F343207

General Info

Members Datasets Scaffolds Average Seq Length
230 163 217 225

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0048806|Ga0316582_0048806_64_855
Length 263
Sequence VAARRQSVAQPAAKERIMTAKKPPRGGALSGRGGRSLNQRVKKGRGLKNSSRRWIERQINDPYVQRAKAEGMRSRAAYKLIEIDDKHHILKKGDRVIDLGAAPGGWCQVAAVRVGSTNEDKRIAAIDYLEMDPMPGVEVLQMDFLDDDAPQKLIEALGGKPDVVVSDMAAPTIGHRQTDHLRTMHLIEVAADFAVRVLKPGGHFLAKTFQGGTEKDLLDLLKRNFKSVIHIKPPSSRSESVELYIVAKDFKGHGGDEDSPAHG

Samples

Sample ID Description Type Environment
1 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
4 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
5 2751185800 Brucella pituitosa AA2 Isolate Unclassified
6 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
7 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
8 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
9 2854911287 Brucella lupini LUP21 Isolate Unclassified
10 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
11 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
12 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
13 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
114 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
124 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
133 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
134 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
159 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.91
Metatranscriptomes 0.43
Isolates 5.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.78
Nodule 3.04
Rhizoplane 0.87
Rhizosphere 86.09
Stem 0
Stem Tuber 0
Unclassified 5.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1003904 3300003578 Bacteria 2870
2 Ga0065715_10181314 3300005293 Bacteria 1474
3 Ga0070658_10006297 3300005327 Bacteria 9614
4 Ga0070658_10022523 3300005327 Bacteria 5055
5 Ga0068869_100051675 3300005334 Bacteria 2981
6 Ga0068869_100286436 3300005334 Bacteria 1326
7 Ga0070666_10013230 3300005335 Bacteria 5231
8 Ga0070680_100147845 3300005336 Bacteria 1972
9 Ga0070660_100020834 3300005339 Bacteria 4826
10 Ga0070660_100206183 3300005339 Bacteria 1595
11 Ga0070691_10002845 3300005341 Bacteria 7743
12 Ga0070692_10014129 3300005345 Bacteria 3739
13 Ga0070667_100516445 3300005367 Bacteria 1096
14 Ga0070709_10001059 3300005434 Bacteria 15182
15 Ga0070709_10055634 3300005434 Bacteria 2499
16 Ga0070714_100285735 3300005435 Bacteria 1534
17 Ga0070714_100373875 3300005435 Bacteria 1342
18 Ga0070714_100378479 3300005435 Bacteria 1334
19 Ga0070714_100428072 3300005435 Bacteria 1254
20 Ga0070713_100000041 3300005436 Bacteria 80753
21 Ga0070713_100711070 3300005436 Bacteria 959
22 Ga0070711_100650716 3300005439 Bacteria 883
23 Ga0070663_100014704 3300005455 Bacteria 5029
24 Ga0068853_100000937 3300005539 Bacteria 20429
25 Ga0070696_100304821 3300005546 Bacteria 1221
26 Ga0070693_100042405 3300005547 Bacteria 2564
27 Ga0070693_100116865 3300005547 Bacteria 1649
28 Ga0068855_100087670 3300005563 Bacteria 3596
29 Ga0068857_100025531 3300005577 Bacteria 5202
30 Ga0068854_100106400 3300005578 Bacteria 2110
31 Ga0068856_100000274 3300005614 Bacteria 56135
32 Ga0068856_100014242 3300005614 Bacteria 7689
33 Ga0068852_100027707 3300005616 Bacteria 4622
34 Ga0068859_100884159 3300005617 Bacteria 979
35 Ga0068861_100175822 3300005719 Bacteria 1778
36 Ga0068858_100243368 3300005842 Bacteria 1707
37 Ga0068860_100571432 3300005843 Bacteria 1134
38 Ga0075365_10006288 3300006038 Bacteria 6517
39 Ga0075365_10369347 3300006038 Bacteria 1012
40 Ga0075363_100007572 3300006048 Bacteria 5003
41 Ga0075364_10051732 3300006051 Bacteria 2683
42 Ga0070716_100193754 3300006173 Bacteria 1345
43 Ga0070712_100000494 3300006175 Bacteria 22527
44 Ga0070712_100001638 3300006175 Bacteria 13689
45 Ga0070712_100750079 3300006175 Bacteria 835
46 Ga0097621_100073697 3300006237 Bacteria 2827
47 Ga0068871_100195930 3300006358 Bacteria 1742
48 Ga0075434_100157789 3300006871 Bacteria 2288
49 Ga0075436_100000023 3300006914 Bacteria 116796
50 Ga0075436_100180573 3300006914 Bacteria 1491
51 Ga0075436_100307939 3300006914 Bacteria 1136
52 Ga0097620_100884167 3300006931 Bacteria 979
53 Ga0105240_10010987 3300009093 Bacteria 12678
54 Ga0105245_10043582 3300009098 Bacteria 4002
55 Ga0105241_10066238 3300009174 Bacteria 2793
56 Ga0105241_10094778 3300009174 Bacteria 2361
57 Ga0105241_10245708 3300009174 Bacteria 1515
58 Ga0105241_10283239 3300009174 Bacteria 1416
59 Ga0105248_10000001 3300009177 Bacteria 1881304
60 Ga0105248_10019949 3300009177 Bacteria 7422
61 Ga0105237_10033153 3300009545 Bacteria 5232
62 Ga0105238_10006836 3300009551 Bacteria 11387
63 Ga0105239_10030655 3300010375 Bacteria 5915
64 Ga0157373_10026508 3300013100 Bacteria 4185
65 Ga0157371_10506619 3300013102 Bacteria 892
66 Ga0157370_10005670 3300013104 Bacteria 13955
67 Ga0157370_10086197 3300013104 Bacteria 2951
68 Ga0157374_10046390 3300013296 Bacteria 4024
69 Ga0157378_10040417 3300013297 Bacteria 4136
70 Ga0157378_10063653 3300013297 Bacteria 3296
71 Ga0157375_10479844 3300013308 Bacteria 1408
72 Ga0157379_10000463 3300014968 Bacteria 32854
73 Ga0157379_10005410 3300014968 Bacteria 10965
74 Ga0157379_10028589 3300014968 Bacteria 4958
75 Ga0157379_10055543 3300014968 Bacteria 3538
76 Ga0157379_10065317 3300014968 Bacteria 3253
77 Ga0163161_10436637 3300017792 Bacteria 1056
78 Ga0207680_10001436 3300025903 Bacteria 11286
79 Ga0207647_10102996 3300025904 Bacteria 1693
80 Ga0207699_10000126 3300025906 Bacteria 53299
81 Ga0207699_10115556 3300025906 Bacteria 1727
82 Ga0207699_10116600 3300025906 Bacteria 1720
83 Ga0207705_10002534 3300025909 Bacteria 14069
84 Ga0207654_10032866 3300025911 Bacteria 2871
85 Ga0207654_10109459 3300025911 Bacteria 1716
86 Ga0207695_10009051 3300025913 Bacteria 12374
87 Ga0207695_10224273 3300025913 Bacteria 1786
88 Ga0207693_10000295 3300025915 Bacteria 46423
89 Ga0207693_10002826 3300025915 Bacteria 15037
90 Ga0207663_10238217 3300025916 Bacteria 1333
91 Ga0207657_10006637 3300025919 Bacteria 11976
92 Ga0207657_10009509 3300025919 Bacteria 9761
93 Ga0207694_10039175 3300025924 Bacteria 3647
94 Ga0207687_10569715 3300025927 Bacteria 952
95 Ga0207700_10000010 3300025928 Bacteria 298473
96 Ga0207664_10316340 3300025929 Unclassified 1377
97 Ga0207644_10588562 3300025931 Bacteria 923
98 Ga0207706_10214341 3300025933 Bacteria 1687
99 Ga0207665_10027671 3300025939 Bacteria 3746
100 Ga0207711_10000002 3300025941 Bacteria 1228676
101 Ga0207667_10006962 3300025949 Bacteria 13669
102 Ga0207640_10296012 3300025981 Bacteria 1278
103 Ga0207677_10133210 3300026023 Bacteria 1891
104 Ga0207703_10028227 3300026035 Bacteria 4422
105 Ga0207639_10050353 3300026041 Bacteria 3163
106 Ga0207702_10000013 3300026078 Bacteria 257468
107 Ga0207641_10485945 3300026088 Bacteria 1197
108 Ga0207674_10000887 3300026116 Bacteria 39121
109 Ga0207675_100232707 3300026118 Bacteria 1778
110 Ga0209813_10021359 3300027866 Bacteria 1819
111 Ga0268264_10491234 3300028381 Bacteria 1196
112 Ga0265318_10001720 3300028577 Bacteria 12528
113 Ga0265338_10012084 3300028800 Bacteria 9871
114 Ga0265338_10064482 3300028800 Bacteria 3185
115 Ga0265338_10101585 3300028800 Bacteria 2341
116 Ga0265328_10124359 3300031239 Bacteria 963
117 Ga0265325_10000325 3300031241 Bacteria 33683
118 Ga0265325_10000829 3300031241 Bacteria 22407
119 Ga0265325_10155672 3300031241 Bacteria 1078
120 Ga0265325_10156888 3300031241 Bacteria 1073
121 Ga0265340_10000115 3300031247 Bacteria 39225
122 Ga0265340_10002893 3300031247 Bacteria 9774
123 Ga0265340_10020531 3300031247 Bacteria 3394
124 Ga0265339_10002615 3300031249 Bacteria 12846
125 Ga0265339_10045523 3300031249 Bacteria 2414
126 Ga0265331_10010347 3300031250 Bacteria 5167
127 Ga0265316_10011441 3300031344 Bacteria 8002
128 Ga0265316_10034448 3300031344 Bacteria 4113
129 Ga0265313_10001462 3300031595 Bacteria 22045
130 Ga0265314_10002766 3300031711 Bacteria 17519
131 Ga0265314_10026538 3300031711 Bacteria 4351
132 Ga0265314_10046446 3300031711 Bacteria 3064
133 Ga0265342_10075432 3300031712 Bacteria 1956
134 Ga0265342_10151472 3300031712 Bacteria 1287
135 Ga0307405_10338931 3300031731 Bacteria 1155
136 Ga0307413_10001473 3300031824 Bacteria 8951
137 Ga0307407_10002560 3300031903 Bacteria 7154
138 Ga0307412_10097143 3300031911 Bacteria 2075
139 Ga0307409_100038615 3300031995 Bacteria 3533
140 Ga0307414_10065019 3300032004 Bacteria 2600
141 Ga0307411_10016758 3300032005 Bacteria 4154
142 Ga0307415_100009544 3300032126 Bacteria 5447
143 Ga0373944_0039855 3300035089 Bacteria 1448
144 Ga0373941_0217088 3300035115 Bacteria 734
145 Ga0373956_0207037 3300035119 Bacteria 930
146 Ga0373956_0235589 3300035119 Bacteria 870
147 Ga0373943_0010273 3300035170 Bacteria 4199
148 Ga0373955_0216168 3300035172 Bacteria 1144
149 Ga0373935_0033580 3300035692 Bacteria 3194
150 Ga0373927_0115655 3300035695 Bacteria 1749
151 Ga0373933_0356286 3300035724 Bacteria 951
152 Ga0373947_0018177 3300035725 Bacteria 4045
153 Ga0373937_0015355 3300036401 Bacteria 6773
154 Ga0373937_0024732 3300036401 Bacteria 5420
155 Ga0373937_0038465 3300036401 Bacteria 4359
156 Ga0373937_0063848 3300036401 Bacteria 3387
157 Ga0373937_0365246 3300036401 Bacteria 1368
158 Ga0316582_0048806 3300036647 Bacteria 2677
159 Ga0316584_0326387 3300036712 Bacteria 1106
160 Ga0373925_0003490 3300037068 Bacteria 12150
161 Ga0373925_0045432 3300037068 Bacteria 3263
162 Ga0373925_0393741 3300037068 Bacteria 1129
163 Ga0395899_0002597 3300037312 Bacteria 14556
164 Ga0395899_0011688 3300037312 Bacteria 6719
165 Ga0395900_0000777 3300037418 Bacteria 42484
166 Ga0395900_0041795 3300037418 Bacteria 4724
167 Ga0395898_0016277 3300037466 Bacteria 7610
168 Ga0395898_0021176 3300037466 Bacteria 6596
169 Ga0395905_0050455 3300037471 Bacteria 3898
170 Ga0395905_0083490 3300037471 Bacteria 2992
171 Ga0395901_0000260 3300038443 Bacteria 66084
172 Ga0395901_0033659 3300038443 Bacteria 5291
173 Ga0436365_1478984 3300039437 Bacteria 1157
174 Ga0439465_0026577 3300041413 Bacteria 1831
175 Ga0451793_1742545 3300041452 Bacteria 1047
176 Ga0439432_011367 3300042006 Bacteria 3069
177 Ga0495670_0216713 3300046691 Bacteria 1016
178 Ga0496104_0590137 3300048907 Bacteria 1021
179 Ga0496119_0021585 3300048922 Bacteria 4644
180 Ga0496122_0006309 3300048925 Bacteria 13664
181 Ga0496123_0017640 3300048926 Bacteria 5730
182 Ga0496125_0128822 3300048928 Bacteria 1786
183 Ga0496126_0001557 3300048929 Bacteria 35204
184 Ga0501033_0068481 3300049570 Bacteria 2609
185 Ga0501033_0188770 3300049570 Bacteria 1475
186 Ga0501034_0092122 3300049571 Bacteria 3028
187 Ga0501038_0394000 3300049574 Bacteria 1072
188 Ga0501067_0002006 3300049583 Bacteria 11215
189 Ga0501068_0190487 3300049584 Bacteria 1299
190 Ga0501070_0102631 3300049586 Bacteria 2365
191 Ga0501072_0685284 3300049588 Bacteria 806
192 Ga0501074_0098623 3300049590 Bacteria 2091
193 Ga0501076_0029487 3300049592 Bacteria 4267
194 Ga0501076_0706474 3300049592 Bacteria 832
195 Ga0501083_0078262 3300049744 Bacteria 2193
196 Ga0501083_0146404 3300049744 Bacteria 1547
197 Ga0501035_0048277 3300049822 Bacteria 3818
198 Ga0501035_0172919 3300049822 Bacteria 1865
199 Ga0501044_0084107 3300049823 Bacteria 3216
200 Ga0501044_0131433 3300049823 Bacteria 2497
201 nmdc:mga00v17_32365_c1 3300050491 Bacteria 3090
202 nmdc:mga0yw44_519308_c1 3300050492 Bacteria 808
203 nmdc:mga08x19_270141_c1 3300050514 Bacteria 1177
204 nmdc:mga08x19_284638_c1 3300050514 Bacteria 1146
205 nmdc:mga08x19_50_c1 3300050514 Bacteria 129410
206 Ga0495619_0269931 3300053085 Bacteria 1179
207 Ga0500643_000014 3300053087 Bacteria 318249
208 Ga0500644_0270691 3300053088 Bacteria 721
209 Ga0500568_0035510 3300053139 Bacteria 2034
210 Ga0500645_071408 3300053730 Bacteria 996
211 Ga0501084_0037930 3300054114 Bacteria 4027
212 Ga0501084_0269803 3300054114 Bacteria 1437
213 Ga0501084_0353354 3300054114 Bacteria 1241
214 Ga0501084_0609488 3300054114 Bacteria 922
215 Ga0501082_0052116 3300060353 Bacteria 3527
216 Ga0501082_0055706 3300060353 Bacteria 3405
217 Ga0501082_0163309 3300060353 Bacteria 1935

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10101585 Ga0265338_101015852 191
2 3300031241 Ga0265325_10000325 Ga0265325_1000032534 191
3 3300031249 Ga0265339_10002615 Ga0265339_1000261511 191
4 3300031344 Ga0265316_10011441 Ga0265316_100114412 191
5 3300031595 Ga0265313_10001462 Ga0265313_100014628 191
6 3300031712 Ga0265342_10151472 Ga0265342_101514722 191
7 3300035115 Ga0373941_0217088 Ga0373941_0217088_32_667 199
8 3300005334 Ga0068869_100051675 Ga0068869_1000516753 201
9 3300009174 Ga0105241_10283239 Ga0105241_102832392 201
10 3300025933 Ga0207706_10214341 Ga0207706_102143412 202
11 3300031731 Ga0307405_10338931 Ga0307405_103389312 202
12 3300031824 Ga0307413_10001473 Ga0307413_100014737 202
13 3300031903 Ga0307407_10002560 Ga0307407_100025604 202
14 3300031911 Ga0307412_10097143 Ga0307412_100971432 202
15 3300031995 Ga0307409_100038615 Ga0307409_1000386154 202
16 3300032004 Ga0307414_10065019 Ga0307414_100650192 202
17 3300032005 Ga0307411_10016758 Ga0307411_100167582 202
18 3300032126 Ga0307415_100009544 Ga0307415_1000095442 202
19 3300053730 Ga0500645_071408 Ga0500645_071408_251_907 202
20 3300035119 Ga0373956_0235589 Ga0373956_0235589_203_847 203
21 3300048929 Ga0496126_0001557 Ga0496126_0001557_8194_8838 204
22 3300014968 Ga0157379_10028589 Ga0157379_100285892 205
23 3300037068 Ga0373925_0045432 Ga0373925_0045432_566_1249 205
24 3300048907 Ga0496104_0590137 Ga0496104_0590137_85_768 205
25 3300035724 Ga0373933_0356286 Ga0373933_0356286_260_919 206
26 3300036401 Ga0373937_0024732 Ga0373937_0024732_1590_2249 206
27 3300028800 Ga0265338_10064482 Ga0265338_100644823 207
28 3300053088 Ga0500644_0270691 Ga0500644_0270691_46_711 207
29 3300005293 Ga0065715_10181314 Ga0065715_101813142 209
30 3300005327 Ga0070658_10006297 Ga0070658_100062973 209
31 3300005339 Ga0070660_100206183 Ga0070660_1002061831 209
32 3300005345 Ga0070692_10014129 Ga0070692_100141295 209
33 3300005455 Ga0070663_100014704 Ga0070663_1000147045 209
34 3300013102 Ga0157371_10506619 Ga0157371_105066192 209
35 3300025904 Ga0207647_10102996 Ga0207647_101029962 209
36 3300025909 Ga0207705_10002534 Ga0207705_1000253417 209
37 3300025919 Ga0207657_10009509 Ga0207657_1000950910 209
38 3300031711 Ga0265314_10046446 Ga0265314_100464464 209
39 3300035172 Ga0373955_0216168 Ga0373955_0216168_92_787 209
40 3300037312 Ga0395899_0002597 Ga0395899_0002597_6036_6698 209
41 3300037312 Ga0395899_0011688 Ga0395899_0011688_974_1657 209
42 3300037418 Ga0395900_0000777 Ga0395900_0000777_13837_14499 209
43 3300037418 Ga0395900_0041795 Ga0395900_0041795_1300_1983 209
44 3300037466 Ga0395898_0016277 Ga0395898_0016277_3583_4266 209
45 3300037466 Ga0395898_0021176 Ga0395898_0021176_2107_2769 209
46 3300037471 Ga0395905_0050455 Ga0395905_0050455_2984_3643 209
47 3300037471 Ga0395905_0083490 Ga0395905_0083490_1470_2153 209
48 3300038443 Ga0395901_0000260 Ga0395901_0000260_9882_10544 209
49 3300038443 Ga0395901_0033659 Ga0395901_0033659_1407_2090 209
50 3300042006 Ga0439432_011367 Ga0439432_011367_2385_3041 209
51 3300005327 Ga0070658_10022523 Ga0070658_100225236 210
52 3300005339 Ga0070660_100020834 Ga0070660_1000208343 210
53 3300006175 Ga0070712_100750079 Ga0070712_1007500791 210
54 3300013104 Ga0157370_10086197 Ga0157370_100861972 210
55 3300025919 Ga0207657_10006637 Ga0207657_100066374 210
56 iso_pu_bacteria 2513237094 2513640661 211
57 iso_pu_bacteria 2513237098 2513674449 211
58 iso_pu_bacteria 2517093001 2517102817 211
59 iso_pu_bacteria 2617270741 2617375522 211
60 iso_pu_bacteria 2824746037 2824746561 211
61 iso_pu_bacteria 2849076700 2849079092 211
62 iso_pu_bacteria 2908775508 2908780413 211
63 iso_pu_bacteria 2941531003 2941533040 211
64 iso_pu_bacteria 3005718088 3005722529 211
65 3300014968 Ga0157379_10000463 Ga0157379_1000046329 212
66 3300025931 Ga0207644_10588562 Ga0207644_105885621 212
67 3300049571 Ga0501034_0092122 Ga0501034_0092122_571_1242 212
68 3300049822 Ga0501035_0172919 Ga0501035_0172919_1129_1800 212
69 3300036401 Ga0373937_0063848 Ga0373937_0063848_2020_2691 213
70 3300053085 Ga0495619_0269931 Ga0495619_0269931_37_708 213
71 3300005336 Ga0070680_100147845 Ga0070680_1001478453 214
72 3300005341 Ga0070691_10002845 Ga0070691_100028456 214
73 3300005434 Ga0070709_10001059 Ga0070709_100010599 214
74 3300005434 Ga0070709_10055634 Ga0070709_100556342 214
75 3300005435 Ga0070714_100285735 Ga0070714_1002857351 214
76 3300005435 Ga0070714_100378479 Ga0070714_1003784792 214
77 3300005435 Ga0070714_100428072 Ga0070714_1004280722 214
78 3300005436 Ga0070713_100000041 Ga0070713_10000004173 214
79 3300005436 Ga0070713_100711070 Ga0070713_1007110702 214
80 3300005539 Ga0068853_100000937 Ga0068853_10000093719 214
81 3300005546 Ga0070696_100304821 Ga0070696_1003048212 214
82 3300005547 Ga0070693_100042405 Ga0070693_1000424053 214
83 3300005547 Ga0070693_100116865 Ga0070693_1001168652 214
84 3300005563 Ga0068855_100087670 Ga0068855_1000876703 214
85 3300005577 Ga0068857_100025531 Ga0068857_1000255313 214
86 3300005578 Ga0068854_100106400 Ga0068854_1001064002 214
87 3300005614 Ga0068856_100000274 Ga0068856_1000002744 214
88 3300005614 Ga0068856_100014242 Ga0068856_1000142428 214
89 3300005616 Ga0068852_100027707 Ga0068852_1000277076 214
90 3300005842 Ga0068858_100243368 Ga0068858_1002433682 214
91 3300005843 Ga0068860_100571432 Ga0068860_1005714322 214
92 3300006173 Ga0070716_100193754 Ga0070716_1001937542 214
93 3300006175 Ga0070712_100000494 Ga0070712_10000049418 214
94 3300006175 Ga0070712_100001638 Ga0070712_1000016385 214
95 3300006358 Ga0068871_100195930 Ga0068871_1001959303 214
96 3300006871 Ga0075434_100157789 Ga0075434_1001577892 214
97 3300006914 Ga0075436_100000023 Ga0075436_10000002381 214
98 3300006914 Ga0075436_100180573 Ga0075436_1001805731 214
99 3300006914 Ga0075436_100307939 Ga0075436_1003079392 214
100 3300009093 Ga0105240_10010987 Ga0105240_1001098710 214
101 3300009098 Ga0105245_10043582 Ga0105245_100435824 214
102 3300009174 Ga0105241_10066238 Ga0105241_100662382 214
103 3300009174 Ga0105241_10245708 Ga0105241_102457082 214
104 3300009545 Ga0105237_10033153 Ga0105237_100331534 214
105 3300009551 Ga0105238_10006836 Ga0105238_100068368 214
106 3300010375 Ga0105239_10030655 Ga0105239_100306553 214
107 3300013100 Ga0157373_10026508 Ga0157373_100265082 214
108 3300013104 Ga0157370_10005670 Ga0157370_100056706 214
109 3300013296 Ga0157374_10046390 Ga0157374_100463903 214
110 3300013297 Ga0157378_10040417 Ga0157378_100404175 214
111 3300014968 Ga0157379_10005410 Ga0157379_100054108 214
112 3300014968 Ga0157379_10065317 Ga0157379_100653173 214
113 3300025906 Ga0207699_10000126 Ga0207699_1000012642 214
114 3300025906 Ga0207699_10115556 Ga0207699_101155563 214
115 3300025906 Ga0207699_10116600 Ga0207699_101166002 214
116 3300025911 Ga0207654_10032866 Ga0207654_100328663 214
117 3300025911 Ga0207654_10109459 Ga0207654_101094592 214
118 3300025913 Ga0207695_10009051 Ga0207695_100090513 214
119 3300025915 Ga0207693_10000295 Ga0207693_1000029541 214
120 3300025915 Ga0207693_10002826 Ga0207693_100028265 214
121 3300025916 Ga0207663_10238217 Ga0207663_102382172 214
122 3300025924 Ga0207694_10039175 Ga0207694_100391752 214
123 3300025927 Ga0207687_10569715 Ga0207687_105697152 214
124 3300025928 Ga0207700_10000010 Ga0207700_10000010101 214
125 3300025929 Ga0207664_10316340 Ga0207664_103163402 214
126 3300025939 Ga0207665_10027671 Ga0207665_100276712 214
127 3300025949 Ga0207667_10006962 Ga0207667_1000696211 214
128 3300025981 Ga0207640_10296012 Ga0207640_102960122 214
129 3300026035 Ga0207703_10028227 Ga0207703_100282272 214
130 3300026041 Ga0207639_10050353 Ga0207639_100503534 214
131 3300026078 Ga0207702_10000013 Ga0207702_10000013186 214
132 3300026088 Ga0207641_10485945 Ga0207641_104859452 214
133 3300026116 Ga0207674_10000887 Ga0207674_100008874 214
134 3300028381 Ga0268264_10491234 Ga0268264_104912342 214
135 3300028800 Ga0265338_10012084 Ga0265338_100120846 214
136 3300031241 Ga0265325_10155672 Ga0265325_101556721 214
137 3300031247 Ga0265340_10000115 Ga0265340_1000011514 214
138 3300031247 Ga0265340_10002893 Ga0265340_100028932 214
139 3300031344 Ga0265316_10034448 Ga0265316_100344486 214
140 3300031711 Ga0265314_10026538 Ga0265314_100265382 214
141 3300031712 Ga0265342_10075432 Ga0265342_100754323 214
142 3300035119 Ga0373956_0207037 Ga0373956_0207037_218_913 214
143 3300036401 Ga0373937_0015355 Ga0373937_0015355_1239_1934 214
144 3300036401 Ga0373937_0038465 Ga0373937_0038465_829_1512 214
145 3300036401 Ga0373937_0365246 Ga0373937_0365246_267_938 214
146 3300037068 Ga0373925_0393741 Ga0373925_0393741_326_1015 214
147 3300049570 Ga0501033_0068481 Ga0501033_0068481_413_1084 214
148 3300049823 Ga0501044_0131433 Ga0501044_0131433_430_1101 214
149 3300050514 nmdc:mga08x19_270141_c1 nmdc:mga08x19_270141_c1_147_836 214
150 3300050514 nmdc:mga08x19_284638_c1 nmdc:mga08x19_284638_c1_240_944 214
151 3300050514 nmdc:mga08x19_50_c1 nmdc:mga08x19_50_c1_48139_48813 214
152 3300053087 Ga0500643_000014 Ga0500643_000014_84070_84747 214
153 3300005439 Ga0070711_100650716 Ga0070711_1006507161 215
154 3300006237 Ga0097621_100073697 Ga0097621_1000736972 215
155 3300009174 Ga0105241_10094778 Ga0105241_100947782 215
156 3300013297 Ga0157378_10063653 Ga0157378_100636533 215
157 3300013308 Ga0157375_10479844 Ga0157375_104798442 215
158 3300014968 Ga0157379_10055543 Ga0157379_100555434 215
159 3300026023 Ga0207677_10133210 Ga0207677_101332103 215
160 3300041452 Ga0451793_1742545 Ga0451793_1742545_38_733 215
161 3300053139 Ga0500568_0035510 Ga0500568_0035510_78_767 215
162 3300031239 Ga0265328_10124359 Ga0265328_101243592 216
163 3300031241 Ga0265325_10000829 Ga0265325_100008293 216
164 3300031247 Ga0265340_10020531 Ga0265340_100205312 216
165 3300031249 Ga0265339_10045523 Ga0265339_100455234 216
166 3300031250 Ga0265331_10010347 Ga0265331_100103476 216
167 3300031711 Ga0265314_10002766 Ga0265314_100027668 216
168 3300005435 Ga0070714_100373875 Ga0070714_1003738752 217
169 3300009177 Ga0105248_10000001 Ga0105248_10000001268 217
170 3300025913 Ga0207695_10224273 Ga0207695_102242732 217
171 3300025941 Ga0207711_10000002 Ga0207711_10000002969 217
172 3300028577 Ga0265318_10001720 Ga0265318_100017206 217
173 3300031241 Ga0265325_10156888 Ga0265325_101568881 217
174 3300035089 Ga0373944_0039855 Ga0373944_0039855_11_703 217
175 3300035170 Ga0373943_0010273 Ga0373943_0010273_763_1455 217
176 3300035692 Ga0373935_0033580 Ga0373935_0033580_1143_1835 217
177 3300035695 Ga0373927_0115655 Ga0373927_0115655_1012_1704 217
178 3300035725 Ga0373947_0018177 Ga0373947_0018177_632_1324 217
179 3300037068 Ga0373925_0003490 Ga0373925_0003490_10675_11367 217
180 3300039437 Ga0436365_1478984 Ga0436365_1478984_48_728 217
181 3300005334 Ga0068869_100286436 Ga0068869_1002864361 218
182 3300005335 Ga0070666_10013230 Ga0070666_100132301 218
183 3300005617 Ga0068859_100884159 Ga0068859_1008841592 218
184 3300006931 Ga0097620_100884167 Ga0097620_1008841672 218
185 3300009177 Ga0105248_10019949 Ga0105248_100199495 218
186 3300025903 Ga0207680_10001436 Ga0207680_100014362 218
187 3300049570 Ga0501033_0188770 Ga0501033_0188770_120_803 218
188 3300049574 Ga0501038_0394000 Ga0501038_0394000_364_1047 218
189 3300049583 Ga0501067_0002006 Ga0501067_0002006_6968_7654 218
190 3300049588 Ga0501072_0685284 Ga0501072_0685284_83_772 218
191 3300049592 Ga0501076_0029487 Ga0501076_0029487_1559_2248 218
192 3300049592 Ga0501076_0706474 Ga0501076_0706474_99_785 218
193 3300049744 Ga0501083_0078262 Ga0501083_0078262_1390_2076 218
194 3300049822 Ga0501035_0048277 Ga0501035_0048277_1349_2032 218
195 3300049823 Ga0501044_0084107 Ga0501044_0084107_924_1607 218
196 3300054114 Ga0501084_0269803 Ga0501084_0269803_330_1019 218
197 3300054114 Ga0501084_0353354 Ga0501084_0353354_311_997 218
198 3300054114 Ga0501084_0609488 Ga0501084_0609488_22_711 218
199 3300060353 Ga0501082_0052116 Ga0501082_0052116_1018_1707 218
200 3300060353 Ga0501082_0055706 Ga0501082_0055706_1697_2383 218
201 3300049584 Ga0501068_0190487 Ga0501068_0190487_248_961 220
202 3300049586 Ga0501070_0102631 Ga0501070_0102631_1129_1842 220
203 3300054114 Ga0501084_0037930 Ga0501084_0037930_982_1695 220
204 3300060353 Ga0501082_0163309 Ga0501082_0163309_397_1110 220
205 iso_pu_bacteria 2839993093 2839994339 220
206 iso_pu_bacteria 2894652903 2894655285 220
207 3300049590 Ga0501074_0098623 Ga0501074_0098623_247_963 221
208 3300049744 Ga0501083_0146404 Ga0501083_0146404_516_1235 222
209 3300005367 Ga0070667_100516445 Ga0070667_1005164451 223
210 3300005719 Ga0068861_100175822 Ga0068861_1001758222 223
211 3300006038 Ga0075365_10006288 Ga0075365_100062884 223
212 3300006048 Ga0075363_100007572 Ga0075363_1000075723 223
213 3300006051 Ga0075364_10051732 Ga0075364_100517322 223
214 3300017792 Ga0163161_10436637 Ga0163161_104366371 223
215 3300026118 Ga0207675_100232707 Ga0207675_1002327073 223
216 3300027866 Ga0209813_10021359 Ga0209813_100213591 223
217 3300050491 nmdc:mga00v17_32365_c1 nmdc:mga00v17_32365_c1_682_1383 223
218 3300006038 Ga0075365_10369347 Ga0075365_103693471 224
219 3300041413 Ga0439465_0026577 Ga0439465_0026577_1076_1777 224
220 3300046691 Ga0495670_0216713 Ga0495670_0216713_57_764 224
221 3300050492 nmdc:mga0yw44_519308_c1 nmdc:mga0yw44_519308_c1_45_782 224
222 3300036647 Ga0316582_0048806 Ga0316582_0048806_64_855 226
223 3300036712 Ga0316584_0326387 Ga0316584_0326387_245_985 226
224 iso_pu_bacteria 2751185800 2753358121 227
225 iso_pu_bacteria 2854911287 2854916372 227
226 3300003578 Ga0006562J51391_1003904 Ga0006562J51391_10039043 231
227 3300048922 Ga0496119_0021585 Ga0496119_0021585_3688_4410 231
228 3300048925 Ga0496122_0006309 Ga0496122_0006309_12919_13641 231
229 3300048926 Ga0496123_0017640 Ga0496123_0017640_2557_3279 231
230 3300048928 Ga0496125_0128822 Ga0496125_0128822_229_951 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

72

250

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8etc-assembly1.cif.gz_w fkbp39 associated nascent 60s ribosome state 4 0.9096 49 230
8fkv-assembly1.cif.gz_SJ human nucleolar pre-60s ribosomal subunit (state d1) 0.9014 49 229
8fkw-assembly1.cif.gz_SJ human nucleolar pre-60s ribosomal subunit (state d2) 0.9013 49 229
7o9m-assembly1.cif.gz_n human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1 and the malsu module 0.9003 35 231
8esq-assembly1.cif.gz_w ytm1 associated nascent 60s ribosome state 2 0.8972 49 230
ID Description Score Start End Superfamily
af_P78860_27_218_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.915 60 231 3.40.50.150
af_Q58771_22_215_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9107 60 230 3.40.50.150
af_Q9VDT6_58_249_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9077 60 231 3.40.50.150
af_Q4CQP4_20_264_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9031 60 229 3.40.50.150
af_Q9VEP1_20_211_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9021 60 229 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2P1P706-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.952 54 230 GO:0005737
GO:0008650
AF-A0A6A5LFF6-F1-model_v4 deleted 0.9351 32 231
AF-A0A537WKP4-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9339 122 231 GO:0008650
AF-A0A0P7IDY6-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9333 33 230 GO:0005737
GO:0008650
AF-A0A529FBI4-F1-model_v4 Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) 0.9324 66 178 GO:0008650

Feature Viewer

pLDDT pTM Quality
84.06 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map