F343207
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 230 | 163 | 217 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300036647|Ga0316582_0048806|Ga0316582_0048806_64_855 |
| Length | 263 |
| Sequence | VAARRQSVAQPAAKERIMTAKKPPRGGALSGRGGRSLNQRVKKGRGLKNSSRRWIERQINDPYVQRAKAEGMRSRAAYKLIEIDDKHHILKKGDRVIDLGAAPGGWCQVAAVRVGSTNEDKRIAAIDYLEMDPMPGVEVLQMDFLDDDAPQKLIEALGGKPDVVVSDMAAPTIGHRQTDHLRTMHLIEVAADFAVRVLKPGGHFLAKTFQGGTEKDLLDLLKRNFKSVIHIKPPSSRSESVELYIVAKDFKGHGGDEDSPAHG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 4 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 5 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 6 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 7 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 8 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 9 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 10 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 11 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 12 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 13 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 14 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 42 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 43 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 44 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 95 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 97 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 98 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 99 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 100 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 101 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 102 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 103 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 105 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 106 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 107 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 108 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 109 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 110 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 111 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 112 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 113 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 114 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 115 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 116 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 117 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 118 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 119 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 120 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 121 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 122 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 124 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 125 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 127 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 128 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 129 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 130 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 133 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 134 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 135 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 137 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 138 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 139 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 140 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 141 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 142 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 155 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 156 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 159 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 160 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 161 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 162 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.91 |
| Metatranscriptomes | 0.43 |
| Isolates | 5.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.78 |
| Nodule | 3.04 |
| Rhizoplane | 0.87 |
| Rhizosphere | 86.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006562J51391_1003904 | 3300003578 | Bacteria | 2870 |
| 2 | Ga0065715_10181314 | 3300005293 | Bacteria | 1474 |
| 3 | Ga0070658_10006297 | 3300005327 | Bacteria | 9614 |
| 4 | Ga0070658_10022523 | 3300005327 | Bacteria | 5055 |
| 5 | Ga0068869_100051675 | 3300005334 | Bacteria | 2981 |
| 6 | Ga0068869_100286436 | 3300005334 | Bacteria | 1326 |
| 7 | Ga0070666_10013230 | 3300005335 | Bacteria | 5231 |
| 8 | Ga0070680_100147845 | 3300005336 | Bacteria | 1972 |
| 9 | Ga0070660_100020834 | 3300005339 | Bacteria | 4826 |
| 10 | Ga0070660_100206183 | 3300005339 | Bacteria | 1595 |
| 11 | Ga0070691_10002845 | 3300005341 | Bacteria | 7743 |
| 12 | Ga0070692_10014129 | 3300005345 | Bacteria | 3739 |
| 13 | Ga0070667_100516445 | 3300005367 | Bacteria | 1096 |
| 14 | Ga0070709_10001059 | 3300005434 | Bacteria | 15182 |
| 15 | Ga0070709_10055634 | 3300005434 | Bacteria | 2499 |
| 16 | Ga0070714_100285735 | 3300005435 | Bacteria | 1534 |
| 17 | Ga0070714_100373875 | 3300005435 | Bacteria | 1342 |
| 18 | Ga0070714_100378479 | 3300005435 | Bacteria | 1334 |
| 19 | Ga0070714_100428072 | 3300005435 | Bacteria | 1254 |
| 20 | Ga0070713_100000041 | 3300005436 | Bacteria | 80753 |
| 21 | Ga0070713_100711070 | 3300005436 | Bacteria | 959 |
| 22 | Ga0070711_100650716 | 3300005439 | Bacteria | 883 |
| 23 | Ga0070663_100014704 | 3300005455 | Bacteria | 5029 |
| 24 | Ga0068853_100000937 | 3300005539 | Bacteria | 20429 |
| 25 | Ga0070696_100304821 | 3300005546 | Bacteria | 1221 |
| 26 | Ga0070693_100042405 | 3300005547 | Bacteria | 2564 |
| 27 | Ga0070693_100116865 | 3300005547 | Bacteria | 1649 |
| 28 | Ga0068855_100087670 | 3300005563 | Bacteria | 3596 |
| 29 | Ga0068857_100025531 | 3300005577 | Bacteria | 5202 |
| 30 | Ga0068854_100106400 | 3300005578 | Bacteria | 2110 |
| 31 | Ga0068856_100000274 | 3300005614 | Bacteria | 56135 |
| 32 | Ga0068856_100014242 | 3300005614 | Bacteria | 7689 |
| 33 | Ga0068852_100027707 | 3300005616 | Bacteria | 4622 |
| 34 | Ga0068859_100884159 | 3300005617 | Bacteria | 979 |
| 35 | Ga0068861_100175822 | 3300005719 | Bacteria | 1778 |
| 36 | Ga0068858_100243368 | 3300005842 | Bacteria | 1707 |
| 37 | Ga0068860_100571432 | 3300005843 | Bacteria | 1134 |
| 38 | Ga0075365_10006288 | 3300006038 | Bacteria | 6517 |
| 39 | Ga0075365_10369347 | 3300006038 | Bacteria | 1012 |
| 40 | Ga0075363_100007572 | 3300006048 | Bacteria | 5003 |
| 41 | Ga0075364_10051732 | 3300006051 | Bacteria | 2683 |
| 42 | Ga0070716_100193754 | 3300006173 | Bacteria | 1345 |
| 43 | Ga0070712_100000494 | 3300006175 | Bacteria | 22527 |
| 44 | Ga0070712_100001638 | 3300006175 | Bacteria | 13689 |
| 45 | Ga0070712_100750079 | 3300006175 | Bacteria | 835 |
| 46 | Ga0097621_100073697 | 3300006237 | Bacteria | 2827 |
| 47 | Ga0068871_100195930 | 3300006358 | Bacteria | 1742 |
| 48 | Ga0075434_100157789 | 3300006871 | Bacteria | 2288 |
| 49 | Ga0075436_100000023 | 3300006914 | Bacteria | 116796 |
| 50 | Ga0075436_100180573 | 3300006914 | Bacteria | 1491 |
| 51 | Ga0075436_100307939 | 3300006914 | Bacteria | 1136 |
| 52 | Ga0097620_100884167 | 3300006931 | Bacteria | 979 |
| 53 | Ga0105240_10010987 | 3300009093 | Bacteria | 12678 |
| 54 | Ga0105245_10043582 | 3300009098 | Bacteria | 4002 |
| 55 | Ga0105241_10066238 | 3300009174 | Bacteria | 2793 |
| 56 | Ga0105241_10094778 | 3300009174 | Bacteria | 2361 |
| 57 | Ga0105241_10245708 | 3300009174 | Bacteria | 1515 |
| 58 | Ga0105241_10283239 | 3300009174 | Bacteria | 1416 |
| 59 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 60 | Ga0105248_10019949 | 3300009177 | Bacteria | 7422 |
| 61 | Ga0105237_10033153 | 3300009545 | Bacteria | 5232 |
| 62 | Ga0105238_10006836 | 3300009551 | Bacteria | 11387 |
| 63 | Ga0105239_10030655 | 3300010375 | Bacteria | 5915 |
| 64 | Ga0157373_10026508 | 3300013100 | Bacteria | 4185 |
| 65 | Ga0157371_10506619 | 3300013102 | Bacteria | 892 |
| 66 | Ga0157370_10005670 | 3300013104 | Bacteria | 13955 |
| 67 | Ga0157370_10086197 | 3300013104 | Bacteria | 2951 |
| 68 | Ga0157374_10046390 | 3300013296 | Bacteria | 4024 |
| 69 | Ga0157378_10040417 | 3300013297 | Bacteria | 4136 |
| 70 | Ga0157378_10063653 | 3300013297 | Bacteria | 3296 |
| 71 | Ga0157375_10479844 | 3300013308 | Bacteria | 1408 |
| 72 | Ga0157379_10000463 | 3300014968 | Bacteria | 32854 |
| 73 | Ga0157379_10005410 | 3300014968 | Bacteria | 10965 |
| 74 | Ga0157379_10028589 | 3300014968 | Bacteria | 4958 |
| 75 | Ga0157379_10055543 | 3300014968 | Bacteria | 3538 |
| 76 | Ga0157379_10065317 | 3300014968 | Bacteria | 3253 |
| 77 | Ga0163161_10436637 | 3300017792 | Bacteria | 1056 |
| 78 | Ga0207680_10001436 | 3300025903 | Bacteria | 11286 |
| 79 | Ga0207647_10102996 | 3300025904 | Bacteria | 1693 |
| 80 | Ga0207699_10000126 | 3300025906 | Bacteria | 53299 |
| 81 | Ga0207699_10115556 | 3300025906 | Bacteria | 1727 |
| 82 | Ga0207699_10116600 | 3300025906 | Bacteria | 1720 |
| 83 | Ga0207705_10002534 | 3300025909 | Bacteria | 14069 |
| 84 | Ga0207654_10032866 | 3300025911 | Bacteria | 2871 |
| 85 | Ga0207654_10109459 | 3300025911 | Bacteria | 1716 |
| 86 | Ga0207695_10009051 | 3300025913 | Bacteria | 12374 |
| 87 | Ga0207695_10224273 | 3300025913 | Bacteria | 1786 |
| 88 | Ga0207693_10000295 | 3300025915 | Bacteria | 46423 |
| 89 | Ga0207693_10002826 | 3300025915 | Bacteria | 15037 |
| 90 | Ga0207663_10238217 | 3300025916 | Bacteria | 1333 |
| 91 | Ga0207657_10006637 | 3300025919 | Bacteria | 11976 |
| 92 | Ga0207657_10009509 | 3300025919 | Bacteria | 9761 |
| 93 | Ga0207694_10039175 | 3300025924 | Bacteria | 3647 |
| 94 | Ga0207687_10569715 | 3300025927 | Bacteria | 952 |
| 95 | Ga0207700_10000010 | 3300025928 | Bacteria | 298473 |
| 96 | Ga0207664_10316340 | 3300025929 | Unclassified | 1377 |
| 97 | Ga0207644_10588562 | 3300025931 | Bacteria | 923 |
| 98 | Ga0207706_10214341 | 3300025933 | Bacteria | 1687 |
| 99 | Ga0207665_10027671 | 3300025939 | Bacteria | 3746 |
| 100 | Ga0207711_10000002 | 3300025941 | Bacteria | 1228676 |
| 101 | Ga0207667_10006962 | 3300025949 | Bacteria | 13669 |
| 102 | Ga0207640_10296012 | 3300025981 | Bacteria | 1278 |
| 103 | Ga0207677_10133210 | 3300026023 | Bacteria | 1891 |
| 104 | Ga0207703_10028227 | 3300026035 | Bacteria | 4422 |
| 105 | Ga0207639_10050353 | 3300026041 | Bacteria | 3163 |
| 106 | Ga0207702_10000013 | 3300026078 | Bacteria | 257468 |
| 107 | Ga0207641_10485945 | 3300026088 | Bacteria | 1197 |
| 108 | Ga0207674_10000887 | 3300026116 | Bacteria | 39121 |
| 109 | Ga0207675_100232707 | 3300026118 | Bacteria | 1778 |
| 110 | Ga0209813_10021359 | 3300027866 | Bacteria | 1819 |
| 111 | Ga0268264_10491234 | 3300028381 | Bacteria | 1196 |
| 112 | Ga0265318_10001720 | 3300028577 | Bacteria | 12528 |
| 113 | Ga0265338_10012084 | 3300028800 | Bacteria | 9871 |
| 114 | Ga0265338_10064482 | 3300028800 | Bacteria | 3185 |
| 115 | Ga0265338_10101585 | 3300028800 | Bacteria | 2341 |
| 116 | Ga0265328_10124359 | 3300031239 | Bacteria | 963 |
| 117 | Ga0265325_10000325 | 3300031241 | Bacteria | 33683 |
| 118 | Ga0265325_10000829 | 3300031241 | Bacteria | 22407 |
| 119 | Ga0265325_10155672 | 3300031241 | Bacteria | 1078 |
| 120 | Ga0265325_10156888 | 3300031241 | Bacteria | 1073 |
| 121 | Ga0265340_10000115 | 3300031247 | Bacteria | 39225 |
| 122 | Ga0265340_10002893 | 3300031247 | Bacteria | 9774 |
| 123 | Ga0265340_10020531 | 3300031247 | Bacteria | 3394 |
| 124 | Ga0265339_10002615 | 3300031249 | Bacteria | 12846 |
| 125 | Ga0265339_10045523 | 3300031249 | Bacteria | 2414 |
| 126 | Ga0265331_10010347 | 3300031250 | Bacteria | 5167 |
| 127 | Ga0265316_10011441 | 3300031344 | Bacteria | 8002 |
| 128 | Ga0265316_10034448 | 3300031344 | Bacteria | 4113 |
| 129 | Ga0265313_10001462 | 3300031595 | Bacteria | 22045 |
| 130 | Ga0265314_10002766 | 3300031711 | Bacteria | 17519 |
| 131 | Ga0265314_10026538 | 3300031711 | Bacteria | 4351 |
| 132 | Ga0265314_10046446 | 3300031711 | Bacteria | 3064 |
| 133 | Ga0265342_10075432 | 3300031712 | Bacteria | 1956 |
| 134 | Ga0265342_10151472 | 3300031712 | Bacteria | 1287 |
| 135 | Ga0307405_10338931 | 3300031731 | Bacteria | 1155 |
| 136 | Ga0307413_10001473 | 3300031824 | Bacteria | 8951 |
| 137 | Ga0307407_10002560 | 3300031903 | Bacteria | 7154 |
| 138 | Ga0307412_10097143 | 3300031911 | Bacteria | 2075 |
| 139 | Ga0307409_100038615 | 3300031995 | Bacteria | 3533 |
| 140 | Ga0307414_10065019 | 3300032004 | Bacteria | 2600 |
| 141 | Ga0307411_10016758 | 3300032005 | Bacteria | 4154 |
| 142 | Ga0307415_100009544 | 3300032126 | Bacteria | 5447 |
| 143 | Ga0373944_0039855 | 3300035089 | Bacteria | 1448 |
| 144 | Ga0373941_0217088 | 3300035115 | Bacteria | 734 |
| 145 | Ga0373956_0207037 | 3300035119 | Bacteria | 930 |
| 146 | Ga0373956_0235589 | 3300035119 | Bacteria | 870 |
| 147 | Ga0373943_0010273 | 3300035170 | Bacteria | 4199 |
| 148 | Ga0373955_0216168 | 3300035172 | Bacteria | 1144 |
| 149 | Ga0373935_0033580 | 3300035692 | Bacteria | 3194 |
| 150 | Ga0373927_0115655 | 3300035695 | Bacteria | 1749 |
| 151 | Ga0373933_0356286 | 3300035724 | Bacteria | 951 |
| 152 | Ga0373947_0018177 | 3300035725 | Bacteria | 4045 |
| 153 | Ga0373937_0015355 | 3300036401 | Bacteria | 6773 |
| 154 | Ga0373937_0024732 | 3300036401 | Bacteria | 5420 |
| 155 | Ga0373937_0038465 | 3300036401 | Bacteria | 4359 |
| 156 | Ga0373937_0063848 | 3300036401 | Bacteria | 3387 |
| 157 | Ga0373937_0365246 | 3300036401 | Bacteria | 1368 |
| 158 | Ga0316582_0048806 | 3300036647 | Bacteria | 2677 |
| 159 | Ga0316584_0326387 | 3300036712 | Bacteria | 1106 |
| 160 | Ga0373925_0003490 | 3300037068 | Bacteria | 12150 |
| 161 | Ga0373925_0045432 | 3300037068 | Bacteria | 3263 |
| 162 | Ga0373925_0393741 | 3300037068 | Bacteria | 1129 |
| 163 | Ga0395899_0002597 | 3300037312 | Bacteria | 14556 |
| 164 | Ga0395899_0011688 | 3300037312 | Bacteria | 6719 |
| 165 | Ga0395900_0000777 | 3300037418 | Bacteria | 42484 |
| 166 | Ga0395900_0041795 | 3300037418 | Bacteria | 4724 |
| 167 | Ga0395898_0016277 | 3300037466 | Bacteria | 7610 |
| 168 | Ga0395898_0021176 | 3300037466 | Bacteria | 6596 |
| 169 | Ga0395905_0050455 | 3300037471 | Bacteria | 3898 |
| 170 | Ga0395905_0083490 | 3300037471 | Bacteria | 2992 |
| 171 | Ga0395901_0000260 | 3300038443 | Bacteria | 66084 |
| 172 | Ga0395901_0033659 | 3300038443 | Bacteria | 5291 |
| 173 | Ga0436365_1478984 | 3300039437 | Bacteria | 1157 |
| 174 | Ga0439465_0026577 | 3300041413 | Bacteria | 1831 |
| 175 | Ga0451793_1742545 | 3300041452 | Bacteria | 1047 |
| 176 | Ga0439432_011367 | 3300042006 | Bacteria | 3069 |
| 177 | Ga0495670_0216713 | 3300046691 | Bacteria | 1016 |
| 178 | Ga0496104_0590137 | 3300048907 | Bacteria | 1021 |
| 179 | Ga0496119_0021585 | 3300048922 | Bacteria | 4644 |
| 180 | Ga0496122_0006309 | 3300048925 | Bacteria | 13664 |
| 181 | Ga0496123_0017640 | 3300048926 | Bacteria | 5730 |
| 182 | Ga0496125_0128822 | 3300048928 | Bacteria | 1786 |
| 183 | Ga0496126_0001557 | 3300048929 | Bacteria | 35204 |
| 184 | Ga0501033_0068481 | 3300049570 | Bacteria | 2609 |
| 185 | Ga0501033_0188770 | 3300049570 | Bacteria | 1475 |
| 186 | Ga0501034_0092122 | 3300049571 | Bacteria | 3028 |
| 187 | Ga0501038_0394000 | 3300049574 | Bacteria | 1072 |
| 188 | Ga0501067_0002006 | 3300049583 | Bacteria | 11215 |
| 189 | Ga0501068_0190487 | 3300049584 | Bacteria | 1299 |
| 190 | Ga0501070_0102631 | 3300049586 | Bacteria | 2365 |
| 191 | Ga0501072_0685284 | 3300049588 | Bacteria | 806 |
| 192 | Ga0501074_0098623 | 3300049590 | Bacteria | 2091 |
| 193 | Ga0501076_0029487 | 3300049592 | Bacteria | 4267 |
| 194 | Ga0501076_0706474 | 3300049592 | Bacteria | 832 |
| 195 | Ga0501083_0078262 | 3300049744 | Bacteria | 2193 |
| 196 | Ga0501083_0146404 | 3300049744 | Bacteria | 1547 |
| 197 | Ga0501035_0048277 | 3300049822 | Bacteria | 3818 |
| 198 | Ga0501035_0172919 | 3300049822 | Bacteria | 1865 |
| 199 | Ga0501044_0084107 | 3300049823 | Bacteria | 3216 |
| 200 | Ga0501044_0131433 | 3300049823 | Bacteria | 2497 |
| 201 | nmdc:mga00v17_32365_c1 | 3300050491 | Bacteria | 3090 |
| 202 | nmdc:mga0yw44_519308_c1 | 3300050492 | Bacteria | 808 |
| 203 | nmdc:mga08x19_270141_c1 | 3300050514 | Bacteria | 1177 |
| 204 | nmdc:mga08x19_284638_c1 | 3300050514 | Bacteria | 1146 |
| 205 | nmdc:mga08x19_50_c1 | 3300050514 | Bacteria | 129410 |
| 206 | Ga0495619_0269931 | 3300053085 | Bacteria | 1179 |
| 207 | Ga0500643_000014 | 3300053087 | Bacteria | 318249 |
| 208 | Ga0500644_0270691 | 3300053088 | Bacteria | 721 |
| 209 | Ga0500568_0035510 | 3300053139 | Bacteria | 2034 |
| 210 | Ga0500645_071408 | 3300053730 | Bacteria | 996 |
| 211 | Ga0501084_0037930 | 3300054114 | Bacteria | 4027 |
| 212 | Ga0501084_0269803 | 3300054114 | Bacteria | 1437 |
| 213 | Ga0501084_0353354 | 3300054114 | Bacteria | 1241 |
| 214 | Ga0501084_0609488 | 3300054114 | Bacteria | 922 |
| 215 | Ga0501082_0052116 | 3300060353 | Bacteria | 3527 |
| 216 | Ga0501082_0055706 | 3300060353 | Bacteria | 3405 |
| 217 | Ga0501082_0163309 | 3300060353 | Bacteria | 1935 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028800 | Ga0265338_10101585 | Ga0265338_101015852 | 191 |
| 2 | 3300031241 | Ga0265325_10000325 | Ga0265325_1000032534 | 191 |
| 3 | 3300031249 | Ga0265339_10002615 | Ga0265339_1000261511 | 191 |
| 4 | 3300031344 | Ga0265316_10011441 | Ga0265316_100114412 | 191 |
| 5 | 3300031595 | Ga0265313_10001462 | Ga0265313_100014628 | 191 |
| 6 | 3300031712 | Ga0265342_10151472 | Ga0265342_101514722 | 191 |
| 7 | 3300035115 | Ga0373941_0217088 | Ga0373941_0217088_32_667 | 199 |
| 8 | 3300005334 | Ga0068869_100051675 | Ga0068869_1000516753 | 201 |
| 9 | 3300009174 | Ga0105241_10283239 | Ga0105241_102832392 | 201 |
| 10 | 3300025933 | Ga0207706_10214341 | Ga0207706_102143412 | 202 |
| 11 | 3300031731 | Ga0307405_10338931 | Ga0307405_103389312 | 202 |
| 12 | 3300031824 | Ga0307413_10001473 | Ga0307413_100014737 | 202 |
| 13 | 3300031903 | Ga0307407_10002560 | Ga0307407_100025604 | 202 |
| 14 | 3300031911 | Ga0307412_10097143 | Ga0307412_100971432 | 202 |
| 15 | 3300031995 | Ga0307409_100038615 | Ga0307409_1000386154 | 202 |
| 16 | 3300032004 | Ga0307414_10065019 | Ga0307414_100650192 | 202 |
| 17 | 3300032005 | Ga0307411_10016758 | Ga0307411_100167582 | 202 |
| 18 | 3300032126 | Ga0307415_100009544 | Ga0307415_1000095442 | 202 |
| 19 | 3300053730 | Ga0500645_071408 | Ga0500645_071408_251_907 | 202 |
| 20 | 3300035119 | Ga0373956_0235589 | Ga0373956_0235589_203_847 | 203 |
| 21 | 3300048929 | Ga0496126_0001557 | Ga0496126_0001557_8194_8838 | 204 |
| 22 | 3300014968 | Ga0157379_10028589 | Ga0157379_100285892 | 205 |
| 23 | 3300037068 | Ga0373925_0045432 | Ga0373925_0045432_566_1249 | 205 |
| 24 | 3300048907 | Ga0496104_0590137 | Ga0496104_0590137_85_768 | 205 |
| 25 | 3300035724 | Ga0373933_0356286 | Ga0373933_0356286_260_919 | 206 |
| 26 | 3300036401 | Ga0373937_0024732 | Ga0373937_0024732_1590_2249 | 206 |
| 27 | 3300028800 | Ga0265338_10064482 | Ga0265338_100644823 | 207 |
| 28 | 3300053088 | Ga0500644_0270691 | Ga0500644_0270691_46_711 | 207 |
| 29 | 3300005293 | Ga0065715_10181314 | Ga0065715_101813142 | 209 |
| 30 | 3300005327 | Ga0070658_10006297 | Ga0070658_100062973 | 209 |
| 31 | 3300005339 | Ga0070660_100206183 | Ga0070660_1002061831 | 209 |
| 32 | 3300005345 | Ga0070692_10014129 | Ga0070692_100141295 | 209 |
| 33 | 3300005455 | Ga0070663_100014704 | Ga0070663_1000147045 | 209 |
| 34 | 3300013102 | Ga0157371_10506619 | Ga0157371_105066192 | 209 |
| 35 | 3300025904 | Ga0207647_10102996 | Ga0207647_101029962 | 209 |
| 36 | 3300025909 | Ga0207705_10002534 | Ga0207705_1000253417 | 209 |
| 37 | 3300025919 | Ga0207657_10009509 | Ga0207657_1000950910 | 209 |
| 38 | 3300031711 | Ga0265314_10046446 | Ga0265314_100464464 | 209 |
| 39 | 3300035172 | Ga0373955_0216168 | Ga0373955_0216168_92_787 | 209 |
| 40 | 3300037312 | Ga0395899_0002597 | Ga0395899_0002597_6036_6698 | 209 |
| 41 | 3300037312 | Ga0395899_0011688 | Ga0395899_0011688_974_1657 | 209 |
| 42 | 3300037418 | Ga0395900_0000777 | Ga0395900_0000777_13837_14499 | 209 |
| 43 | 3300037418 | Ga0395900_0041795 | Ga0395900_0041795_1300_1983 | 209 |
| 44 | 3300037466 | Ga0395898_0016277 | Ga0395898_0016277_3583_4266 | 209 |
| 45 | 3300037466 | Ga0395898_0021176 | Ga0395898_0021176_2107_2769 | 209 |
| 46 | 3300037471 | Ga0395905_0050455 | Ga0395905_0050455_2984_3643 | 209 |
| 47 | 3300037471 | Ga0395905_0083490 | Ga0395905_0083490_1470_2153 | 209 |
| 48 | 3300038443 | Ga0395901_0000260 | Ga0395901_0000260_9882_10544 | 209 |
| 49 | 3300038443 | Ga0395901_0033659 | Ga0395901_0033659_1407_2090 | 209 |
| 50 | 3300042006 | Ga0439432_011367 | Ga0439432_011367_2385_3041 | 209 |
| 51 | 3300005327 | Ga0070658_10022523 | Ga0070658_100225236 | 210 |
| 52 | 3300005339 | Ga0070660_100020834 | Ga0070660_1000208343 | 210 |
| 53 | 3300006175 | Ga0070712_100750079 | Ga0070712_1007500791 | 210 |
| 54 | 3300013104 | Ga0157370_10086197 | Ga0157370_100861972 | 210 |
| 55 | 3300025919 | Ga0207657_10006637 | Ga0207657_100066374 | 210 |
| 56 | iso_pu_bacteria | 2513237094 | 2513640661 | 211 |
| 57 | iso_pu_bacteria | 2513237098 | 2513674449 | 211 |
| 58 | iso_pu_bacteria | 2517093001 | 2517102817 | 211 |
| 59 | iso_pu_bacteria | 2617270741 | 2617375522 | 211 |
| 60 | iso_pu_bacteria | 2824746037 | 2824746561 | 211 |
| 61 | iso_pu_bacteria | 2849076700 | 2849079092 | 211 |
| 62 | iso_pu_bacteria | 2908775508 | 2908780413 | 211 |
| 63 | iso_pu_bacteria | 2941531003 | 2941533040 | 211 |
| 64 | iso_pu_bacteria | 3005718088 | 3005722529 | 211 |
| 65 | 3300014968 | Ga0157379_10000463 | Ga0157379_1000046329 | 212 |
| 66 | 3300025931 | Ga0207644_10588562 | Ga0207644_105885621 | 212 |
| 67 | 3300049571 | Ga0501034_0092122 | Ga0501034_0092122_571_1242 | 212 |
| 68 | 3300049822 | Ga0501035_0172919 | Ga0501035_0172919_1129_1800 | 212 |
| 69 | 3300036401 | Ga0373937_0063848 | Ga0373937_0063848_2020_2691 | 213 |
| 70 | 3300053085 | Ga0495619_0269931 | Ga0495619_0269931_37_708 | 213 |
| 71 | 3300005336 | Ga0070680_100147845 | Ga0070680_1001478453 | 214 |
| 72 | 3300005341 | Ga0070691_10002845 | Ga0070691_100028456 | 214 |
| 73 | 3300005434 | Ga0070709_10001059 | Ga0070709_100010599 | 214 |
| 74 | 3300005434 | Ga0070709_10055634 | Ga0070709_100556342 | 214 |
| 75 | 3300005435 | Ga0070714_100285735 | Ga0070714_1002857351 | 214 |
| 76 | 3300005435 | Ga0070714_100378479 | Ga0070714_1003784792 | 214 |
| 77 | 3300005435 | Ga0070714_100428072 | Ga0070714_1004280722 | 214 |
| 78 | 3300005436 | Ga0070713_100000041 | Ga0070713_10000004173 | 214 |
| 79 | 3300005436 | Ga0070713_100711070 | Ga0070713_1007110702 | 214 |
| 80 | 3300005539 | Ga0068853_100000937 | Ga0068853_10000093719 | 214 |
| 81 | 3300005546 | Ga0070696_100304821 | Ga0070696_1003048212 | 214 |
| 82 | 3300005547 | Ga0070693_100042405 | Ga0070693_1000424053 | 214 |
| 83 | 3300005547 | Ga0070693_100116865 | Ga0070693_1001168652 | 214 |
| 84 | 3300005563 | Ga0068855_100087670 | Ga0068855_1000876703 | 214 |
| 85 | 3300005577 | Ga0068857_100025531 | Ga0068857_1000255313 | 214 |
| 86 | 3300005578 | Ga0068854_100106400 | Ga0068854_1001064002 | 214 |
| 87 | 3300005614 | Ga0068856_100000274 | Ga0068856_1000002744 | 214 |
| 88 | 3300005614 | Ga0068856_100014242 | Ga0068856_1000142428 | 214 |
| 89 | 3300005616 | Ga0068852_100027707 | Ga0068852_1000277076 | 214 |
| 90 | 3300005842 | Ga0068858_100243368 | Ga0068858_1002433682 | 214 |
| 91 | 3300005843 | Ga0068860_100571432 | Ga0068860_1005714322 | 214 |
| 92 | 3300006173 | Ga0070716_100193754 | Ga0070716_1001937542 | 214 |
| 93 | 3300006175 | Ga0070712_100000494 | Ga0070712_10000049418 | 214 |
| 94 | 3300006175 | Ga0070712_100001638 | Ga0070712_1000016385 | 214 |
| 95 | 3300006358 | Ga0068871_100195930 | Ga0068871_1001959303 | 214 |
| 96 | 3300006871 | Ga0075434_100157789 | Ga0075434_1001577892 | 214 |
| 97 | 3300006914 | Ga0075436_100000023 | Ga0075436_10000002381 | 214 |
| 98 | 3300006914 | Ga0075436_100180573 | Ga0075436_1001805731 | 214 |
| 99 | 3300006914 | Ga0075436_100307939 | Ga0075436_1003079392 | 214 |
| 100 | 3300009093 | Ga0105240_10010987 | Ga0105240_1001098710 | 214 |
| 101 | 3300009098 | Ga0105245_10043582 | Ga0105245_100435824 | 214 |
| 102 | 3300009174 | Ga0105241_10066238 | Ga0105241_100662382 | 214 |
| 103 | 3300009174 | Ga0105241_10245708 | Ga0105241_102457082 | 214 |
| 104 | 3300009545 | Ga0105237_10033153 | Ga0105237_100331534 | 214 |
| 105 | 3300009551 | Ga0105238_10006836 | Ga0105238_100068368 | 214 |
| 106 | 3300010375 | Ga0105239_10030655 | Ga0105239_100306553 | 214 |
| 107 | 3300013100 | Ga0157373_10026508 | Ga0157373_100265082 | 214 |
| 108 | 3300013104 | Ga0157370_10005670 | Ga0157370_100056706 | 214 |
| 109 | 3300013296 | Ga0157374_10046390 | Ga0157374_100463903 | 214 |
| 110 | 3300013297 | Ga0157378_10040417 | Ga0157378_100404175 | 214 |
| 111 | 3300014968 | Ga0157379_10005410 | Ga0157379_100054108 | 214 |
| 112 | 3300014968 | Ga0157379_10065317 | Ga0157379_100653173 | 214 |
| 113 | 3300025906 | Ga0207699_10000126 | Ga0207699_1000012642 | 214 |
| 114 | 3300025906 | Ga0207699_10115556 | Ga0207699_101155563 | 214 |
| 115 | 3300025906 | Ga0207699_10116600 | Ga0207699_101166002 | 214 |
| 116 | 3300025911 | Ga0207654_10032866 | Ga0207654_100328663 | 214 |
| 117 | 3300025911 | Ga0207654_10109459 | Ga0207654_101094592 | 214 |
| 118 | 3300025913 | Ga0207695_10009051 | Ga0207695_100090513 | 214 |
| 119 | 3300025915 | Ga0207693_10000295 | Ga0207693_1000029541 | 214 |
| 120 | 3300025915 | Ga0207693_10002826 | Ga0207693_100028265 | 214 |
| 121 | 3300025916 | Ga0207663_10238217 | Ga0207663_102382172 | 214 |
| 122 | 3300025924 | Ga0207694_10039175 | Ga0207694_100391752 | 214 |
| 123 | 3300025927 | Ga0207687_10569715 | Ga0207687_105697152 | 214 |
| 124 | 3300025928 | Ga0207700_10000010 | Ga0207700_10000010101 | 214 |
| 125 | 3300025929 | Ga0207664_10316340 | Ga0207664_103163402 | 214 |
| 126 | 3300025939 | Ga0207665_10027671 | Ga0207665_100276712 | 214 |
| 127 | 3300025949 | Ga0207667_10006962 | Ga0207667_1000696211 | 214 |
| 128 | 3300025981 | Ga0207640_10296012 | Ga0207640_102960122 | 214 |
| 129 | 3300026035 | Ga0207703_10028227 | Ga0207703_100282272 | 214 |
| 130 | 3300026041 | Ga0207639_10050353 | Ga0207639_100503534 | 214 |
| 131 | 3300026078 | Ga0207702_10000013 | Ga0207702_10000013186 | 214 |
| 132 | 3300026088 | Ga0207641_10485945 | Ga0207641_104859452 | 214 |
| 133 | 3300026116 | Ga0207674_10000887 | Ga0207674_100008874 | 214 |
| 134 | 3300028381 | Ga0268264_10491234 | Ga0268264_104912342 | 214 |
| 135 | 3300028800 | Ga0265338_10012084 | Ga0265338_100120846 | 214 |
| 136 | 3300031241 | Ga0265325_10155672 | Ga0265325_101556721 | 214 |
| 137 | 3300031247 | Ga0265340_10000115 | Ga0265340_1000011514 | 214 |
| 138 | 3300031247 | Ga0265340_10002893 | Ga0265340_100028932 | 214 |
| 139 | 3300031344 | Ga0265316_10034448 | Ga0265316_100344486 | 214 |
| 140 | 3300031711 | Ga0265314_10026538 | Ga0265314_100265382 | 214 |
| 141 | 3300031712 | Ga0265342_10075432 | Ga0265342_100754323 | 214 |
| 142 | 3300035119 | Ga0373956_0207037 | Ga0373956_0207037_218_913 | 214 |
| 143 | 3300036401 | Ga0373937_0015355 | Ga0373937_0015355_1239_1934 | 214 |
| 144 | 3300036401 | Ga0373937_0038465 | Ga0373937_0038465_829_1512 | 214 |
| 145 | 3300036401 | Ga0373937_0365246 | Ga0373937_0365246_267_938 | 214 |
| 146 | 3300037068 | Ga0373925_0393741 | Ga0373925_0393741_326_1015 | 214 |
| 147 | 3300049570 | Ga0501033_0068481 | Ga0501033_0068481_413_1084 | 214 |
| 148 | 3300049823 | Ga0501044_0131433 | Ga0501044_0131433_430_1101 | 214 |
| 149 | 3300050514 | nmdc:mga08x19_270141_c1 | nmdc:mga08x19_270141_c1_147_836 | 214 |
| 150 | 3300050514 | nmdc:mga08x19_284638_c1 | nmdc:mga08x19_284638_c1_240_944 | 214 |
| 151 | 3300050514 | nmdc:mga08x19_50_c1 | nmdc:mga08x19_50_c1_48139_48813 | 214 |
| 152 | 3300053087 | Ga0500643_000014 | Ga0500643_000014_84070_84747 | 214 |
| 153 | 3300005439 | Ga0070711_100650716 | Ga0070711_1006507161 | 215 |
| 154 | 3300006237 | Ga0097621_100073697 | Ga0097621_1000736972 | 215 |
| 155 | 3300009174 | Ga0105241_10094778 | Ga0105241_100947782 | 215 |
| 156 | 3300013297 | Ga0157378_10063653 | Ga0157378_100636533 | 215 |
| 157 | 3300013308 | Ga0157375_10479844 | Ga0157375_104798442 | 215 |
| 158 | 3300014968 | Ga0157379_10055543 | Ga0157379_100555434 | 215 |
| 159 | 3300026023 | Ga0207677_10133210 | Ga0207677_101332103 | 215 |
| 160 | 3300041452 | Ga0451793_1742545 | Ga0451793_1742545_38_733 | 215 |
| 161 | 3300053139 | Ga0500568_0035510 | Ga0500568_0035510_78_767 | 215 |
| 162 | 3300031239 | Ga0265328_10124359 | Ga0265328_101243592 | 216 |
| 163 | 3300031241 | Ga0265325_10000829 | Ga0265325_100008293 | 216 |
| 164 | 3300031247 | Ga0265340_10020531 | Ga0265340_100205312 | 216 |
| 165 | 3300031249 | Ga0265339_10045523 | Ga0265339_100455234 | 216 |
| 166 | 3300031250 | Ga0265331_10010347 | Ga0265331_100103476 | 216 |
| 167 | 3300031711 | Ga0265314_10002766 | Ga0265314_100027668 | 216 |
| 168 | 3300005435 | Ga0070714_100373875 | Ga0070714_1003738752 | 217 |
| 169 | 3300009177 | Ga0105248_10000001 | Ga0105248_10000001268 | 217 |
| 170 | 3300025913 | Ga0207695_10224273 | Ga0207695_102242732 | 217 |
| 171 | 3300025941 | Ga0207711_10000002 | Ga0207711_10000002969 | 217 |
| 172 | 3300028577 | Ga0265318_10001720 | Ga0265318_100017206 | 217 |
| 173 | 3300031241 | Ga0265325_10156888 | Ga0265325_101568881 | 217 |
| 174 | 3300035089 | Ga0373944_0039855 | Ga0373944_0039855_11_703 | 217 |
| 175 | 3300035170 | Ga0373943_0010273 | Ga0373943_0010273_763_1455 | 217 |
| 176 | 3300035692 | Ga0373935_0033580 | Ga0373935_0033580_1143_1835 | 217 |
| 177 | 3300035695 | Ga0373927_0115655 | Ga0373927_0115655_1012_1704 | 217 |
| 178 | 3300035725 | Ga0373947_0018177 | Ga0373947_0018177_632_1324 | 217 |
| 179 | 3300037068 | Ga0373925_0003490 | Ga0373925_0003490_10675_11367 | 217 |
| 180 | 3300039437 | Ga0436365_1478984 | Ga0436365_1478984_48_728 | 217 |
| 181 | 3300005334 | Ga0068869_100286436 | Ga0068869_1002864361 | 218 |
| 182 | 3300005335 | Ga0070666_10013230 | Ga0070666_100132301 | 218 |
| 183 | 3300005617 | Ga0068859_100884159 | Ga0068859_1008841592 | 218 |
| 184 | 3300006931 | Ga0097620_100884167 | Ga0097620_1008841672 | 218 |
| 185 | 3300009177 | Ga0105248_10019949 | Ga0105248_100199495 | 218 |
| 186 | 3300025903 | Ga0207680_10001436 | Ga0207680_100014362 | 218 |
| 187 | 3300049570 | Ga0501033_0188770 | Ga0501033_0188770_120_803 | 218 |
| 188 | 3300049574 | Ga0501038_0394000 | Ga0501038_0394000_364_1047 | 218 |
| 189 | 3300049583 | Ga0501067_0002006 | Ga0501067_0002006_6968_7654 | 218 |
| 190 | 3300049588 | Ga0501072_0685284 | Ga0501072_0685284_83_772 | 218 |
| 191 | 3300049592 | Ga0501076_0029487 | Ga0501076_0029487_1559_2248 | 218 |
| 192 | 3300049592 | Ga0501076_0706474 | Ga0501076_0706474_99_785 | 218 |
| 193 | 3300049744 | Ga0501083_0078262 | Ga0501083_0078262_1390_2076 | 218 |
| 194 | 3300049822 | Ga0501035_0048277 | Ga0501035_0048277_1349_2032 | 218 |
| 195 | 3300049823 | Ga0501044_0084107 | Ga0501044_0084107_924_1607 | 218 |
| 196 | 3300054114 | Ga0501084_0269803 | Ga0501084_0269803_330_1019 | 218 |
| 197 | 3300054114 | Ga0501084_0353354 | Ga0501084_0353354_311_997 | 218 |
| 198 | 3300054114 | Ga0501084_0609488 | Ga0501084_0609488_22_711 | 218 |
| 199 | 3300060353 | Ga0501082_0052116 | Ga0501082_0052116_1018_1707 | 218 |
| 200 | 3300060353 | Ga0501082_0055706 | Ga0501082_0055706_1697_2383 | 218 |
| 201 | 3300049584 | Ga0501068_0190487 | Ga0501068_0190487_248_961 | 220 |
| 202 | 3300049586 | Ga0501070_0102631 | Ga0501070_0102631_1129_1842 | 220 |
| 203 | 3300054114 | Ga0501084_0037930 | Ga0501084_0037930_982_1695 | 220 |
| 204 | 3300060353 | Ga0501082_0163309 | Ga0501082_0163309_397_1110 | 220 |
| 205 | iso_pu_bacteria | 2839993093 | 2839994339 | 220 |
| 206 | iso_pu_bacteria | 2894652903 | 2894655285 | 220 |
| 207 | 3300049590 | Ga0501074_0098623 | Ga0501074_0098623_247_963 | 221 |
| 208 | 3300049744 | Ga0501083_0146404 | Ga0501083_0146404_516_1235 | 222 |
| 209 | 3300005367 | Ga0070667_100516445 | Ga0070667_1005164451 | 223 |
| 210 | 3300005719 | Ga0068861_100175822 | Ga0068861_1001758222 | 223 |
| 211 | 3300006038 | Ga0075365_10006288 | Ga0075365_100062884 | 223 |
| 212 | 3300006048 | Ga0075363_100007572 | Ga0075363_1000075723 | 223 |
| 213 | 3300006051 | Ga0075364_10051732 | Ga0075364_100517322 | 223 |
| 214 | 3300017792 | Ga0163161_10436637 | Ga0163161_104366371 | 223 |
| 215 | 3300026118 | Ga0207675_100232707 | Ga0207675_1002327073 | 223 |
| 216 | 3300027866 | Ga0209813_10021359 | Ga0209813_100213591 | 223 |
| 217 | 3300050491 | nmdc:mga00v17_32365_c1 | nmdc:mga00v17_32365_c1_682_1383 | 223 |
| 218 | 3300006038 | Ga0075365_10369347 | Ga0075365_103693471 | 224 |
| 219 | 3300041413 | Ga0439465_0026577 | Ga0439465_0026577_1076_1777 | 224 |
| 220 | 3300046691 | Ga0495670_0216713 | Ga0495670_0216713_57_764 | 224 |
| 221 | 3300050492 | nmdc:mga0yw44_519308_c1 | nmdc:mga0yw44_519308_c1_45_782 | 224 |
| 222 | 3300036647 | Ga0316582_0048806 | Ga0316582_0048806_64_855 | 226 |
| 223 | 3300036712 | Ga0316584_0326387 | Ga0316584_0326387_245_985 | 226 |
| 224 | iso_pu_bacteria | 2751185800 | 2753358121 | 227 |
| 225 | iso_pu_bacteria | 2854911287 | 2854916372 | 227 |
| 226 | 3300003578 | Ga0006562J51391_1003904 | Ga0006562J51391_10039043 | 231 |
| 227 | 3300048922 | Ga0496119_0021585 | Ga0496119_0021585_3688_4410 | 231 |
| 228 | 3300048925 | Ga0496122_0006309 | Ga0496122_0006309_12919_13641 | 231 |
| 229 | 3300048926 | Ga0496123_0017640 | Ga0496123_0017640_2557_3279 | 231 |
| 230 | 3300048928 | Ga0496125_0128822 | Ga0496125_0128822_229_951 | 231 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8etc-assembly1.cif.gz_w | fkbp39 associated nascent 60s ribosome state 4 | 0.9096 | 49 | 230 |
| 8fkv-assembly1.cif.gz_SJ | human nucleolar pre-60s ribosomal subunit (state d1) | 0.9014 | 49 | 229 |
| 8fkw-assembly1.cif.gz_SJ | human nucleolar pre-60s ribosomal subunit (state d2) | 0.9013 | 49 | 229 |
| 7o9m-assembly1.cif.gz_n | human mitochondrial ribosome large subunit assembly intermediate with mterf4-nsun4, mrm2, mtg1 and the malsu module | 0.9003 | 35 | 231 |
| 8esq-assembly1.cif.gz_w | ytm1 associated nascent 60s ribosome state 2 | 0.8972 | 49 | 230 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P78860_27_218_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.915 | 60 | 231 | 3.40.50.150 |
| af_Q58771_22_215_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9107 | 60 | 230 | 3.40.50.150 |
| af_Q9VDT6_58_249_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9077 | 60 | 231 | 3.40.50.150 |
| af_Q4CQP4_20_264_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9031 | 60 | 229 | 3.40.50.150 |
| af_Q9VEP1_20_211_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9021 | 60 | 229 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P1P706-F1-model_v4 | Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) | 0.952 | 54 | 230 |
GO:0005737
GO:0008650 |
| AF-A0A6A5LFF6-F1-model_v4 | deleted | 0.9351 | 32 | 231 |
|
| AF-A0A537WKP4-F1-model_v4 | Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) | 0.9339 | 122 | 231 |
GO:0008650
|
| AF-A0A0P7IDY6-F1-model_v4 | Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) | 0.9333 | 33 | 230 |
GO:0005737
GO:0008650 |
| AF-A0A529FBI4-F1-model_v4 | Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.166) (23S rRNA Um2552 methyltransferase) (rRNA (uridine-2'-O-)-methyltransferase) | 0.9324 | 66 | 178 |
GO:0008650
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar