F343220

General Info

Members Datasets Scaffolds Average Seq Length
230 149 460 381

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0148023|Ga0395898_0148023_193_1533
Length 434
Sequence MKAHRLLVVPGLVLLLAGGWALAQTQTITQTTAEAPASPRPVVTVPGMPPVIDPTNLYSETSAGKMSPAVEGALRRIYVPNRRSNSVTVIDPDTMRVVDTFKVGRNPQHVVPSWDLKRLWVANNAEGRTDGSLTPIDPLTGRPGPSIAVDDPYNLYWTPDGKYAIVVAEEHKRLDFRDPHTMKPIFSIKAPKCGGINHADFSIDGRYAIFTCEFEGAVTKIDMTNFTVVGTLVLTPFYQRPDVVAQFQEIVAEKKPAPIIDASELGGAICATWGMPQDVRISPDGKLFYVADMLADGVHVVDGASFRQVGFIATGIGAHGLYPSRDGKFLYVANRGTNKLFGPRHGKGSVSVIDFATQKVVQTWPIPGGGSPDMGNVSADGKYLWLSGRFDDVVYRINTASGAVDQIKVGREPHGLAVWPQPGRYSLGHTGNMR

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
138 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.04
Nodule 0
Rhizoplane 0.43
Rhizosphere 93.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0148023 3300037466 Bacteria 2247
2 JGI25162J39368_1000868 3300002737 Bacteria 19808
3 Ga0055540_1015926 3300003792 Bacteria 2163
4 Ga0055531_10003171 3300003794 Bacteria 10577
5 Ga0070676_10002579 3300005328 Bacteria 9318
6 Ga0070676_10018791 3300005328 Bacteria 3835
7 Ga0070670_100000922 3300005331 Bacteria 23101
8 Ga0070670_100105617 3300005331 Bacteria 2426
9 Ga0070677_10001555 3300005333 Bacteria 7271
10 Ga0068868_100178568 3300005338 Bacteria 1760
11 Ga0070661_100149991 3300005344 Bacteria 1762
12 Ga0070692_10117776 3300005345 Bacteria 1477
13 Ga0070668_100001300 3300005347 Bacteria 17854
14 Ga0070668_100018431 3300005347 Bacteria 5241
15 Ga0070668_100090132 3300005347 Bacteria 2416
16 Ga0070669_100001506 3300005353 Bacteria 16829
17 Ga0070675_100002462 3300005354 Bacteria 13840
18 Ga0070671_100001155 3300005355 Bacteria 19642
19 Ga0070671_100017039 3300005355 Bacteria 5877
20 Ga0070674_100003068 3300005356 Bacteria 9296
21 Ga0070673_100002837 3300005364 Bacteria 10666
22 Ga0070673_100069289 3300005364 Bacteria 2826
23 Ga0070659_100264914 3300005366 Bacteria 1426
24 Ga0070667_100000636 3300005367 Bacteria 34113
25 Ga0070667_100198497 3300005367 Bacteria 1780
26 Ga0070714_100217566 3300005435 Bacteria 1754
27 Ga0070708_100000133 3300005445 Bacteria 50894
28 Ga0070663_100000519 3300005455 Bacteria 20322
29 Ga0070663_100076822 3300005455 Bacteria 2443
30 Ga0070678_100000956 3300005456 Bacteria 14865
31 Ga0070678_100008778 3300005456 Bacteria 6073
32 Ga0070678_100032315 3300005456 Bacteria 3621
33 Ga0070662_100042323 3300005457 Bacteria 3253
34 Ga0068867_100016329 3300005459 Bacteria 5271
35 Ga0068867_100045532 3300005459 Bacteria 3218
36 Ga0070706_100181928 3300005467 Bacteria 1963
37 Ga0070679_100197857 3300005530 Bacteria 1976
38 Ga0068853_100003171 3300005539 Bacteria 12569
39 Ga0070672_100000249 3300005543 Bacteria 30273
40 Ga0070672_100002449 3300005543 Bacteria 11783
41 Ga0070672_100022792 3300005543 Bacteria 4606
42 Ga0070672_100219505 3300005543 Bacteria 1594
43 Ga0070665_100005198 3300005548 Bacteria 13464
44 Ga0070664_100103854 3300005564 Bacteria 2474
45 Ga0070664_100175224 3300005564 Bacteria 1904
46 Ga0068857_100006174 3300005577 Bacteria 10244
47 Ga0068854_100180723 3300005578 Bacteria 1648
48 Ga0068852_100024207 3300005616 Bacteria 4904
49 Ga0068852_100059575 3300005616 Bacteria 3311
50 Ga0068852_100139935 3300005616 Bacteria 2238
51 Ga0068859_100179479 3300005617 Bacteria 2200
52 Ga0068859_100271298 3300005617 Bacteria 1789
53 Ga0068851_10000780 3300005834 Bacteria 13724
54 Ga0068863_100009450 3300005841 Bacteria 9515
55 Ga0068858_100019811 3300005842 Bacteria 6289
56 Ga0068860_100003703 3300005843 Bacteria 15733
57 Ga0068860_100012941 3300005843 Bacteria 8196
58 Ga0068860_100030958 3300005843 Bacteria 5145
59 Ga0068860_100199636 3300005843 Bacteria 1938
60 Ga0068862_100003340 3300005844 Bacteria 13852
61 Ga0081455_10003964 3300005937 Bacteria 16801
62 Ga0081539_10027698 3300005985 Bacteria 3583
63 Ga0075365_10013513 3300006038 Bacteria 4887
64 Ga0097621_100006060 3300006237 Bacteria 8549
65 Ga0097621_100050417 3300006237 Bacteria 3385
66 Ga0068871_100015827 3300006358 Bacteria 5660
67 Ga0068871_100034339 3300006358 Bacteria 4024
68 Ga0068871_100066055 3300006358 Bacteria 2964
69 Ga0075428_100338253 3300006844 Bacteria 1616
70 Ga0075433_10084797 3300006852 Bacteria 2796
71 Ga0075429_100074612 3300006880 Bacteria 2954
72 Ga0068865_100211853 3300006881 Bacteria 1510
73 Ga0097620_100179481 3300006931 Bacteria 2200
74 Ga0097620_100271300 3300006931 Bacteria 1789
75 Ga0075435_100184825 3300007076 Bacteria 1762
76 Ga0111539_10053497 3300009094 Bacteria 4805
77 Ga0111539_10511978 3300009094 Bacteria 1398
78 Ga0114129_10024980 3300009147 Bacteria 8470
79 Ga0114129_10040161 3300009147 Bacteria 6596
80 Ga0114129_10144752 3300009147 Bacteria 3256
81 Ga0114129_10177542 3300009147 Bacteria 2900
82 Ga0105243_10146061 3300009148 Bacteria 2023
83 Ga0105241_10179927 3300009174 Bacteria 1753
84 Ga0105248_10435183 3300009177 Bacteria 1477
85 Ga0157374_10056851 3300013296 Bacteria 3653
86 Ga0157378_10007418 3300013297 Bacteria 9583
87 Ga0163162_10170818 3300013306 Bacteria 2299
88 Ga0157372_10230516 3300013307 Bacteria 2147
89 Ga0157375_10006652 3300013308 Bacteria 10062
90 Ga0157375_10251983 3300013308 Bacteria 1926
91 Ga0157377_10000235 3300014745 Bacteria 28671
92 Ga0157379_10183566 3300014968 Bacteria 1890
93 Ga0157376_10006992 3300014969 Bacteria 8006
94 Ga0157376_10041895 3300014969 Bacteria 3751
95 Ga0213872_10000164 3300021361 Bacteria 60317
96 Ga0213875_10000008 3300021388 Bacteria 533344
97 Ga0213875_10004185 3300021388 Bacteria 7982
98 Ga0209672_100596 3300025228 Bacteria 19013
99 Ga0209051_1000136 3300025303 Bacteria 138015
100 Ga0209257_1000055 3300025304 Bacteria 415534
101 Ga0207656_10017335 3300025321 Bacteria 2819
102 Ga0207682_10003031 3300025893 Bacteria 7370
103 Ga0207682_10005109 3300025893 Bacteria 5376
104 Ga0207682_10020493 3300025893 Bacteria 2596
105 Ga0207645_10000368 3300025907 Bacteria 37407
106 Ga0207645_10013147 3300025907 Bacteria 5590
107 Ga0207643_10001557 3300025908 Bacteria 13058
108 Ga0207684_10077313 3300025910 Bacteria 2830
109 Ga0207662_10032008 3300025918 Bacteria 3058
110 Ga0207650_10005476 3300025925 Bacteria 8664
111 Ga0207650_10094527 3300025925 Bacteria 2290
112 Ga0207700_10296860 3300025928 Bacteria 1394
113 Ga0207664_10223628 3300025929 Bacteria 1634
114 Ga0207644_10000462 3300025931 Bacteria 26318
115 Ga0207644_10017326 3300025931 Bacteria 4863
116 Ga0207706_10006055 3300025933 Bacteria 11247
117 Ga0207669_10061356 3300025937 Bacteria 2310
118 Ga0207665_10029797 3300025939 Bacteria 3606
119 Ga0207691_10003266 3300025940 Bacteria 15790
120 Ga0207691_10004984 3300025940 Bacteria 12808
121 Ga0207691_10006532 3300025940 Bacteria 11257
122 Ga0207691_10012028 3300025940 Bacteria 8301
123 Ga0207691_10029862 3300025940 Bacteria 5098
124 Ga0207711_10005935 3300025941 Bacteria 10322
125 Ga0207668_10026038 3300025972 Bacteria 3793
126 Ga0207668_10043537 3300025972 Bacteria 3047
127 Ga0207640_10026828 3300025981 Bacteria 3503
128 Ga0207658_10010685 3300025986 Bacteria 6239
129 Ga0207703_10001182 3300026035 Bacteria 24519
130 Ga0207703_10223687 3300026035 Bacteria 1684
131 Ga0207678_10001014 3300026067 Bacteria 25612
132 Ga0207678_10073695 3300026067 Bacteria 2926
133 Ga0207702_10129627 3300026078 Bacteria 2268
134 Ga0207641_10006430 3300026088 Bacteria 9903
135 Ga0207641_10018532 3300026088 Bacteria 5708
136 Ga0207641_10232638 3300026088 Bacteria 1713
137 Ga0207648_10011657 3300026089 Bacteria 8274
138 Ga0207648_10021393 3300026089 Bacteria 5814
139 Ga0207648_10064537 3300026089 Bacteria 3191
140 Ga0207648_10081050 3300026089 Bacteria 2831
141 Ga0207648_10135185 3300026089 Bacteria 2172
142 Ga0207676_10010929 3300026095 Bacteria 6478
143 Ga0207676_10077652 3300026095 Bacteria 2687
144 Ga0207674_10017197 3300026116 Bacteria 7890
145 Ga0207675_100018183 3300026118 Bacteria 6554
146 Ga0207675_100061211 3300026118 Bacteria 3515
147 Ga0207683_10000133 3300026121 Bacteria 61157
148 Ga0207683_10031486 3300026121 Bacteria 4604
149 Ga0207683_10054918 3300026121 Bacteria 3493
150 Ga0207698_10016315 3300026142 Bacteria 5003
151 Ga0207698_10056473 3300026142 Bacteria 3032
152 Ga0207698_10082327 3300026142 Bacteria 2601
153 Ga0207428_10020581 3300027907 Bacteria 5603
154 Ga0207428_10123824 3300027907 Bacteria 1981
155 Ga0268266_10006170 3300028379 Bacteria 11019
156 Ga0268265_10004033 3300028380 Bacteria 10339
157 Ga0268264_10000629 3300028381 Bacteria 41961
158 Ga0268264_10020044 3300028381 Bacteria 5464
159 Ga0268264_10123185 3300028381 Bacteria 2288
160 Ga0307405_10007014 3300031731 Bacteria 5600
161 Ga0307413_10090147 3300031824 Bacteria 1994
162 Ga0307410_10012156 3300031852 Bacteria 4962
163 Ga0307406_10017586 3300031901 Bacteria 4165
164 Ga0307406_10124527 3300031901 Bacteria 1798
165 Ga0307412_10013904 3300031911 Bacteria 4732
166 Ga0307409_100004124 3300031995 Bacteria 8086
167 Ga0307409_100006577 3300031995 Bacteria 6851
168 Ga0307416_100114512 3300032002 Bacteria 2386
169 Ga0307416_100137531 3300032002 Bacteria 2213
170 Ga0307411_10021424 3300032005 Bacteria 3782
171 Ga0307411_10100387 3300032005 Bacteria 2045
172 Ga0307411_10239692 3300032005 Bacteria 1419
173 Ga0307415_100079308 3300032126 Bacteria 2338
174 Ga0307415_100223104 3300032126 Bacteria 1512
175 Ga0373945_0057980 3300035116 Bacteria 1440
176 Ga0373924_0022056 3300035410 Bacteria 2487
177 Ga0373931_0041472 3300035691 Bacteria 2418
178 Ga0373935_0040104 3300035692 Bacteria 2938
179 Ga0373937_0046482 3300036401 Bacteria 3970
180 Ga0395899_0050940 3300037312 Bacteria 3073
181 Ga0395900_0004805 3300037418 Bacteria 14232
182 Ga0395898_0186186 3300037466 Bacteria 1984
183 Ga0395898_0308523 3300037466 Bacteria 1509
184 Ga0395905_0015881 3300037471 Bacteria 7152
185 Ga0395905_0199223 3300037471 Bacteria 1877
186 Ga0436364_0214612 3300037853 Bacteria 30361
187 Ga0436364_1415525 3300037853 Bacteria 425173
188 Ga0395901_0011587 3300038443 Bacteria 8934
189 Ga0395901_0014922 3300038443 Bacteria 7894
190 Ga0436365_1046947 3300039437 Bacteria 2629
191 Ga0436361_0167314 3300039447 Bacteria 59578
192 Ga0466966_0052937 3300044684 Bacteria 2577
193 Ga0495638_0000343 3300046460 Bacteria 58771
194 Ga0495645_0033236 3300046543 Bacteria 3763
195 Ga0495645_0165078 3300046543 Bacteria 1528
196 Ga0495625_0088769 3300046660 Bacteria 2141
197 Ga0495635_0043354 3300046663 Bacteria 3105
198 Ga0495647_0001897 3300046681 Bacteria 6507
199 Ga0495674_0011779 3300047319 Bacteria 8247
200 Ga0495686_0000282 3300047472 Bacteria 89471
201 Ga0496104_0327223 3300048907 Bacteria 1446
202 Ga0501034_0164297 3300049571 Bacteria 2189
203 Ga0501036_0071749 3300049572 Bacteria 2928
204 Ga0501043_0000112 3300049579 Bacteria 76249
205 Ga0501043_0052295 3300049579 Bacteria 3209
206 Ga0501046_0000146 3300049580 Bacteria 74204
207 Ga0501047_0000192 3300049581 Bacteria 74300
208 Ga0501047_0294039 3300049581 Bacteria 1467
209 Ga0501048_0000494 3300049582 Bacteria 27525
210 Ga0501262_002061 3300049759 Bacteria 2269
211 Ga0501265_002619 3300049762 Bacteria 2038
212 Ga0501035_0064761 3300049822 Bacteria 3248
213 Ga0501035_0072000 3300049822 Bacteria 3060
214 Ga0501044_0002875 3300049823 Bacteria 19600
215 Ga0501044_0065728 3300049823 Bacteria 3698
216 Ga0501044_0077005 3300049823 Bacteria 3383
217 Ga0501044_0146991 3300049823 Bacteria 2342
218 Ga0501045_0009798 3300049824 Bacteria 6702
219 nmdc:mga05p37_211877_c1 3300050507 Bacteria 2342
220 nmdc:mga05p37_47969_c1 3300050507 Bacteria 5253
221 nmdc:mga09592_66781_c1 3300050508 Bacteria 3049
222 nmdc:mga0qj67_122095_c1 3300050509 Bacteria 2108
223 nmdc:mga08y16_125862_c1 3300050511 Bacteria 2666
224 nmdc:mga08y16_140785_c1 3300050511 Bacteria 2508
225 nmdc:mga08y16_60946_c1 3300050511 Bacteria 3940
226 nmdc:mga0n895_28027_c1 3300050512 Bacteria 5355
227 nmdc:mga0a205_3150_c1 3300050515 Bacteria 5178
228 nmdc:mga0a205_31685_c1 3300050515 Bacteria 5067
229 Ga0495619_0254477 3300053085 Bacteria 1217
230 3003002612 3002998708 Bacteria 11715108
231 Ga0395898_0148023
232 JGI25162J39368_1000868
233 Ga0055540_1015926
234 Ga0055531_10003171
235 Ga0070676_10002579
236 Ga0070676_10018791
237 Ga0070670_100000922
238 Ga0070670_100105617
239 Ga0070677_10001555
240 Ga0068868_100178568
241 Ga0070661_100149991
242 Ga0070692_10117776
243 Ga0070668_100001300
244 Ga0070668_100018431
245 Ga0070668_100090132
246 Ga0070669_100001506
247 Ga0070675_100002462
248 Ga0070671_100001155
249 Ga0070671_100017039
250 Ga0070674_100003068
251 Ga0070673_100002837
252 Ga0070673_100069289
253 Ga0070659_100264914
254 Ga0070667_100000636
255 Ga0070667_100198497
256 Ga0070714_100217566
257 Ga0070708_100000133
258 Ga0070663_100000519
259 Ga0070663_100076822
260 Ga0070678_100000956
261 Ga0070678_100008778
262 Ga0070678_100032315
263 Ga0070662_100042323
264 Ga0068867_100016329
265 Ga0068867_100045532
266 Ga0070706_100181928
267 Ga0070679_100197857
268 Ga0068853_100003171
269 Ga0070672_100000249
270 Ga0070672_100002449
271 Ga0070672_100022792
272 Ga0070672_100219505
273 Ga0070665_100005198
274 Ga0070664_100103854
275 Ga0070664_100175224
276 Ga0068857_100006174
277 Ga0068854_100180723
278 Ga0068852_100024207
279 Ga0068852_100059575
280 Ga0068852_100139935
281 Ga0068859_100179479
282 Ga0068859_100271298
283 Ga0068851_10000780
284 Ga0068863_100009450
285 Ga0068858_100019811
286 Ga0068860_100003703
287 Ga0068860_100012941
288 Ga0068860_100030958
289 Ga0068860_100199636
290 Ga0068862_100003340
291 Ga0081455_10003964
292 Ga0081539_10027698
293 Ga0075365_10013513
294 Ga0097621_100006060
295 Ga0097621_100050417
296 Ga0068871_100015827
297 Ga0068871_100034339
298 Ga0068871_100066055
299 Ga0075428_100338253
300 Ga0075433_10084797
301 Ga0075429_100074612
302 Ga0068865_100211853
303 Ga0097620_100179481
304 Ga0097620_100271300
305 Ga0075435_100184825
306 Ga0111539_10053497
307 Ga0111539_10511978
308 Ga0114129_10024980
309 Ga0114129_10040161
310 Ga0114129_10144752
311 Ga0114129_10177542
312 Ga0105243_10146061
313 Ga0105241_10179927
314 Ga0105248_10435183
315 Ga0157374_10056851
316 Ga0157378_10007418
317 Ga0163162_10170818
318 Ga0157372_10230516
319 Ga0157375_10006652
320 Ga0157375_10251983
321 Ga0157377_10000235
322 Ga0157379_10183566
323 Ga0157376_10006992
324 Ga0157376_10041895
325 Ga0213872_10000164
326 Ga0213875_10000008
327 Ga0213875_10004185
328 Ga0209672_100596
329 Ga0209051_1000136
330 Ga0209257_1000055
331 Ga0207656_10017335
332 Ga0207682_10003031
333 Ga0207682_10005109
334 Ga0207682_10020493
335 Ga0207645_10000368
336 Ga0207645_10013147
337 Ga0207643_10001557
338 Ga0207684_10077313
339 Ga0207662_10032008
340 Ga0207650_10005476
341 Ga0207650_10094527
342 Ga0207700_10296860
343 Ga0207664_10223628
344 Ga0207644_10000462
345 Ga0207644_10017326
346 Ga0207706_10006055
347 Ga0207669_10061356
348 Ga0207665_10029797
349 Ga0207691_10003266
350 Ga0207691_10004984
351 Ga0207691_10006532
352 Ga0207691_10012028
353 Ga0207691_10029862
354 Ga0207711_10005935
355 Ga0207668_10026038
356 Ga0207668_10043537
357 Ga0207640_10026828
358 Ga0207658_10010685
359 Ga0207703_10001182
360 Ga0207703_10223687
361 Ga0207678_10001014
362 Ga0207678_10073695
363 Ga0207702_10129627
364 Ga0207641_10006430
365 Ga0207641_10018532
366 Ga0207641_10232638
367 Ga0207648_10011657
368 Ga0207648_10021393
369 Ga0207648_10064537
370 Ga0207648_10081050
371 Ga0207648_10135185
372 Ga0207676_10010929
373 Ga0207676_10077652
374 Ga0207674_10017197
375 Ga0207675_100018183
376 Ga0207675_100061211
377 Ga0207683_10000133
378 Ga0207683_10031486
379 Ga0207683_10054918
380 Ga0207698_10016315
381 Ga0207698_10056473
382 Ga0207698_10082327
383 Ga0207428_10020581
384 Ga0207428_10123824
385 Ga0268266_10006170
386 Ga0268265_10004033
387 Ga0268264_10000629
388 Ga0268264_10020044
389 Ga0268264_10123185
390 Ga0307405_10007014
391 Ga0307413_10090147
392 Ga0307410_10012156
393 Ga0307406_10017586
394 Ga0307406_10124527
395 Ga0307412_10013904
396 Ga0307409_100004124
397 Ga0307409_100006577
398 Ga0307416_100114512
399 Ga0307416_100137531
400 Ga0307411_10021424
401 Ga0307411_10100387
402 Ga0307411_10239692
403 Ga0307415_100079308
404 Ga0307415_100223104
405 Ga0373945_0057980
406 Ga0373924_0022056
407 Ga0373931_0041472
408 Ga0373935_0040104
409 Ga0373937_0046482
410 Ga0395899_0050940
411 Ga0395900_0004805
412 Ga0395898_0186186
413 Ga0395898_0308523
414 Ga0395905_0015881
415 Ga0395905_0199223
416 Ga0436364_0214612
417 Ga0436364_1415525
418 Ga0395901_0011587
419 Ga0395901_0014922
420 Ga0436365_1046947
421 Ga0436361_0167314
422 Ga0466966_0052937
423 Ga0495638_0000343
424 Ga0495645_0033236
425 Ga0495645_0165078
426 Ga0495625_0088769
427 Ga0495635_0043354
428 Ga0495647_0001897
429 Ga0495674_0011779
430 Ga0495686_0000282
431 Ga0496104_0327223
432 Ga0501034_0164297
433 Ga0501036_0071749
434 Ga0501043_0000112
435 Ga0501043_0052295
436 Ga0501046_0000146
437 Ga0501047_0000192
438 Ga0501047_0294039
439 Ga0501048_0000494
440 Ga0501262_002061
441 Ga0501265_002619
442 Ga0501035_0064761
443 Ga0501035_0072000
444 Ga0501044_0002875
445 Ga0501044_0065728
446 Ga0501044_0077005
447 Ga0501044_0146991
448 Ga0501045_0009798
449 nmdc:mga05p37_211877_c1
450 nmdc:mga05p37_47969_c1
451 nmdc:mga09592_66781_c1
452 nmdc:mga0qj67_122095_c1
453 nmdc:mga08y16_125862_c1
454 nmdc:mga08y16_140785_c1
455 nmdc:mga08y16_60946_c1
456 nmdc:mga0n895_28027_c1
457 nmdc:mga0a205_3150_c1
458 nmdc:mga0a205_31685_c1
459 Ga0495619_0254477
460 3003002612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21783

YNCE

YNCE-like beta-propeller

262

422

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l0q-assembly3.cif.gz_C tandem yvtn beta-propeller and pkd domains from an archaeal surface layer protein 0.8722 68 382
6r5z-assembly2.cif.gz_E 9-bladed beta-propeller formed by three 3-bladed fragments 0.8546 192 320
7som-assembly1.cif.gz_R ciliary c2 central pair apparatus isolated from chlamydomonas reinhardtii 0.8509 89 370
6kiv-assembly1.cif.gz_R cryo-em structure of human mll1-ubncp complex (4.0 angstrom) 0.845 147 368
7bid-assembly1.cif.gz_A crystal structure of v31wrap-t, a 7-bladed designer protein 0.8423 69 373
ID Description Score Start End Superfamily
af_P42841_71_212_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9117 148 266 2.130.10.10
af_Q9UTN4_49_196_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.9095 148 259 2.40.128.630
af_Q79FU0_283_386_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9058 222 323 2.40.10.500
1l0qD01 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8975 68 372 2.130.10.10
af_Q9VNG2_130_262_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.884 148 264 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A511BR65-F1-model_v4 YNCE-like beta-propeller domain-containing protein 0.9952 28 391
AF-A0A536URS9-F1-model_v4 YncE family protein 0.9942 71 391
AF-A0A4Y3TVR2-F1-model_v4 YNCE-like beta-propeller domain-containing protein 0.9941 33 391
AF-A0A511B1N5-F1-model_v4 YNCE-like beta-propeller domain-containing protein 0.9939 33 391
AF-A0A4Y6VBD0-F1-model_v4 YncE family protein 0.9935 28 391

Map