ga0081455_10191892 | 3300005937 | Bacteria | 1537 |
| 30 | Ga0081538_10001913 | 3300005981 | Bacteria | 20841 |
| 31 | Ga0081538_10009321 | 3300005981 | Bacteria | 8209 |
| 32 | Ga0081538_10021300 | 3300005981 | Bacteria | 4737 |
| 33 | Ga0081538_10067867 | 3300005981 | Bacteria | 1987 |
| 34 | Ga0081538_10107625 | 3300005981 | Bacteria | 1380 |
| 35 | Ga0081538_10184496 | 3300005981 | Bacteria | 887 |
| 36 | Ga0081539_10002904 | 3300005985 | Bacteria | 22668 |
| 37 | Ga0081539_10009632 | 3300005985 | Bacteria | 8015 |
| 38 | Ga0081539_10050056 | 3300005985 | Bacteria | 2366 |
| 39 | Ga0075365_10028062 | 3300006038 | Bacteria | 3587 |
| 40 | Ga0075432_10072398 | 3300006058 | Bacteria | 1240 |
| 41 | Ga0075431_100320977 | 3300006847 | Bacteria | 1562 |
| 42 | Ga0105240_10061134 | 3300009093 | Bacteria | 4695 |
| 43 | Ga0111539_10021974 | 3300009094 | Bacteria | 7842 |
| 44 | Ga0111539_10364118 | 3300009094 | Bacteria | 1683 |
| 45 | Ga0111539_10407091 | 3300009094 | Bacteria | 1584 |
| 46 | Ga0111539_11113095 | 3300009094 | Unclassified | 918 |
| 47 | Ga0111539_11168193 | 3300009094 | Bacteria | 894 |
| 48 | Ga0111539_11350712 | 3300009094 | Bacteria | 827 |
| 49 | Ga0105245_10564589 | 3300009098 | Bacteria | 1161 |
| 50 | Ga0114129_10066308 | 3300009147 | Bacteria | 5036 |
| 51 | Ga0114129_10430876 | 3300009147 | Bacteria | 1733 |
| 52 | Ga0114129_10785251 | 3300009147 | Bacteria | 1216 |
| 53 | Ga0105237_10018979 | 3300009545 | Bacteria | 7106 |
| 54 | Ga0105238_10034162 | 3300009551 | Bacteria | 5175 |
| 55 | Ga0105239_10109203 | 3300010375 | Bacteria | 3065 |
| 56 | Ga0157370_10042477 | 3300013104 | Bacteria | 4381 |
| 57 | Ga0157372_10186719 | 3300013307 | Bacteria | 2400 |
| 58 | Ga0157375_10675164 | 3300013308 | Bacteria | 1188 |
| 59 | Ga0163163_10113706 | 3300014325 | Bacteria | 2737 |
| 60 | Ga0157380_10278758 | 3300014326 | Bacteria | 1528 |
| 61 | Ga0213874_10069186 | 3300021377 | Bacteria | 1122 |
| 62 | Ga0207643_10106301 | 3300025908 | Bacteria | 1650 |
| 63 | Ga0207705_10032701 | 3300025909 | Bacteria | 3718 |
| 64 | Ga0207707_10010935 | 3300025912 | Bacteria | 7893 |
| 65 | Ga0207707_10496043 | 3300025912 | Bacteria | 1042 |
| 66 | Ga0207695_10075450 | 3300025913 | Bacteria | 3431 |
| 67 | Ga0207671_10088016 | 3300025914 | Bacteria | 2336 |
| 68 | Ga0207663_10350129 | 3300025916 | Bacteria | 1118 |
| 69 | Ga0207660_10006676 | 3300025917 | Bacteria | 7479 |
| 70 | Ga0207657_10012911 | 3300025919 | Bacteria | 8214 |
| 71 | Ga0207657_10017080 | 3300025919 | Bacteria | 6977 |
| 72 | Ga0207649_10005180 | 3300025920 | Bacteria | 7040 |
| 73 | Ga0207646_10065468 | 3300025922 | Bacteria | 3245 |
| 74 | Ga0207694_10046537 | 3300025924 | Bacteria | 3353 |
| 75 | Ga0207687_10529821 | 3300025927 | Bacteria | 986 |
| 76 | Ga0207690_10007386 | 3300025932 | Bacteria | 6525 |
| 77 | Ga0207669_10144022 | 3300025937 | Bacteria | 1659 |
| 78 | Ga0207661_10000257 | 3300025944 | Bacteria | 34367 |
| 79 | Ga0207661_10356508 | 3300025944 | Bacteria | 1321 |
| 80 | Ga0207661_10366621 | 3300025944 | Bacteria | 1302 |
| 81 | Ga0207712_10333077 | 3300025961 | Bacteria | 1256 |
| 82 | Ga0207677_10260856 | 3300026023 | Bacteria | 1412 |
| 83 | Ga0207678_10212487 | 3300026067 | Bacteria | 1655 |
| 84 | Ga0207708_10122193 | 3300026075 | Bacteria | 2029 |
| 85 | Ga0207702_10042132 | 3300026078 | Bacteria | 3829 |
| 86 | Ga0207702_10140545 | 3300026078 | Bacteria | 2184 |
| 87 | Ga0207648_10281220 | 3300026089 | Bacteria | 1488 |
| 88 | Ga0207675_100348927 | 3300026118 | Bacteria | 1450 |
| 89 | Ga0207675_101217446 | 3300026118 | Bacteria | 773 |
| 90 | Ga0207698_10102191 | 3300026142 | Bacteria | 2379 |
| 91 | Ga0207428_10257989 | 3300027907 | Bacteria | 1299 |
| 92 | Ga0207428_10413686 | 3300027907 | Bacteria | 986 |
| 93 | Ga0207428_10609277 | 3300027907 | Bacteria | 786 |
| 94 | Ga0268266_10013842 | 3300028379 | Bacteria | 6945 |
| 95 | Ga0268265_10421173 | 3300028380 | Bacteria | 1240 |
| 96 | Ga0265319_1020379 | 3300028563 | Bacteria | 2459 |
| 97 | Ga0265338_10060791 | 3300028800 | Bacteria | 3315 |
| 98 | Ga0265340_10040159 | 3300031247 | Bacteria | 2306 |
| 99 | Ga0307408_100019186 | 3300031548 | Bacteria | 4602 |
| 100 | Ga0307405_10043548 | 3300031731 | Bacteria | 2740 |
| 101 | Ga0307405_10430904 | 3300031731 | Bacteria | 1040 |
| 102 | Ga0307413_10045441 | 3300031824 | Bacteria | 2603 |
| 103 | Ga0307413_10074880 | 3300031824 | Bacteria | 2146 |
| 104 | Ga0307413_10150524 | 3300031824 | Bacteria | 1621 |
| 105 | Ga0307413_10510246 | 3300031824 | Bacteria | 967 |
| 106 | Ga0307410_10028533 | 3300031852 | Bacteria | 3542 |
| 107 | Ga0307410_10217843 | 3300031852 | Bacteria | 1467 |
| 108 | Ga0326468_10009913 | 3300031889 | Bacteria | 953 |
| 109 | Ga0307406_10018824 | 3300031901 | Bacteria | 4042 |
| 110 | Ga0307406_10040518 | 3300031901 | Bacteria | 2897 |
| 111 | Ga0307406_10444021 | 3300031901 | Bacteria | 1039 |
| 112 | Ga0307412_10043606 | 3300031911 | Bacteria | 2922 |
| 113 | Ga0307412_10101283 | 3300031911 | Bacteria | 2038 |
| 114 | Ga0307412_10228941 | 3300031911 | Bacteria | 1430 |
| 115 | Ga0307409_100005209 | 3300031995 | Bacteria | 7443 |
| 116 | Ga0307409_100011281 | 3300031995 | Bacteria | 5622 |
| 117 | Ga0307409_100048169 | 3300031995 | Bacteria | 3240 |
| 118 | Ga0307416_100053951 | 3300032002 | Bacteria | 3228 |
| 119 | Ga0307416_100332626 | 3300032002 | Bacteria | 1527 |
| 120 | Ga0307416_100998173 | 3300032002 | Bacteria | 940 |
| 121 | Ga0307411_10031138 | 3300032005 | Bacteria | 3278 |
| 122 | Ga0307415_100309244 | 3300032126 | Bacteria | 1313 |
| 123 | Ga0373944_0069647 | 3300035089 | Bacteria | 1144 |
| 124 | Ga0373935_0353393 | 3300035692 | Bacteria | 1048 |
| 125 | Ga0395900_0031106 | 3300037418 | Bacteria | 5483 |
| 126 | Ga0395898_0000333 | 3300037466 | Bacteria | 106932 |
| 127 | Ga0395901_0352856 | 3300038443 | Bacteria | 1518 |
| 128 | Ga0439448_0027003 | 3300042005 | Bacteria | 1808 |
| 129 | Ga0450916_007983 | 3300042530 | Bacteria | 1280 |
| 130 | Ga0466969_0018100 | 3300044656 | Bacteria | 3675 |
| 131 | Ga0466969_0049433 | 3300044656 | Bacteria | 2075 |
| 132 | Ga0466969_0083446 | 3300044656 | Bacteria | 1522 |
| 133 | Ga0466966_0017712 | 3300044684 | Bacteria | 4704 |
| 134 | Ga0466966_0252294 | 3300044684 | Bacteria | 1063 |
| 135 | Ga0466966_0413051 | 3300044684 | Bacteria | 811 |
| 136 | Ga0466961_0006657 | 3300044693 | Bacteria | 7349 |
| 137 | Ga0466961_0022373 | 3300044693 | Bacteria | 4066 |
| 138 | Ga0466961_0046026 | 3300044693 | Bacteria | 2791 |
| 139 | Ga0466963_0001010 | 3300044694 | Bacteria | 14546 |
| 140 | Ga0466963_0026924 | 3300044694 | Bacteria | 3678 |
| 141 | Ga0466971_0016337 | 3300044719 | Bacteria | 3274 |
| 142 | Ga0466971_0021280 | 3300044719 | Bacteria | 2887 |
| 143 | Ga0466968_0024690 | 3300044735 | Bacteria | 2458 |
| 144 | Ga0466970_0209748 | 3300044765 | Bacteria | 1085 |
| 145 | Ga0466957_0026884 | 3300044842 | Bacteria | 3416 |
| 146 | Ga0466957_0030540 | 3300044842 | Bacteria | 3218 |
| 147 | Ga0466957_0095516 | 3300044842 | Bacteria | 1867 |
| 148 | Ga0466957_0172175 | 3300044842 | Bacteria | 1411 |
| 149 | Ga0466959_0005807 | 3300045049 | Bacteria | 8501 |
| 150 | Ga0466959_0008093 | 3300045049 | Bacteria | 7414 |
| 151 | Ga0466959_0014415 | 3300045049 | Bacteria | 5742 |
| 152 | Ga0466958_0000727 | 3300045836 | Bacteria | 14397 |
| 153 | Ga0466958_0008531 | 3300045836 | Bacteria | 5690 |
| 154 | Ga0466958_0152018 | 3300045836 | Bacteria | 1460 |
| 155 | Ga0466958_0220837 | 3300045836 | Bacteria | 1209 |
| 156 | Ga0466958_0261782 | 3300045836 | Bacteria | 1107 |
| 157 | Ga0466967_0049172 | 3300045976 | Bacteria | 3687 |
| 158 | Ga0495620_0114469 | 3300046515 | Bacteria | 1067 |
| 159 | Ga0495624_0135362 | 3300046690 | Bacteria | 1510 |
| 160 | Ga0496102_0140075 | 3300048905 | Bacteria | 2268 |
| 161 | Ga0496105_0488708 | 3300048908 | Bacteria | 968 |
| 162 | Ga0496105_0593699 | 3300048908 | Bacteria | 860 |
| 163 | Ga0496108_1065128 | 3300048911 | Bacteria | 688 |
| 164 | Ga0496109_0034771 | 3300048912 | Bacteria | 4541 |
| 165 | Ga0496109_0442547 | 3300048912 | Bacteria | 1228 |
| 166 | Ga0496110_0171082 | 3300048913 | Bacteria | 1971 |
| 167 | Ga0496111_0089550 | 3300048914 | Bacteria | 2254 |
| 168 | Ga0496111_0104072 | 3300048914 | Bacteria | 2088 |
| 169 | Ga0496112_0451552 | 3300048915 | Bacteria | 1223 |
| 170 | Ga0496113_0026147 | 3300048916 | Bacteria | 4170 |
| 171 | Ga0496115_0440880 | 3300048918 | Bacteria | 1053 |
| 172 | Ga0501291_005039 | 3300049514 | Bacteria | 1710 |
| 173 | Ga0501031_0143395 | 3300049568 | Bacteria | 1561 |
| 174 | Ga0501031_0261565 | 3300049568 | Bacteria | 1124 |
| 175 | Ga0501032_0375653 | 3300049569 | Bacteria | 914 |
| 176 | Ga0501033_0338088 | 3300049570 | Bacteria | 1056 |
| 177 | Ga0501036_0277197 | 3300049572 | Bacteria | 1403 |
| 178 | Ga0501036_0358561 | 3300049572 | Bacteria | 1217 |
| 179 | Ga0501037_0648761 | 3300049573 | Bacteria | 706 |
| 180 | Ga0501038_0058641 | 3300049574 | Bacteria | 3300 |
| 181 | Ga0501038_0132385 | 3300049574 | Bacteria | 2046 |
| 182 | Ga0501038_0209502 | 3300049574 | Bacteria | 1560 |
| 183 | Ga0501040_0040916 | 3300049576 | Bacteria | 3156 |
| 184 | Ga0501040_0071261 | 3300049576 | Bacteria | 2399 |
| 185 | Ga0501040_0271147 | 3300049576 | Bacteria | 1212 |
| 186 | Ga0501041_0102981 | 3300049577 | Bacteria | 1768 |
| 187 | Ga0501041_0165301 | 3300049577 | Bacteria | 1384 |
| 188 | Ga0501041_0186684 | 3300049577 | Bacteria | 1298 |
| 189 | Ga0501041_0295424 | 3300049577 | Bacteria | 1020 |
| 190 | Ga0501042_0116073 | 3300049578 | Bacteria | 1927 |
| 191 | Ga0501048_0058524 | 3300049582 | Bacteria | 2731 |
| 192 | Ga0501048_0146488 | 3300049582 | Bacteria | 1670 |
| 193 | Ga0501068_0336374 | 3300049584 | Bacteria | 969 |
| 194 | Ga0501070_0362431 | 3300049586 | Bacteria | 1176 |
| 195 | Ga0501071_0038465 | 3300049587 | Bacteria | 3419 |
| 196 | Ga0501071_0078531 | 3300049587 | Bacteria | 2412 |
| 197 | Ga0501071_0370346 | 3300049587 | Bacteria | 1092 |
| 198 | Ga0501072_0014032 | 3300049588 | Bacteria | 6140 |
| 199 | Ga0501072_0054541 | 3300049588 | Bacteria | 3149 |
| 200 | Ga0501072_0276314 | 3300049588 | Bacteria | 1336 |
| 201 | Ga0501074_0548431 | 3300049590 | Bacteria | 818 |
| 202 | Ga0501075_0032473 | 3300049591 | Bacteria | 3879 |
| 203 | Ga0501076_0137325 | 3300049592 | Bacteria | 1985 |
| 204 | Ga0501076_0166179 | 3300049592 | Bacteria | 1798 |
| 205 | Ga0501076_0414995 | 3300049592 | Bacteria | 1107 |
| 206 | Ga0501079_0131473 | 3300049741 | Bacteria | 1948 |
| 207 | Ga0501079_0203843 | 3300049741 | Bacteria | 1545 |
| 208 | Ga0501079_0211377 | 3300049741 | Bacteria | 1515 |
| 209 | Ga0501080_0097833 | 3300049742 | Bacteria | 2725 |
| 210 | Ga0501081_0052467 | 3300049743 | Bacteria | 2814 |
| 211 | Ga0501083_0157153 | 3300049744 | Bacteria | 1488 |
| 212 | Ga0501044_0304193 | 3300049823 | Bacteria | 1523 |
| 213 | Ga0501045_0466658 | 3300049824 | Bacteria | 938 |
| 214 | nmdc:mga05p37_1248281_c1 | 3300050507 | Bacteria | 763 |
| 215 | nmdc:mga05p37_25492_c1 | 3300050507 | Bacteria | 7192 |
| 216 | nmdc:mga05p37_853472_c1 | 3300050507 | Bacteria | 988 |
| 217 | nmdc:mga05p37_859083_c1 | 3300050507 | Bacteria | 984 |
| 218 | nmdc:mga0qj67_508165_c1 | 3300050509 | Bacteria | 968 |
| 219 | nmdc:mga08y16_1046064_c1 | 3300050511 | Unclassified | 794 |
| 220 | nmdc:mga08y16_346105_c1 | 3300050511 | Bacteria | 1528 |
| 221 | nmdc:mga08y16_593814_c1 | 3300050511 | Bacteria | 1117 |
| 222 | nmdc:mga08y16_601100_c1 | 3300050511 | Bacteria | 1109 |
| 223 | Ga0501084_0066415 | 3300054114 | Bacteria | 3018 |
| 224 | Ga0501084_0098259 | 3300054114 | Bacteria | 2458 |
| 225 | Ga0501084_0634727 | 3300054114 | Bacteria | 902 |
| 226 | Ga0501082_0123155 | 3300060353 | Bacteria | 2248 |
| 227 | Ga0501082_0155258 | 3300060353 | Bacteria | 1988 |
| 228 | Ga0466962_0012146 | 3300061719 | Bacteria | 4140 |
| 229 | Ga0530510_0013210 | 3300061734 | Bacteria | 5807 |
| 230 | Ga0530510_0107704 | 3300061734 | Bacteria | 2040 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048913 | Ga0496110_0171082 | Ga0496110_0171082_129_722 | 163 |
| 2 | 3300044694 | Ga0466963_0026924 | Ga0466963_0026924_3090_3629 | 178 |
| 3 | 3300049576 | Ga0501040_0271147 | Ga0501040_0271147_18_611 | 197 |
| 4 | 3300005618 | Ga0068864_100299973 | Ga0068864_1002999732 | 200 |
| 5 | 3300014325 | Ga0163163_10113706 | Ga0163163_101137062 | 200 |
| 6 | 3300048911 | Ga0496108_1065128 | Ga0496108_1065128_44_652 | 200 |
| 7 | 3300048912 | Ga0496109_0034771 | Ga0496109_0034771_1403_2011 | 200 |
| 8 | 3300048914 | Ga0496111_0089550 | Ga0496111_0089550_1455_2063 | 200 |
| 9 | 3300048914 | Ga0496111_0104072 | Ga0496111_0104072_479_1087 | 200 |
| 10 | 3300048915 | Ga0496112_0451552 | Ga0496112_0451552_451_1059 | 200 |
| 11 | 3300048916 | Ga0496113_0026147 | Ga0496113_0026147_271_879 | 200 |
| 12 | 3300049577 | Ga0501041_0165301 | Ga0501041_0165301_714_1322 | 202 |
| 13 | 3300006038 | Ga0075365_10028062 | Ga0075365_100280621 | 203 |
| 14 | 3300005981 | Ga0081538_10009321 | Ga0081538_100093212 | 204 |
| 15 | 3300005614 | Ga0068856_100545258 | Ga0068856_1005452581 | 206 |
| 16 | 3300021377 | Ga0213874_10069186 | Ga0213874_100691862 | 206 |
| 17 | 3300026078 | Ga0207702_10042132 | Ga0207702_100421322 | 206 |
| 18 | 3300037418 | Ga0395900_0031106 | Ga0395900_0031106_2710_3333 | 206 |
| 19 | 3300037466 | Ga0395898_0000333 | Ga0395898_0000333_22211_22834 | 206 |
| 20 | 3300044656 | Ga0466969_0049433 | Ga0466969_0049433_500_1123 | 206 |
| 21 | 3300044656 | Ga0466969_0083446 | Ga0466969_0083446_319_945 | 206 |
| 22 | 3300044684 | Ga0466966_0252294 | Ga0466966_0252294_271_909 | 206 |
| 23 | 3300044684 | Ga0466966_0413051 | Ga0466966_0413051_135_758 | 206 |
| 24 | 3300044693 | Ga0466961_0022373 | Ga0466961_0022373_1404_2030 | 206 |
| 25 | 3300044693 | Ga0466961_0046026 | Ga0466961_0046026_94_720 | 206 |
| 26 | 3300044719 | Ga0466971_0016337 | Ga0466971_0016337_1562_2188 | 206 |
| 27 | 3300044719 | Ga0466971_0021280 | Ga0466971_0021280_1619_2242 | 206 |
| 28 | 3300044765 | Ga0466970_0209748 | Ga0466970_0209748_338_964 | 206 |
| 29 | 3300044842 | Ga0466957_0026884 | Ga0466957_0026884_1920_2546 | 206 |
| 30 | 3300044842 | Ga0466957_0030540 | Ga0466957_0030540_2190_2813 | 206 |
| 31 | 3300045049 | Ga0466959_0008093 | Ga0466959_0008093_6328_6954 | 206 |
| 32 | 3300045049 | Ga0466959_0014415 | Ga0466959_0014415_1388_2011 | 206 |
| 33 | 3300045836 | Ga0466958_0008531 | Ga0466958_0008531_3175_3801 | 206 |
| 34 | 3300045836 | Ga0466958_0152018 | Ga0466958_0152018_456_1082 | 206 |
| 35 | 3300045836 | Ga0466958_0220837 | Ga0466958_0220837_178_801 | 206 |
| 36 | 3300061719 | Ga0466962_0012146 | Ga0466962_0012146_1614_2240 | 206 |
| 37 | 3300044656 | Ga0466969_0018100 | Ga0466969_0018100_2589_3218 | 207 |
| 38 | 3300044684 | Ga0466966_0017712 | Ga0466966_0017712_3528_4157 | 207 |
| 39 | 3300044693 | Ga0466961_0006657 | Ga0466961_0006657_3589_4218 | 207 |
| 40 | 3300044694 | Ga0466963_0001010 | Ga0466963_0001010_8766_9395 | 207 |
| 41 | 3300044735 | Ga0466968_0024690 | Ga0466968_0024690_274_903 | 207 |
| 42 | 3300044842 | Ga0466957_0095516 | Ga0466957_0095516_28_657 | 207 |
| 43 | 3300045049 | Ga0466959_0005807 | Ga0466959_0005807_6393_7022 | 207 |
| 44 | 3300045836 | Ga0466958_0000727 | Ga0466958_0000727_10389_11018 | 207 |
| 45 | 3300048908 | Ga0496105_0488708 | Ga0496105_0488708_44_688 | 207 |
| 46 | 3300048918 | Ga0496115_0440880 | Ga0496115_0440880_267_899 | 207 |
| 47 | 3300005339 | Ga0070660_100002664 | Ga0070660_1000026647 | 209 |
| 48 | 3300009147 | Ga0114129_10785251 | Ga0114129_107852511 | 209 |
| 49 | 3300025919 | Ga0207657_10017080 | Ga0207657_100170805 | 209 |
| 50 | 3300050507 | nmdc:mga05p37_859083_c1 | nmdc:mga05p37_859083_c1_311_952 | 209 |
| 51 | 3300044842 | Ga0466957_0172175 | Ga0466957_0172175_365_1069 | 210 |
| 52 | 3300045836 | Ga0466958_0261782 | Ga0466958_0261782_11_721 | 210 |
| 53 | 3300005341 | Ga0070691_10236946 | Ga0070691_102369462 | 214 |
| 54 | 3300005356 | Ga0070674_100324206 | Ga0070674_1003242062 | 214 |
| 55 | 3300005366 | Ga0070659_100185158 | Ga0070659_1001851583 | 214 |
| 56 | 3300005459 | Ga0068867_100161005 | Ga0068867_1001610052 | 214 |
| 57 | 3300042530 | Ga0450916_007983 | Ga0450916_007983_41_685 | 214 |
| 58 | 3300049574 | Ga0501038_0132385 | Ga0501038_0132385_1353_1997 | 214 |
| 59 | 3300049741 | Ga0501079_0203843 | Ga0501079_0203843_726_1370 | 214 |
| 60 | 3300050509 | nmdc:mga0qj67_508165_c1 | nmdc:mga0qj67_508165_c1_226_870 | 214 |
| 61 | 3300025912 | Ga0207707_10496043 | Ga0207707_104960432 | 216 |
| 62 | 3300049587 | Ga0501071_0038465 | Ga0501071_0038465_84_737 | 216 |
| 63 | 3300025916 | Ga0207663_10350129 | Ga0207663_103501292 | 217 |
| 64 | 3300025922 | Ga0207646_10065468 | Ga0207646_100654684 | 217 |
| 65 | 3300028563 | Ga0265319_1020379 | Ga0265319_10203792 | 217 |
| 66 | 3300028800 | Ga0265338_10060791 | Ga0265338_100607913 | 217 |
| 67 | 3300031247 | Ga0265340_10040159 | Ga0265340_100401593 | 217 |
| 68 | 3300035089 | Ga0373944_0069647 | Ga0373944_0069647_213_869 | 217 |
| 69 | 3300035692 | Ga0373935_0353393 | Ga0373935_0353393_26_682 | 217 |
| 70 | 3300005356 | Ga0070674_100091174 | Ga0070674_1000911742 | 218 |
| 71 | 3300025937 | Ga0207669_10144022 | Ga0207669_101440222 | 218 |
| 72 | 3300032002 | Ga0307416_100998173 | Ga0307416_1009981732 | 218 |
| 73 | 3300046690 | Ga0495624_0135362 | Ga0495624_0135362_269_955 | 218 |
| 74 | 3300005563 | Ga0068855_100093892 | Ga0068855_1000938921 | 219 |
| 75 | 3300009098 | Ga0105245_10564589 | Ga0105245_105645892 | 219 |
| 76 | 3300013308 | Ga0157375_10675164 | Ga0157375_106751642 | 219 |
| 77 | 3300014326 | Ga0157380_10278758 | Ga0157380_102787582 | 219 |
| 78 | 3300025927 | Ga0207687_10529821 | Ga0207687_105298212 | 219 |
| 79 | 3300038443 | Ga0395901_0352856 | Ga0395901_0352856_317_976 | 219 |
| 80 | 3300048905 | Ga0496102_0140075 | Ga0496102_0140075_1117_1785 | 219 |
| 81 | 3300005336 | Ga0070680_100428426 | Ga0070680_1004284262 | 220 |
| 82 | 3300005438 | Ga0070701_10166839 | Ga0070701_101668392 | 220 |
| 83 | 3300005441 | Ga0070700_100540467 | Ga0070700_1005404672 | 220 |
| 84 | 3300005458 | Ga0070681_10679774 | Ga0070681_106797742 | 220 |
| 85 | 3300005546 | Ga0070696_100216741 | Ga0070696_1002167412 | 220 |
| 86 | 3300005937 | Ga0081455_10191892 | Ga0081455_101918922 | 220 |
| 87 | 3300005981 | Ga0081538_10001913 | Ga0081538_1000191315 | 220 |
| 88 | 3300005981 | Ga0081538_10021300 | Ga0081538_100213006 | 220 |
| 89 | 3300005981 | Ga0081538_10067867 | Ga0081538_100678673 | 220 |
| 90 | 3300005981 | Ga0081538_10107625 | Ga0081538_101076252 | 220 |
| 91 | 3300005981 | Ga0081538_10184496 | Ga0081538_101844961 | 220 |
| 92 | 3300005985 | Ga0081539_10002904 | Ga0081539_1000290424 | 220 |
| 93 | 3300006847 | Ga0075431_100320977 | Ga0075431_1003209772 | 220 |
| 94 | 3300009094 | Ga0111539_10021974 | Ga0111539_100219743 | 220 |
| 95 | 3300009094 | Ga0111539_10364118 | Ga0111539_103641182 | 220 |
| 96 | 3300009094 | Ga0111539_10407091 | Ga0111539_104070912 | 220 |
| 97 | 3300009094 | Ga0111539_11113095 | Ga0111539_111130952 | 220 |
| 98 | 3300009094 | Ga0111539_11168193 | Ga0111539_111681931 | 220 |
| 99 | 3300009094 | Ga0111539_11350712 | Ga0111539_113507121 | 220 |
| 100 | 3300009147 | Ga0114129_10066308 | Ga0114129_100663082 | 220 |
| 101 | 3300009147 | Ga0114129_10430876 | Ga0114129_104308762 | 220 |
| 102 | 3300025961 | Ga0207712_10333077 | Ga0207712_103330772 | 220 |
| 103 | 3300026067 | Ga0207678_10212487 | Ga0207678_102124872 | 220 |
| 104 | 3300026075 | Ga0207708_10122193 | Ga0207708_101221932 | 220 |
| 105 | 3300026118 | Ga0207675_101217446 | Ga0207675_1012174461 | 220 |
| 106 | 3300027907 | Ga0207428_10257989 | Ga0207428_102579892 | 220 |
| 107 | 3300027907 | Ga0207428_10609277 | Ga0207428_106092772 | 220 |
| 108 | 3300028380 | Ga0268265_10421173 | Ga0268265_104211732 | 220 |
| 109 | 3300031731 | Ga0307405_10043548 | Ga0307405_100435483 | 220 |
| 110 | 3300031824 | Ga0307413_10074880 | Ga0307413_100748802 | 220 |
| 111 | 3300031824 | Ga0307413_10510246 | Ga0307413_105102462 | 220 |
| 112 | 3300031852 | Ga0307410_10217843 | Ga0307410_102178431 | 220 |
| 113 | 3300031901 | Ga0307406_10040518 | Ga0307406_100405183 | 220 |
| 114 | 3300031901 | Ga0307406_10444021 | Ga0307406_104440212 | 220 |
| 115 | 3300031911 | Ga0307412_10228941 | Ga0307412_102289412 | 220 |
| 116 | 3300031995 | Ga0307409_100011281 | Ga0307409_1000112815 | 220 |
| 117 | 3300032002 | Ga0307416_100053951 | Ga0307416_1000539512 | 220 |
| 118 | 3300042005 | Ga0439448_0027003 | Ga0439448_0027003_194_856 | 220 |
| 119 | 3300049514 | Ga0501291_005039 | Ga0501291_005039_803_1474 | 220 |
| 120 | 3300049568 | Ga0501031_0143395 | Ga0501031_0143395_31_696 | 220 |
| 121 | 3300049568 | Ga0501031_0261565 | Ga0501031_0261565_380_1045 | 220 |
| 122 | 3300049569 | Ga0501032_0375653 | Ga0501032_0375653_215_880 | 220 |
| 123 | 3300049570 | Ga0501033_0338088 | Ga0501033_0338088_285_950 | 220 |
| 124 | 3300049572 | Ga0501036_0277197 | Ga0501036_0277197_714_1379 | 220 |
| 125 | 3300049572 | Ga0501036_0358561 | Ga0501036_0358561_116_781 | 220 |
| 126 | 3300049573 | Ga0501037_0648761 | Ga0501037_0648761_22_687 | 220 |
| 127 | 3300049574 | Ga0501038_0058641 | Ga0501038_0058641_2283_2948 | 220 |
| 128 | 3300049574 | Ga0501038_0209502 | Ga0501038_0209502_285_950 | 220 |
| 129 | 3300049576 | Ga0501040_0040916 | Ga0501040_0040916_849_1514 | 220 |
| 130 | 3300049576 | Ga0501040_0071261 | Ga0501040_0071261_1144_1809 | 220 |
| 131 | 3300049577 | Ga0501041_0102981 | Ga0501041_0102981_42_707 | 220 |
| 132 | 3300049577 | Ga0501041_0186684 | Ga0501041_0186684_435_1100 | 220 |
| 133 | 3300049577 | Ga0501041_0295424 | Ga0501041_0295424_325_990 | 220 |
| 134 | 3300049578 | Ga0501042_0116073 | Ga0501042_0116073_1229_1894 | 220 |
| 135 | 3300049582 | Ga0501048_0058524 | Ga0501048_0058524_247_912 | 220 |
| 136 | 3300049582 | Ga0501048_0146488 | Ga0501048_0146488_629_1294 | 220 |
| 137 | 3300049584 | Ga0501068_0336374 | Ga0501068_0336374_82_747 | 220 |
| 138 | 3300049586 | Ga0501070_0362431 | Ga0501070_0362431_487_1152 | 220 |
| 139 | 3300049587 | Ga0501071_0078531 | Ga0501071_0078531_200_865 | 220 |
| 140 | 3300049587 | Ga0501071_0370346 | Ga0501071_0370346_229_900 | 220 |
| 141 | 3300049588 | Ga0501072_0014032 | Ga0501072_0014032_352_1017 | 220 |
| 142 | 3300049588 | Ga0501072_0054541 | Ga0501072_0054541_691_1356 | 220 |
| 143 | 3300049588 | Ga0501072_0276314 | Ga0501072_0276314_578_1243 | 220 |
| 144 | 3300049590 | Ga0501074_0548431 | Ga0501074_0548431_117_782 | 220 |
| 145 | 3300049591 | Ga0501075_0032473 | Ga0501075_0032473_1019_1684 | 220 |
| 146 | 3300049592 | Ga0501076_0137325 | Ga0501076_0137325_623_1288 | 220 |
| 147 | 3300049592 | Ga0501076_0166179 | Ga0501076_0166179_1036_1701 | 220 |
| 148 | 3300049592 | Ga0501076_0414995 | Ga0501076_0414995_31_696 | 220 |
| 149 | 3300049741 | Ga0501079_0131473 | Ga0501079_0131473_897_1562 | 220 |
| 150 | 3300049741 | Ga0501079_0211377 | Ga0501079_0211377_647_1312 | 220 |
| 151 | 3300049742 | Ga0501080_0097833 | Ga0501080_0097833_107_772 | 220 |
| 152 | 3300049743 | Ga0501081_0052467 | Ga0501081_0052467_93_758 | 220 |
| 153 | 3300049744 | Ga0501083_0157153 | Ga0501083_0157153_611_1276 | 220 |
| 154 | 3300049823 | Ga0501044_0304193 | Ga0501044_0304193_280_954 | 220 |
| 155 | 3300049824 | Ga0501045_0466658 | Ga0501045_0466658_71_736 | 220 |
| 156 | 3300050507 | nmdc:mga05p37_1248281_c1 | nmdc:mga05p37_1248281_c1_82_753 | 220 |
| 157 | 3300050507 | nmdc:mga05p37_25492_c1 | nmdc:mga05p37_25492_c1_503_1174 | 220 |
| 158 | 3300050511 | nmdc:mga08y16_1046064_c1 | nmdc:mga08y16_1046064_c1_85_747 | 220 |
| 159 | 3300050511 | nmdc:mga08y16_346105_c1 | nmdc:mga08y16_346105_c1_41_712 | 220 |
| 160 | 3300050511 | nmdc:mga08y16_593814_c1 | nmdc:mga08y16_593814_c1_56_718 | 220 |
| 161 | 3300050511 | nmdc:mga08y16_601100_c1 | nmdc:mga08y16_601100_c1_41_712 | 220 |
| 162 | 3300054114 | Ga0501084_0066415 | Ga0501084_0066415_2038_2703 | 220 |
| 163 | 3300054114 | Ga0501084_0098259 | Ga0501084_0098259_37_702 | 220 |
| 164 | 3300054114 | Ga0501084_0634727 | Ga0501084_0634727_71_736 | 220 |
| 165 | 3300060353 | Ga0501082_0123155 | Ga0501082_0123155_634_1299 | 220 |
| 166 | 3300060353 | Ga0501082_0155258 | Ga0501082_0155258_965_1630 | 220 |
| 167 | 3300061734 | Ga0530510_0013210 | Ga0530510_0013210_4741_5406 | 220 |
| 168 | 3300061734 | Ga0530510_0107704 | Ga0530510_0107704_661_1326 | 220 |
| 169 | 3300005337 | Ga0070682_100028170 | Ga0070682_1000281703 | 221 |
| 170 | 3300005339 | Ga0070660_100003783 | Ga0070660_10000378310 | 221 |
| 171 | 3300005345 | Ga0070692_10082577 | Ga0070692_100825773 | 221 |
| 172 | 3300005366 | Ga0070659_100007192 | Ga0070659_1000071926 | 221 |
| 173 | 3300005458 | Ga0070681_10011505 | Ga0070681_100115058 | 221 |
| 174 | 3300005530 | Ga0070679_100136753 | Ga0070679_1001367532 | 221 |
| 175 | 3300005539 | Ga0068853_100017704 | Ga0068853_1000177043 | 221 |
| 176 | 3300005564 | Ga0070664_100200709 | Ga0070664_1002007091 | 221 |
| 177 | 3300005564 | Ga0070664_100501296 | Ga0070664_1005012962 | 221 |
| 178 | 3300005614 | Ga0068856_100070637 | Ga0068856_1000706372 | 221 |
| 179 | 3300005616 | Ga0068852_100004550 | Ga0068852_1000045503 | 221 |
| 180 | 3300006058 | Ga0075432_10072398 | Ga0075432_100723982 | 221 |
| 181 | 3300009093 | Ga0105240_10061134 | Ga0105240_100611343 | 221 |
| 182 | 3300009545 | Ga0105237_10018979 | Ga0105237_100189796 | 221 |
| 183 | 3300009551 | Ga0105238_10034162 | Ga0105238_100341624 | 221 |
| 184 | 3300010375 | Ga0105239_10109203 | Ga0105239_101092033 | 221 |
| 185 | 3300013104 | Ga0157370_10042477 | Ga0157370_100424775 | 221 |
| 186 | 3300013307 | Ga0157372_10186719 | Ga0157372_101867191 | 221 |
| 187 | 3300025908 | Ga0207643_10106301 | Ga0207643_101063013 | 221 |
| 188 | 3300025909 | Ga0207705_10032701 | Ga0207705_100327013 | 221 |
| 189 | 3300025912 | Ga0207707_10010935 | Ga0207707_100109356 | 221 |
| 190 | 3300025913 | Ga0207695_10075450 | Ga0207695_100754502 | 221 |
| 191 | 3300025914 | Ga0207671_10088016 | Ga0207671_100880164 | 221 |
| 192 | 3300025917 | Ga0207660_10006676 | Ga0207660_100066763 | 221 |
| 193 | 3300025919 | Ga0207657_10012911 | Ga0207657_100129119 | 221 |
| 194 | 3300025920 | Ga0207649_10005180 | Ga0207649_100051804 | 221 |
| 195 | 3300025924 | Ga0207694_10046537 | Ga0207694_100465371 | 221 |
| 196 | 3300025932 | Ga0207690_10007386 | Ga0207690_100073866 | 221 |
| 197 | 3300025944 | Ga0207661_10000257 | Ga0207661_1000025721 | 221 |
| 198 | 3300026023 | Ga0207677_10260856 | Ga0207677_102608563 | 221 |
| 199 | 3300026078 | Ga0207702_10140545 | Ga0207702_101405452 | 221 |
| 200 | 3300026089 | Ga0207648_10281220 | Ga0207648_102812202 | 221 |
| 201 | 3300026118 | Ga0207675_100348927 | Ga0207675_1003489273 | 221 |
| 202 | 3300026142 | Ga0207698_10102191 | Ga0207698_101021912 | 221 |
| 203 | 3300027907 | Ga0207428_10413686 | Ga0207428_104136862 | 221 |
| 204 | 3300031548 | Ga0307408_100019186 | Ga0307408_1000191863 | 221 |
| 205 | 3300031731 | Ga0307405_10430904 | Ga0307405_104309042 | 221 |
| 206 | 3300031824 | Ga0307413_10045441 | Ga0307413_100454412 | 221 |
| 207 | 3300031852 | Ga0307410_10028533 | Ga0307410_100285332 | 221 |
| 208 | 3300031889 | Ga0326468_10009913 | Ga0326468_100099132 | 221 |
| 209 | 3300031901 | Ga0307406_10018824 | Ga0307406_100188242 | 221 |
| 210 | 3300031911 | Ga0307412_10043606 | Ga0307412_100436063 | 221 |
| 211 | 3300031995 | Ga0307409_100048169 | Ga0307409_1000481693 | 221 |
| 212 | 3300032002 | Ga0307416_100332626 | Ga0307416_1003326262 | 221 |
| 213 | 3300032005 | Ga0307411_10031138 | Ga0307411_100311383 | 221 |
| 214 | 3300045976 | Ga0466967_0049172 | Ga0466967_0049172_1196_1867 | 221 |
| 215 | 3300003203 | JGI25406J46586_10014311 | JGI25406J46586_100143113 | 222 |
| 216 | 3300003203 | JGI25406J46586_10059428 | JGI25406J46586_100594282 | 222 |
| 217 | 3300005548 | Ga0070665_100000312 | Ga0070665_10000031264 | 222 |
| 218 | 3300005985 | Ga0081539_10009632 | Ga0081539_100096326 | 222 |
| 219 | 3300005985 | Ga0081539_10050056 | Ga0081539_100500562 | 222 |
| 220 | 3300025944 | Ga0207661_10356508 | Ga0207661_103565081 | 222 |
| 221 | 3300025944 | Ga0207661_10366621 | Ga0207661_103666212 | 222 |
| 222 | 3300028379 | Ga0268266_10013842 | Ga0268266_100138426 | 222 |
| 223 | 3300031824 | Ga0307413_10150524 | Ga0307413_101505242 | 222 |
| 224 | 3300031911 | Ga0307412_10101283 | Ga0307412_101012832 | 222 |
| 225 | 3300031995 | Ga0307409_100005209 | Ga0307409_1000052095 | 222 |
| 226 | 3300032126 | Ga0307415_100309244 | Ga0307415_1003092442 | 222 |
| 227 | 3300046515 | Ga0495620_0114469 | Ga0495620_0114469_21_692 | 222 |
| 228 | 3300048908 | Ga0496105_0593699 | Ga0496105_0593699_75_749 | 222 |
| 229 | 3300048912 | Ga0496109_0442547 | Ga0496109_0442547_39_710 | 222 |
| 230 | 3300050507 | nmdc:mga05p37_853472_c1 | nmdc:mga05p37_853472_c1_285_956 | 222 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lhu-assembly1.cif.gz_A | crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp | 0.9615 | 13 | 202 |
| 7lhs-assembly2.cif.gz_B | crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps | 0.94 | 13 | 204 |
| 7lhs-assembly1.cif.gz_A | crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps | 0.9394 | 13 | 202 |
| 7lhu-assembly2.cif.gz_B | crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp | 0.9339 | 13 | 204 |
| 6vpu-assembly8.cif.gz_H | 1.90 angstrom resolution crystal structure phosphoadenosine phosphosulfate reductase (cysh) from vibrio vulnificus | 0.9249 | 13 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P17854_2_216_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9264 | 13 | 198 | 3.40.50.620 |
| 2goyE00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9213 | 13 | 202 | 3.40.50.620 |
| 4bwvB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8958 | 18 | 202 | 3.40.50.620 |
| af_Q60377_225_441_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8928 | 17 | 200 | 3.40.50.620 |
| af_P9WIK3_10_254_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8691 | 13 | 222 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A061NLW8-F1-model_v4 | Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) | 0.9804 | 13 | 201 |
GO:0004604
GO:0005737 GO:0019379 GO:0043866 GO:0046872 GO:0051539 GO:0070814 |
| AF-A0A2T2SKD0-F1-model_v4 | Phosphoadenylyl-sulfate reductase | 0.9793 | 13 | 197 |
GO:0004604
GO:0005737 GO:0019379 |
| AF-A0A838PTG6-F1-model_v4 | Phosphoadenosine phosphosulfate reductase family protein | 0.9788 | 10 | 170 |
GO:0004604
GO:0005737 GO:0019379 |
| AF-A0A7V8YQ67-F1-model_v4 | Phosphoadenosine phosphosulfate reductase family protein | 0.9757 | 11 | 119 |
GO:0004604
GO:0005737 GO:0019379 |
| AF-A0A2V9Q655-F1-model_v4 | Phosphoadenosine phosphosulfate reductase | 0.9679 | 54 | 160 |
GO:0004604
GO:0005737 GO:0019379 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar