F343200

General Info

Members Datasets Scaffolds Average Seq Length
230 133 460 427

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0011909|Ga0373931_0011909_1983_3371
Length 462
Sequence LDRDAHQLARALMAPPAPRVRDATPQGDAGRLGSGPALGPLSVPGRRVAVVGGGWAGLATAVEATRRGHRVTLFEMAPQLGGRARGVEVGGLVLDNGQHILIGAYTATLALMRAVGVEVDTALLRTPLRFTSPDGSGLHLEAGSPIAAFARAVLGQRKWTIGERVALLAAAGGWALRRFRCDEALTVAELTARLPLAIRDQLVDPLCVAALNTPASEASAGVFLRVLKDALFSGPGSADLLLPRVSLSELLPEQARRSLAGARVRLQARVTTLRAHGEGWLVDDEPFDRVVLAATPTESARLAADIAPAWSRSVSALRYEPIVTVYLQSDGTRLPEPMLALHCDARAPAQFVFDRGQLGGPRGLLAFVISGAQAWVDRGLDETTQATLTQARAALGAHLREPLRVVHTIAEKRATFRCTPGLRRPPTRVAPGLLAAGDHIDGPYPATLEGAVRSGMQAAALL

Samples

Sample ID Description Type Environment
1 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
94 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
101 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
107 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
110 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
116 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
117 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
118 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
123 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
124 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
125 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
126 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
127 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
128 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
129 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
130 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
131 2643221660 Methylibium sp. Root1272 Isolate Unclassified
132 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
133 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 0
Isolates 2.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.52
Nodule 0
Rhizoplane 0.43
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373931_0011909 3300035691 Bacteria 4208
2 Ga0070690_100103484 3300005330 Bacteria 1890
3 Ga0068869_100029054 3300005334 Bacteria 3869
4 Ga0068869_100063147 3300005334 Bacteria 2720
5 Ga0068868_100027786 3300005338 Bacteria 4318
6 Ga0068868_100053754 3300005338 Bacteria 3173
7 Ga0070687_100028620 3300005343 Bacteria 2705
8 Ga0070668_100069521 3300005347 Bacteria 2739
9 Ga0070669_100005371 3300005353 Bacteria 9244
10 Ga0070669_100028760 3300005353 Bacteria 4003
11 Ga0070675_100009031 3300005354 Bacteria 7742
12 Ga0070675_100056078 3300005354 Bacteria 3245
13 Ga0070671_100002780 3300005355 Bacteria 13594
14 Ga0070671_100063070 3300005355 Bacteria 3086
15 Ga0070674_100004603 3300005356 Bacteria 7883
16 Ga0070674_100064488 3300005356 Bacteria 2567
17 Ga0070674_100105752 3300005356 Bacteria 2058
18 Ga0070673_100039321 3300005364 Bacteria 3618
19 Ga0070673_100069145 3300005364 Bacteria 2829
20 Ga0070673_100092364 3300005364 Bacteria 2475
21 Ga0070673_100215235 3300005364 Bacteria 1661
22 Ga0070673_100233057 3300005364 Bacteria 1598
23 Ga0070667_100004689 3300005367 Bacteria 11473
24 Ga0070667_100005834 3300005367 Bacteria 10272
25 Ga0070700_100009966 3300005441 Bacteria 5230
26 Ga0070700_100049733 3300005441 Bacteria 2603
27 Ga0070663_100185273 3300005455 Bacteria 1617
28 Ga0070678_100063028 3300005456 Bacteria 2741
29 Ga0070678_100067813 3300005456 Bacteria 2657
30 Ga0070662_100013180 3300005457 Bacteria 5496
31 Ga0070662_100024098 3300005457 Bacteria 4188
32 Ga0070662_100050152 3300005457 Bacteria 3011
33 Ga0070662_100052877 3300005457 Bacteria 2938
34 Ga0068867_100000348 3300005459 Bacteria 30639
35 Ga0068867_100004809 3300005459 Bacteria 9507
36 Ga0068867_100011121 3300005459 Bacteria 6349
37 Ga0070706_100004682 3300005467 Bacteria 13119
38 Ga0070699_100120934 3300005518 Bacteria 2302
39 Ga0070672_100002969 3300005543 Bacteria 10926
40 Ga0070672_100008819 3300005543 Bacteria 6925
41 Ga0070672_100010260 3300005543 Bacteria 6491
42 Ga0070672_100147380 3300005543 Bacteria 1945
43 Ga0068854_100004960 3300005578 Bacteria 8390
44 Ga0068852_100008845 3300005616 Bacteria 7450
45 Ga0068852_100125012 3300005616 Bacteria 2360
46 Ga0068864_100007003 3300005618 Bacteria 9251
47 Ga0068864_100017323 3300005618 Bacteria 6005
48 Ga0068861_100012510 3300005719 Bacteria 5919
49 Ga0068861_100016604 3300005719 Bacteria 5212
50 Ga0068863_100038133 3300005841 Bacteria 4573
51 Ga0068863_100138382 3300005841 Bacteria 2326
52 Ga0068863_100165644 3300005841 Bacteria 2119
53 Ga0068858_100007475 3300005842 Bacteria 10563
54 Ga0068860_100000678 3300005843 Bacteria 39403
55 Ga0068860_100006688 3300005843 Bacteria 11573
56 Ga0068860_100154777 3300005843 Bacteria 2209
57 Ga0068862_100006858 3300005844 Bacteria 9446
58 Ga0068862_100091117 3300005844 Bacteria 2655
59 Ga0070716_100007381 3300006173 Bacteria 5408
60 Ga0075366_10000188 3300006195 Bacteria 27344
61 Ga0075370_10011048 3300006353 Bacteria 4735
62 Ga0075430_100015088 3300006846 Bacteria 6576
63 Ga0075429_100015020 3300006880 Bacteria 6715
64 Ga0068865_100003866 3300006881 Bacteria 8979
65 Ga0068865_100005609 3300006881 Bacteria 7617
66 Ga0068865_100029778 3300006881 Bacteria 3626
67 Ga0105245_10029617 3300009098 Bacteria 4838
68 Ga0114129_10076930 3300009147 Bacteria 4644
69 Ga0105243_10081861 3300009148 Bacteria 2637
70 Ga0105242_10093377 3300009176 Bacteria 2537
71 Ga0105248_10002815 3300009177 Bacteria 19307
72 Ga0105248_10238312 3300009177 Bacteria 2048
73 Ga0105249_10009586 3300009553 Bacteria 8486
74 Ga0105249_10026714 3300009553 Bacteria 5205
75 Ga0105246_10059384 3300011119 Bacteria 2653
76 Ga0157378_10004242 3300013297 Bacteria 12644
77 Ga0163162_10007397 3300013306 Bacteria 10678
78 Ga0163162_10297656 3300013306 Bacteria 1745
79 Ga0157375_10008988 3300013308 Bacteria 8744
80 Ga0157375_10036804 3300013308 Bacteria 4685
81 Ga0157375_10217170 3300013308 Bacteria 2070
82 Ga0157375_10271870 3300013308 Bacteria 1857
83 Ga0163163_10005842 3300014325 Bacteria 10704
84 Ga0163163_10069097 3300014325 Bacteria 3516
85 Ga0157380_10003102 3300014326 Bacteria 11335
86 Ga0157379_10006822 3300014968 Bacteria 9868
87 Ga0157379_10044615 3300014968 Bacteria 3957
88 Ga0157379_10136282 3300014968 Bacteria 2212
89 Ga0183362_10001 3300015683 Bacteria 2046624
90 Ga0163161_10005025 3300017792 Bacteria 9200
91 Ga0207682_10015164 3300025893 Bacteria 3001
92 Ga0207682_10035109 3300025893 Bacteria 2024
93 Ga0207680_10008544 3300025903 Bacteria 5036
94 Ga0207680_10144256 3300025903 Bacteria 1581
95 Ga0207645_10005193 3300025907 Bacteria 9507
96 Ga0207645_10010861 3300025907 Bacteria 6240
97 Ga0207645_10097365 3300025907 Bacteria 1896
98 Ga0207643_10109354 3300025908 Bacteria 1627
99 Ga0207705_10200834 3300025909 Bacteria 1511
100 Ga0207684_10003491 3300025910 Bacteria 15343
101 Ga0207681_10002108 3300025923 Bacteria 12743
102 Ga0207681_10033914 3300025923 Bacteria 3352
103 Ga0207650_10003274 3300025925 Bacteria 11160
104 Ga0207650_10031006 3300025925 Bacteria 3857
105 Ga0207659_10015238 3300025926 Bacteria 4976
106 Ga0207659_10018629 3300025926 Bacteria 4555
107 Ga0207659_10046924 3300025926 Bacteria 3053
108 Ga0207659_10076555 3300025926 Bacteria 2459
109 Ga0207659_10145719 3300025926 Bacteria 1844
110 Ga0207644_10012479 3300025931 Bacteria 5645
111 Ga0207644_10074585 3300025931 Bacteria 2490
112 Ga0207706_10014434 3300025933 Bacteria 7159
113 Ga0207706_10020339 3300025933 Bacteria 5966
114 Ga0207706_10066024 3300025933 Bacteria 3185
115 Ga0207706_10190546 3300025933 Bacteria 1800
116 Ga0207686_10036780 3300025934 Bacteria 2950
117 Ga0207709_10008198 3300025935 Bacteria 5784
118 Ga0207669_10001822 3300025937 Bacteria 9021
119 Ga0207669_10034945 3300025937 Bacteria 2854
120 Ga0207704_10001858 3300025938 Bacteria 9456
121 Ga0207704_10013500 3300025938 Bacteria 4090
122 Ga0207665_10012929 3300025939 Bacteria 5491
123 Ga0207665_10108590 3300025939 Bacteria 1947
124 Ga0207691_10005797 3300025940 Bacteria 11944
125 Ga0207691_10015723 3300025940 Bacteria 7192
126 Ga0207691_10091153 3300025940 Bacteria 2731
127 Ga0207711_10066809 3300025941 Bacteria 3110
128 Ga0207689_10019817 3300025942 Bacteria 5666
129 Ga0207689_10065082 3300025942 Bacteria 2999
130 Ga0207651_10052340 3300025960 Bacteria 2783
131 Ga0207651_10077651 3300025960 Bacteria 2378
132 Ga0207651_10192464 3300025960 Bacteria 1628
133 Ga0207712_10022506 3300025961 Bacteria 4151
134 Ga0207668_10002017 3300025972 Bacteria 11847
135 Ga0207658_10001717 3300025986 Bacteria 16591
136 Ga0207658_10030910 3300025986 Bacteria 3797
137 Ga0207658_10131503 3300025986 Bacteria 2011
138 Ga0207677_10014312 3300026023 Bacteria 4629
139 Ga0207677_10039032 3300026023 Bacteria 3118
140 Ga0207703_10004911 3300026035 Bacteria 10866
141 Ga0207639_10060865 3300026041 Bacteria 2914
142 Ga0207639_10184629 3300026041 Bacteria 1777
143 Ga0207678_10195061 3300026067 Bacteria 1731
144 Ga0207678_10209665 3300026067 Bacteria 1667
145 Ga0207708_10031932 3300026075 Bacteria 3999
146 Ga0207708_10058580 3300026075 Bacteria 2938
147 Ga0207641_10008522 3300026088 Bacteria 8467
148 Ga0207641_10133960 3300026088 Bacteria 2228
149 Ga0207648_10000839 3300026089 Bacteria 34622
150 Ga0207648_10004959 3300026089 Bacteria 13539
151 Ga0207648_10071698 3300026089 Bacteria 3019
152 Ga0207676_10013774 3300026095 Bacteria 5805
153 Ga0207676_10103161 3300026095 Bacteria 2369
154 Ga0207674_10042551 3300026116 Bacteria 4691
155 Ga0207675_100014262 3300026118 Bacteria 7407
156 Ga0207675_100015310 3300026118 Bacteria 7156
157 Ga0207683_10087163 3300026121 Bacteria 2776
158 Ga0207683_10095743 3300026121 Bacteria 2647
159 Ga0207683_10137556 3300026121 Bacteria 2199
160 Ga0207683_10240912 3300026121 Bacteria 1650
161 Ga0207698_10018685 3300026142 Bacteria 4729
162 Ga0207698_10149055 3300026142 Bacteria 2027
163 Ga0268265_10052723 3300028380 Bacteria 3078
164 Ga0268265_10062297 3300028380 Bacteria 2865
165 Ga0268264_10023571 3300028381 Bacteria 5018
166 Ga0307517_10001248 3300028786 Bacteria 42703
167 Ga0307515_10001547 3300028794 Bacteria 51411
168 Ga0307515_10002041 3300028794 Bacteria 44592
169 Ga0307515_10060228 3300028794 Bacteria 5420
170 Ga0307515_10165772 3300028794 Bacteria 2228
171 Ga0307512_10011212 3300030522 Bacteria 8505
172 Ga0307512_10021867 3300030522 Bacteria 5760
173 Ga0307513_10016866 3300031456 Bacteria 8786
174 Ga0307513_10057010 3300031456 Bacteria 4166
175 Ga0307509_10000215 3300031507 Bacteria 92190
176 Ga0307509_10031386 3300031507 Bacteria 5866
177 Ga0307509_10038835 3300031507 Bacteria 5190
178 Ga0307508_10000094 3300031616 Bacteria 104107
179 Ga0307508_10000272 3300031616 Bacteria 63553
180 Ga0307508_10006000 3300031616 Bacteria 11463
181 Ga0307508_10082031 3300031616 Bacteria 2806
182 Ga0307514_10003118 3300031649 Bacteria 16306
183 Ga0307514_10041148 3300031649 Bacteria 3640
184 Ga0307514_10105093 3300031649 Bacteria 2018
185 Ga0307516_10040200 3300031730 Bacteria 4657
186 Ga0307405_10036661 3300031731 Bacteria 2940
187 Ga0307409_100042325 3300031995 Bacteria 3410
188 Ga0307416_100348386 3300032002 Bacteria 1498
189 Ga0307510_10101129 3300033180 Bacteria 2672
190 Ga0373925_0040717 3300037068 Bacteria 3441
191 Ga0373925_0058658 3300037068 Bacteria 2886
192 Ga0451843_1442468 3300041509 Bacteria 2346
193 Ga0439446_0015656 3300042156 Bacteria 2105
194 Ga0453684_0014312 3300044712 Bacteria 12713
195 Ga0495592_0001680 3300046454 Bacteria 15512
196 Ga0495620_0026072 3300046515 Bacteria 2754
197 Ga0495630_0013870 3300046517 Bacteria 5861
198 Ga0495586_0014795 3300046535 Bacteria 4148
199 Ga0495622_0048386 3300046557 Bacteria 1976
200 Ga0495625_0019138 3300046660 Bacteria 5324
201 Ga0495676_0044182 3300047321 Bacteria 3639
202 Ga0495686_0051335 3300047472 Bacteria 2588
203 Ga0496108_0139165 3300048911 Bacteria 2091
204 Ga0496121_0010336 3300048924 Bacteria 10546
205 Ga0496124_0000151 3300048927 Bacteria 142761
206 Ga0496125_0013546 3300048928 Bacteria 8012
207 Ga0496125_0034741 3300048928 Bacteria 4438
208 Ga0501198_000002 3300049649 Bacteria 197356
209 Ga0501222_000002 3300049662 Bacteria 169093
210 nmdc:mga0k408_506_c1 3300050493 Bacteria 21412
211 nmdc:mga0k408_7304_c1 3300050493 Bacteria 5903
212 nmdc:mga0k408_8734_c1 3300050493 Bacteria 5451
213 nmdc:mga0k408_9328_c1 3300050493 Bacteria 5288
214 nmdc:mga07m45_18017_c1 3300050496 Bacteria 3804
215 nmdc:mga05p37_294385_c1 3300050507 Bacteria 1931
216 nmdc:mga09592_21174_c1 3300050508 Bacteria 5357
217 nmdc:mga08y16_269072_c1 3300050511 Bacteria 1759
218 Ga0500594_0028456 3300053118 Bacteria 1454
219 Ga0500658_0031334 3300053134 Bacteria 2080
220 Ga0500559_0000530 3300053136 Bacteria 26602
221 Ga0500568_0037376 3300053139 Bacteria 1970
222 Ga0500619_000100 3300053154 Bacteria 22919
223 Ga0500622_0002881 3300053156 Bacteria 12026
224 Ga0500587_000403 3300053739 Bacteria 5016
225 Ga0500587_000908 3300053739 Bacteria 3954
226 2587756076 2585428062 Bacteria 6842168
227 2644304940 2643221654 Bacteria 5273570
228 2644340266 2643221660 Bacteria 4208257
229 2919704506 2919704043 Bacteria 5560311
230 2974322697 2974320154 Bacteria 4571377
231 Ga0373931_0011909
232 Ga0070690_100103484
233 Ga0068869_100029054
234 Ga0068869_100063147
235 Ga0068868_100027786
236 Ga0068868_100053754
237 Ga0070687_100028620
238 Ga0070668_100069521
239 Ga0070669_100005371
240 Ga0070669_100028760
241 Ga0070675_100009031
242 Ga0070675_100056078
243 Ga0070671_100002780
244 Ga0070671_100063070
245 Ga0070674_100004603
246 Ga0070674_100064488
247 Ga0070674_100105752
248 Ga0070673_100039321
249 Ga0070673_100069145
250 Ga0070673_100092364
251 Ga0070673_100215235
252 Ga0070673_100233057
253 Ga0070667_100004689
254 Ga0070667_100005834
255 Ga0070700_100009966
256 Ga0070700_100049733
257 Ga0070663_100185273
258 Ga0070678_100063028
259 Ga0070678_100067813
260 Ga0070662_100013180
261 Ga0070662_100024098
262 Ga0070662_100050152
263 Ga0070662_100052877
264 Ga0068867_100000348
265 Ga0068867_100004809
266 Ga0068867_100011121
267 Ga0070706_100004682
268 Ga0070699_100120934
269 Ga0070672_100002969
270 Ga0070672_100008819
271 Ga0070672_100010260
272 Ga0070672_100147380
273 Ga0068854_100004960
274 Ga0068852_100008845
275 Ga0068852_100125012
276 Ga0068864_100007003
277 Ga0068864_100017323
278 Ga0068861_100012510
279 Ga0068861_100016604
280 Ga0068863_100038133
281 Ga0068863_100138382
282 Ga0068863_100165644
283 Ga0068858_100007475
284 Ga0068860_100000678
285 Ga0068860_100006688
286 Ga0068860_100154777
287 Ga0068862_100006858
288 Ga0068862_100091117
289 Ga0070716_100007381
290 Ga0075366_10000188
291 Ga0075370_10011048
292 Ga0075430_100015088
293 Ga0075429_100015020
294 Ga0068865_100003866
295 Ga0068865_100005609
296 Ga0068865_100029778
297 Ga0105245_10029617
298 Ga0114129_10076930
299 Ga0105243_10081861
300 Ga0105242_10093377
301 Ga0105248_10002815
302 Ga0105248_10238312
303 Ga0105249_10009586
304 Ga0105249_10026714
305 Ga0105246_10059384
306 Ga0157378_10004242
307 Ga0163162_10007397
308 Ga0163162_10297656
309 Ga0157375_10008988
310 Ga0157375_10036804
311 Ga0157375_10217170
312 Ga0157375_10271870
313 Ga0163163_10005842
314 Ga0163163_10069097
315 Ga0157380_10003102
316 Ga0157379_10006822
317 Ga0157379_10044615
318 Ga0157379_10136282
319 Ga0183362_10001
320 Ga0163161_10005025
321 Ga0207682_10015164
322 Ga0207682_10035109
323 Ga0207680_10008544
324 Ga0207680_10144256
325 Ga0207645_10005193
326 Ga0207645_10010861
327 Ga0207645_10097365
328 Ga0207643_10109354
329 Ga0207705_10200834
330 Ga0207684_10003491
331 Ga0207681_10002108
332 Ga0207681_10033914
333 Ga0207650_10003274
334 Ga0207650_10031006
335 Ga0207659_10015238
336 Ga0207659_10018629
337 Ga0207659_10046924
338 Ga0207659_10076555
339 Ga0207659_10145719
340 Ga0207644_10012479
341 Ga0207644_10074585
342 Ga0207706_10014434
343 Ga0207706_10020339
344 Ga0207706_10066024
345 Ga0207706_10190546
346 Ga0207686_10036780
347 Ga0207709_10008198
348 Ga0207669_10001822
349 Ga0207669_10034945
350 Ga0207704_10001858
351 Ga0207704_10013500
352 Ga0207665_10012929
353 Ga0207665_10108590
354 Ga0207691_10005797
355 Ga0207691_10015723
356 Ga0207691_10091153
357 Ga0207711_10066809
358 Ga0207689_10019817
359 Ga0207689_10065082
360 Ga0207651_10052340
361 Ga0207651_10077651
362 Ga0207651_10192464
363 Ga0207712_10022506
364 Ga0207668_10002017
365 Ga0207658_10001717
366 Ga0207658_10030910
367 Ga0207658_10131503
368 Ga0207677_10014312
369 Ga0207677_10039032
370 Ga0207703_10004911
371 Ga0207639_10060865
372 Ga0207639_10184629
373 Ga0207678_10195061
374 Ga0207678_10209665
375 Ga0207708_10031932
376 Ga0207708_10058580
377 Ga0207641_10008522
378 Ga0207641_10133960
379 Ga0207648_10000839
380 Ga0207648_10004959
381 Ga0207648_10071698
382 Ga0207676_10013774
383 Ga0207676_10103161
384 Ga0207674_10042551
385 Ga0207675_100014262
386 Ga0207675_100015310
387 Ga0207683_10087163
388 Ga0207683_10095743
389 Ga0207683_10137556
390 Ga0207683_10240912
391 Ga0207698_10018685
392 Ga0207698_10149055
393 Ga0268265_10052723
394 Ga0268265_10062297
395 Ga0268264_10023571
396 Ga0307517_10001248
397 Ga0307515_10001547
398 Ga0307515_10002041
399 Ga0307515_10060228
400 Ga0307515_10165772
401 Ga0307512_10011212
402 Ga0307512_10021867
403 Ga0307513_10016866
404 Ga0307513_10057010
405 Ga0307509_10000215
406 Ga0307509_10031386
407 Ga0307509_10038835
408 Ga0307508_10000094
409 Ga0307508_10000272
410 Ga0307508_10006000
411 Ga0307508_10082031
412 Ga0307514_10003118
413 Ga0307514_10041148
414 Ga0307514_10105093
415 Ga0307516_10040200
416 Ga0307405_10036661
417 Ga0307409_100042325
418 Ga0307416_100348386
419 Ga0307510_10101129
420 Ga0373925_0040717
421 Ga0373925_0058658
422 Ga0451843_1442468
423 Ga0439446_0015656
424 Ga0453684_0014312
425 Ga0495592_0001680
426 Ga0495620_0026072
427 Ga0495630_0013870
428 Ga0495586_0014795
429 Ga0495622_0048386
430 Ga0495625_0019138
431 Ga0495676_0044182
432 Ga0495686_0051335
433 Ga0496108_0139165
434 Ga0496121_0010336
435 Ga0496124_0000151
436 Ga0496125_0013546
437 Ga0496125_0034741
438 Ga0501198_000002
439 Ga0501222_000002
440 nmdc:mga0k408_506_c1
441 nmdc:mga0k408_7304_c1
442 nmdc:mga0k408_8734_c1
443 nmdc:mga0k408_9328_c1
444 nmdc:mga07m45_18017_c1
445 nmdc:mga05p37_294385_c1
446 nmdc:mga09592_21174_c1
447 nmdc:mga08y16_269072_c1
448 Ga0500594_0028456
449 Ga0500658_0031334
450 Ga0500559_0000530
451 Ga0500568_0037376
452 Ga0500619_000100
453 Ga0500622_0002881
454 Ga0500587_000403
455 Ga0500587_000908
456 2587756076
457 2644304940
458 2644340266
459 2919704506
460 2974322697

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

47

92

0.93

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

50

115

0.93

PF01266

DAO

FAD dependent oxidoreductase

47

124

0.89

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

47

98

0.88

PF01593

Amino_oxidase

Flavin containing amine oxidoreductase

55

462

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qkg-assembly2.cif.gz_B 2-naphthoyl-coa reductase(ncr) 0.9914 6 42
3edm-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.9792 4 32
3edm-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.9771 4 32
3k30-assembly1.cif.gz_B histamine dehydrogenase from nocardiodes simplex 0.9737 4 42
5fwn-assembly1.cif.gz_B imine reductase from amycolatopsis orientalis. closed form in in complex with (r)- methyltetrahydroisoquinoline 0.9678 4 31
ID Description Score Start End Superfamily
af_Q2G1W0_1_195_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9945 4 32 3.40.50.720
2f1kD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9928 4 32 3.40.50.720
af_I6XF25_1_136_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9913 4 34 3.40.50.720
5z2gB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9913 6 33 3.50.50.60
af_I6Y4U4_173_293_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9907 5 38 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A0N0JD70-F1-model_v4 Amine oxidase domain-containing protein 0.9746 4 424 GO:0016491
AF-A0A840SA13-F1-model_v4 Squalene-associated FAD-dependent desaturase 0.9726 3 425 GO:0016491
AF-A0A0N0JD70-F1-model_v4 Amine oxidase domain-containing protein 0.9678 4 424 GO:0016491
AF-A0A258R4A0-F1-model_v4 Phytoene dehydrogenase 0.9659 2 358 GO:0016491
AF-A0A840SA13-F1-model_v4 Squalene-associated FAD-dependent desaturase 0.9658 3 425 GO:0016491

Map