F343099

General Info

Members Datasets Scaffolds Average Seq Length
230 157 460 190

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10112506|Ga0207661_101125062
Length 173
Sequence MIKWVLKRAIDRFERNWKYDGSYMRDIIDASPRAAWLFSRAVALGKFRRDIPIEPWYAAGITAVRHEDCGPCTQLAVNPDAMPPDVALVWKFTRATLAHDAAADEYREAIVQRWGRLALVSLAFAIAAARIYPTVKYALGHGKACMRIVVAGTPVPLDHGRVPAPAHVVVHTP

Samples

Sample ID Description Type Environment
1 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
117 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0
Rhizoplane 0.87
Rhizosphere 98.26
Stem 0
Stem Tuber 0
Unclassified 6.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207661_10112506 3300025944 Bacteria 2305
2 Ga0065714_10147289 3300005288 Bacteria 1129
3 Ga0065712_10000736 3300005290 Bacteria 8455
4 Ga0065712_10269158 3300005290 Unclassified 918
5 Ga0065715_10011918 3300005293 Bacteria 2778
6 Ga0065707_10091356 3300005295 Bacteria 3962
7 Ga0070658_10001759 3300005327 Bacteria 18230
8 Ga0070676_10491829 3300005328 Bacteria 869
9 Ga0070690_100073277 3300005330 Bacteria 2228
10 Ga0068869_100342083 3300005334 Bacteria 1218
11 Ga0068868_100089177 3300005338 Bacteria 2483
12 Ga0068868_100453204 3300005338 Bacteria 1116
13 Ga0070675_100329225 3300005354 Bacteria 1351
14 Ga0070675_100334760 3300005354 Bacteria 1340
15 Ga0070675_100342024 3300005354 Bacteria 1325
16 Ga0070674_100048776 3300005356 Bacteria 2907
17 Ga0070674_100446673 3300005356 Bacteria 1066
18 Ga0070688_100603136 3300005365 Bacteria 841
19 Ga0070659_100119499 3300005366 Bacteria 2133
20 Ga0070700_100091299 3300005441 Bacteria 1988
21 Ga0070678_100634275 3300005456 Bacteria 957
22 Ga0070681_10193110 3300005458 Bacteria 1955
23 Ga0068867_100021241 3300005459 Bacteria 4632
24 Ga0068867_100150817 3300005459 Bacteria 1826
25 Ga0070679_100150330 3300005530 Bacteria 2305
26 Ga0070679_100226504 3300005530 Bacteria 1829
27 Ga0070684_100006750 3300005535 Bacteria 8897
28 Ga0070684_100151982 3300005535 Bacteria 2097
29 Ga0070672_100034514 3300005543 Bacteria 3839
30 Ga0068855_100115475 3300005563 Bacteria 3077
31 Ga0068855_100153036 3300005563 Bacteria 2622
32 Ga0068855_100189555 3300005563 Bacteria 2320
33 Ga0068855_100342384 3300005563 Bacteria 1648
34 Ga0070664_101185396 3300005564 Bacteria 720
35 Ga0068857_100043994 3300005577 Bacteria 3960
36 Ga0070702_100289089 3300005615 Unclassified 1129
37 Ga0068852_100423892 3300005616 Bacteria 1313
38 Ga0068864_100577542 3300005618 Bacteria 1089
39 Ga0068870_10192040 3300005840 Bacteria 1233
40 Ga0068858_100102656 3300005842 Bacteria 2667
41 Ga0070712_100131376 3300006175 Bacteria 1898
42 Ga0070712_100482341 3300006175 Bacteria 1037
43 Ga0075367_10175862 3300006178 Bacteria 1334
44 Ga0097621_100006953 3300006237 Bacteria 8056
45 Ga0075430_100011427 3300006846 Bacteria 7539
46 Ga0075430_100157440 3300006846 Bacteria 1891
47 Ga0075430_100342532 3300006846 Bacteria 1235
48 Ga0075431_100016792 3300006847 Bacteria 7435
49 Ga0075431_100048023 3300006847 Bacteria 4402
50 Ga0075431_100061834 3300006847 Bacteria 3864
51 Ga0075431_100105477 3300006847 Bacteria 2908
52 Ga0075434_100073882 3300006871 Bacteria 3403
53 Ga0075429_100298827 3300006880 Bacteria 1410
54 Ga0068865_100010717 3300006881 Bacteria 5712
55 Ga0105240_10007412 3300009093 Bacteria 15941
56 Ga0105240_10240192 3300009093 Bacteria 2100
57 Ga0111539_10001343 3300009094 Bacteria 32787
58 Ga0111539_10075403 3300009094 Bacteria 3973
59 Ga0111539_10156890 3300009094 Bacteria 2663
60 Ga0111539_10509659 3300009094 Bacteria 1401
61 Ga0111539_12069377 3300009094 Unclassified 660
62 Ga0105245_10285250 3300009098 Bacteria 1615
63 Ga0105247_10013717 3300009101 Bacteria 4860
64 Ga0114129_10022618 3300009147 Bacteria 8916
65 Ga0114129_10648760 3300009147 Bacteria 1363
66 Ga0114129_10690881 3300009147 Bacteria 1312
67 Ga0105241_10002998 3300009174 Bacteria 12615
68 Ga0105242_10005324 3300009176 Bacteria 9942
69 Ga0105237_10025805 3300009545 Bacteria 6009
70 Ga0105237_10154493 3300009545 Bacteria 2291
71 Ga0105238_10001705 3300009551 Bacteria 22136
72 Ga0105238_10004139 3300009551 Bacteria 14390
73 Ga0105238_10068301 3300009551 Bacteria 3555
74 Ga0105238_10375470 3300009551 Bacteria 1413
75 Ga0105238_10639778 3300009551 Bacteria 1073
76 Ga0105249_10012779 3300009553 Bacteria 7405
77 Ga0105249_10633012 3300009553 Unclassified 1126
78 Ga0105239_10013028 3300010375 Bacteria 9246
79 Ga0105239_10023006 3300010375 Bacteria 6871
80 Ga0105239_10096810 3300010375 Bacteria 3260
81 Ga0105246_10391283 3300011119 Bacteria 1152
82 Ga0157373_10322422 3300013100 Bacteria 1099
83 Ga0157370_10614352 3300013104 Bacteria 995
84 Ga0157369_10042968 3300013105 Bacteria 4928
85 Ga0157374_10005496 3300013296 Bacteria 10644
86 Ga0157374_10085641 3300013296 Bacteria 2997
87 Ga0157378_10004413 3300013297 Bacteria 12386
88 Ga0163162_10030929 3300013306 Bacteria 5307
89 Ga0163162_10470929 3300013306 Bacteria 1388
90 Ga0157372_10666104 3300013307 Bacteria 1212
91 Ga0157375_10006730 3300013308 Bacteria 10011
92 Ga0157375_10099187 3300013308 Bacteria 2991
93 Ga0157375_10305459 3300013308 Bacteria 1755
94 Ga0163163_10460685 3300014325 Bacteria 1332
95 Ga0163163_10499293 3300014325 Bacteria 1278
96 Ga0163163_10986071 3300014325 Bacteria 906
97 Ga0157380_10034509 3300014326 Bacteria 3902
98 Ga0157380_10149947 3300014326 Bacteria 2014
99 Ga0157377_10010627 3300014745 Bacteria 4560
100 Ga0157377_10611959 3300014745 Bacteria 779
101 Ga0157379_10275291 3300014968 Bacteria 1531
102 Ga0207642_10401004 3300025899 Bacteria 821
103 Ga0207710_10025619 3300025900 Bacteria 2545
104 Ga0207688_10135559 3300025901 Unclassified 1446
105 Ga0207680_10247978 3300025903 Bacteria 1229
106 Ga0207645_10357089 3300025907 Bacteria 979
107 Ga0207705_10046490 3300025909 Bacteria 3119
108 Ga0207654_10117491 3300025911 Bacteria 1665
109 Ga0207707_10266857 3300025912 Bacteria 1484
110 Ga0207695_10013037 3300025913 Bacteria 9929
111 Ga0207695_10249734 3300025913 Bacteria 1674
112 Ga0207671_10088255 3300025914 Bacteria 2333
113 Ga0207662_10665730 3300025918 Unclassified 728
114 Ga0207657_10000992 3300025919 Bacteria 30122
115 Ga0207649_11042000 3300025920 Bacteria 644
116 Ga0207652_10240394 3300025921 Bacteria 1632
117 Ga0207681_10571379 3300025923 Bacteria 932
118 Ga0207694_10005903 3300025924 Bacteria 9387
119 Ga0207694_10006342 3300025924 Bacteria 9028
120 Ga0207694_10046406 3300025924 Bacteria 3358
121 Ga0207659_10035937 3300025926 Bacteria 3428
122 Ga0207687_10000521 3300025927 Bacteria 25789
123 Ga0207687_11045658 3300025927 Bacteria 701
124 Ga0207690_10085995 3300025932 Bacteria 2209
125 Ga0207706_10224284 3300025933 Bacteria 1645
126 Ga0207686_10001208 3300025934 Bacteria 14982
127 Ga0207709_10467507 3300025935 Bacteria 978
128 Ga0207669_10975740 3300025937 Unclassified 711
129 Ga0207704_10003784 3300025938 Bacteria 6891
130 Ga0207691_10040050 3300025940 Bacteria 4332
131 Ga0207691_10208049 3300025940 Bacteria 1701
132 Ga0207711_10002155 3300025941 Bacteria 17723
133 Ga0207661_10493829 3300025944 Bacteria 1118
134 Ga0207661_10768869 3300025944 Bacteria 887
135 Ga0207679_10079559 3300025945 Bacteria 2500
136 Ga0207667_10009419 3300025949 Bacteria 11503
137 Ga0207667_10110643 3300025949 Bacteria 2834
138 Ga0207667_10168526 3300025949 Bacteria 2251
139 Ga0207667_10337191 3300025949 Unclassified 1539
140 Ga0207651_10039405 3300025960 Bacteria 3116
141 Ga0207712_10006565 3300025961 Bacteria 7341
142 Ga0207677_10197202 3300026023 Bacteria 1597
143 Ga0207703_10233162 3300026035 Bacteria 1651
144 Ga0207703_10537735 3300026035 Bacteria 1101
145 Ga0207708_10201677 3300026075 Bacteria 1587
146 Ga0207702_10089876 3300026078 Bacteria 2686
147 Ga0207648_10028318 3300026089 Bacteria 4968
148 Ga0207648_10563923 3300026089 Bacteria 1047
149 Ga0207648_10667086 3300026089 Bacteria 962
150 Ga0207674_10055780 3300026116 Bacteria 4015
151 Ga0207674_10333775 3300026116 Bacteria 1466
152 Ga0207675_100238417 3300026118 Bacteria 1757
153 Ga0207675_101728438 3300026118 Bacteria 645
154 Ga0207683_10256784 3300026121 Unclassified 1595
155 Ga0207683_10512294 3300026121 Bacteria 1108
156 Ga0207683_10876688 3300026121 Bacteria 833
157 Ga0207698_10325752 3300026142 Bacteria 1441
158 Ga0207428_10036051 3300027907 Bacteria 4039
159 Ga0207428_10095648 3300027907 Bacteria 2301
160 Ga0268265_10776974 3300028380 Bacteria 932
161 Ga0265331_10082086 3300031250 Bacteria 1496
162 Ga0307408_100938287 3300031548 Bacteria 794
163 Ga0265314_10027374 3300031711 Bacteria 4269
164 Ga0265342_10032278 3300031712 Bacteria 3230
165 Ga0307410_10037680 3300031852 Bacteria 3161
166 Ga0307410_10227286 3300031852 Bacteria 1439
167 Ga0307407_10209221 3300031903 Bacteria 1312
168 Ga0307416_100052837 3300032002 Bacteria 3256
169 Ga0307416_100381277 3300032002 Bacteria 1440
170 Ga0307414_10548428 3300032004 Unclassified 1030
171 Ga0373936_0083097 3300035113 Bacteria 1335
172 Ga0373931_0066610 3300035691 Bacteria 1955
173 Ga0373937_1132961 3300036401 Bacteria 731
174 Ga0439453_0078737 3300041408 Unclassified 708
175 Ga0439448_0203857 3300042005 Bacteria 694
176 Ga0439435_0051598 3300042436 Bacteria 1179
177 Ga0439464_0084552 3300042439 Bacteria 951
178 Ga0451576_0626983 3300045051 Bacteria 1130
179 Ga0495598_0013035 3300046537 Bacteria 2053
180 Ga0495621_0135681 3300046539 Bacteria 960
181 Ga0495645_0226145 3300046543 Bacteria 1256
182 Ga0495659_0034283 3300046664 Bacteria 1785
183 Ga0495647_0047070 3300046681 Bacteria 1663
184 Ga0495674_0062871 3300047319 Bacteria 3231
185 Ga0495675_0076496 3300047444 Bacteria 2110
186 Ga0496109_0034490 3300048912 Bacteria 4558
187 Ga0496113_0057402 3300048916 Bacteria 2925
188 Ga0501031_0349121 3300049568 Unclassified 958
189 Ga0501036_0255022 3300049572 Bacteria 1470
190 Ga0501036_0355269 3300049572 Bacteria 1224
191 Ga0501037_0138163 3300049573 Bacteria 1745
192 Ga0501038_0289444 3300049574 Bacteria 1288
193 Ga0501039_0222765 3300049575 Bacteria 1483
194 Ga0501040_0056055 3300049576 Bacteria 2704
195 Ga0501041_0018251 3300049577 Bacteria 4179
196 Ga0501041_0056480 3300049577 Bacteria 2399
197 Ga0501042_0012175 3300049578 Bacteria 5821
198 Ga0501047_0035429 3300049581 Bacteria 4822
199 Ga0501047_0248616 3300049581 Bacteria 1627
200 Ga0501047_0457843 3300049581 Unclassified 1105
201 Ga0501048_0094741 3300049582 Bacteria 2106
202 Ga0501048_0477676 3300049582 Unclassified 893
203 Ga0501068_0091891 3300049584 Bacteria 1873
204 Ga0501072_0406156 3300049588 Bacteria 1080
205 Ga0501074_0151603 3300049590 Bacteria 1657
206 Ga0501075_0282320 3300049591 Bacteria 1265
207 Ga0501076_0121539 3300049592 Bacteria 2115
208 Ga0501077_0161021 3300049593 Bacteria 1425
209 Ga0501079_0210802 3300049741 Bacteria 1517
210 Ga0501080_0856563 3300049742 Bacteria 794
211 Ga0501081_0038189 3300049743 Bacteria 3279
212 Ga0501035_0314620 3300049822 Bacteria 1317
213 Ga0501045_0088607 3300049824 Bacteria 2286
214 nmdc:mga06z11_256179_c1 3300050494 Bacteria 1031
215 nmdc:mga09592_482785_c1 3300050508 Bacteria 1068
216 nmdc:mga0qj67_182629_c1 3300050509 Bacteria 1704
217 nmdc:mga0qj67_76519_c1 3300050509 Bacteria 2677
218 nmdc:mga06r32_101465_c1 3300050510 Bacteria 2824
219 nmdc:mga06r32_113352_c1 3300050510 Bacteria 2669
220 nmdc:mga06r32_222313_c1 3300050510 Bacteria 1876
221 nmdc:mga06r32_3710_c1 3300050510 Bacteria 13650
222 nmdc:mga08y16_103589_c1 3300050511 Bacteria 2963
223 nmdc:mga08y16_119274_c1 3300050511 Bacteria 2746
224 nmdc:mga08y16_20140_c1 3300050511 Bacteria 7040
225 nmdc:mga08y16_625085_c1 3300050511 Unclassified 1083
226 nmdc:mga0n895_173882_c1 3300050512 Bacteria 2185
227 Ga0501084_0141715 3300054114 Bacteria 2024
228 Ga0501082_0000152 3300060353 Bacteria 58259
229 Ga0501082_0091198 3300060353 Bacteria 2631
230 Ga0530510_0460691 3300061734 Bacteria 962
231 Ga0207661_10112506
232 Ga0065714_10147289
233 Ga0065712_10000736
234 Ga0065712_10269158
235 Ga0065715_10011918
236 Ga0065707_10091356
237 Ga0070658_10001759
238 Ga0070676_10491829
239 Ga0070690_100073277
240 Ga0068869_100342083
241 Ga0068868_100089177
242 Ga0068868_100453204
243 Ga0070675_100329225
244 Ga0070675_100334760
245 Ga0070675_100342024
246 Ga0070674_100048776
247 Ga0070674_100446673
248 Ga0070688_100603136
249 Ga0070659_100119499
250 Ga0070700_100091299
251 Ga0070678_100634275
252 Ga0070681_10193110
253 Ga0068867_100021241
254 Ga0068867_100150817
255 Ga0070679_100150330
256 Ga0070679_100226504
257 Ga0070684_100006750
258 Ga0070684_100151982
259 Ga0070672_100034514
260 Ga0068855_100115475
261 Ga0068855_100153036
262 Ga0068855_100189555
263 Ga0068855_100342384
264 Ga0070664_101185396
265 Ga0068857_100043994
266 Ga0070702_100289089
267 Ga0068852_100423892
268 Ga0068864_100577542
269 Ga0068870_10192040
270 Ga0068858_100102656
271 Ga0070712_100131376
272 Ga0070712_100482341
273 Ga0075367_10175862
274 Ga0097621_100006953
275 Ga0075430_100011427
276 Ga0075430_100157440
277 Ga0075430_100342532
278 Ga0075431_100016792
279 Ga0075431_100048023
280 Ga0075431_100061834
281 Ga0075431_100105477
282 Ga0075434_100073882
283 Ga0075429_100298827
284 Ga0068865_100010717
285 Ga0105240_10007412
286 Ga0105240_10240192
287 Ga0111539_10001343
288 Ga0111539_10075403
289 Ga0111539_10156890
290 Ga0111539_10509659
291 Ga0111539_12069377
292 Ga0105245_10285250
293 Ga0105247_10013717
294 Ga0114129_10022618
295 Ga0114129_10648760
296 Ga0114129_10690881
297 Ga0105241_10002998
298 Ga0105242_10005324
299 Ga0105237_10025805
300 Ga0105237_10154493
301 Ga0105238_10001705
302 Ga0105238_10004139
303 Ga0105238_10068301
304 Ga0105238_10375470
305 Ga0105238_10639778
306 Ga0105249_10012779
307 Ga0105249_10633012
308 Ga0105239_10013028
309 Ga0105239_10023006
310 Ga0105239_10096810
311 Ga0105246_10391283
312 Ga0157373_10322422
313 Ga0157370_10614352
314 Ga0157369_10042968
315 Ga0157374_10005496
316 Ga0157374_10085641
317 Ga0157378_10004413
318 Ga0163162_10030929
319 Ga0163162_10470929
320 Ga0157372_10666104
321 Ga0157375_10006730
322 Ga0157375_10099187
323 Ga0157375_10305459
324 Ga0163163_10460685
325 Ga0163163_10499293
326 Ga0163163_10986071
327 Ga0157380_10034509
328 Ga0157380_10149947
329 Ga0157377_10010627
330 Ga0157377_10611959
331 Ga0157379_10275291
332 Ga0207642_10401004
333 Ga0207710_10025619
334 Ga0207688_10135559
335 Ga0207680_10247978
336 Ga0207645_10357089
337 Ga0207705_10046490
338 Ga0207654_10117491
339 Ga0207707_10266857
340 Ga0207695_10013037
341 Ga0207695_10249734
342 Ga0207671_10088255
343 Ga0207662_10665730
344 Ga0207657_10000992
345 Ga0207649_11042000
346 Ga0207652_10240394
347 Ga0207681_10571379
348 Ga0207694_10005903
349 Ga0207694_10006342
350 Ga0207694_10046406
351 Ga0207659_10035937
352 Ga0207687_10000521
353 Ga0207687_11045658
354 Ga0207690_10085995
355 Ga0207706_10224284
356 Ga0207686_10001208
357 Ga0207709_10467507
358 Ga0207669_10975740
359 Ga0207704_10003784
360 Ga0207691_10040050
361 Ga0207691_10208049
362 Ga0207711_10002155
363 Ga0207661_10493829
364 Ga0207661_10768869
365 Ga0207679_10079559
366 Ga0207667_10009419
367 Ga0207667_10110643
368 Ga0207667_10168526
369 Ga0207667_10337191
370 Ga0207651_10039405
371 Ga0207712_10006565
372 Ga0207677_10197202
373 Ga0207703_10233162
374 Ga0207703_10537735
375 Ga0207708_10201677
376 Ga0207702_10089876
377 Ga0207648_10028318
378 Ga0207648_10563923
379 Ga0207648_10667086
380 Ga0207674_10055780
381 Ga0207674_10333775
382 Ga0207675_100238417
383 Ga0207675_101728438
384 Ga0207683_10256784
385 Ga0207683_10512294
386 Ga0207683_10876688
387 Ga0207698_10325752
388 Ga0207428_10036051
389 Ga0207428_10095648
390 Ga0268265_10776974
391 Ga0265331_10082086
392 Ga0307408_100938287
393 Ga0265314_10027374
394 Ga0265342_10032278
395 Ga0307410_10037680
396 Ga0307410_10227286
397 Ga0307407_10209221
398 Ga0307416_100052837
399 Ga0307416_100381277
400 Ga0307414_10548428
401 Ga0373936_0083097
402 Ga0373931_0066610
403 Ga0373937_1132961
404 Ga0439453_0078737
405 Ga0439448_0203857
406 Ga0439435_0051598
407 Ga0439464_0084552
408 Ga0451576_0626983
409 Ga0495598_0013035
410 Ga0495621_0135681
411 Ga0495645_0226145
412 Ga0495659_0034283
413 Ga0495647_0047070
414 Ga0495674_0062871
415 Ga0495675_0076496
416 Ga0496109_0034490
417 Ga0496113_0057402
418 Ga0501031_0349121
419 Ga0501036_0255022
420 Ga0501036_0355269
421 Ga0501037_0138163
422 Ga0501038_0289444
423 Ga0501039_0222765
424 Ga0501040_0056055
425 Ga0501041_0018251
426 Ga0501041_0056480
427 Ga0501042_0012175
428 Ga0501047_0035429
429 Ga0501047_0248616
430 Ga0501047_0457843
431 Ga0501048_0094741
432 Ga0501048_0477676
433 Ga0501068_0091891
434 Ga0501072_0406156
435 Ga0501074_0151603
436 Ga0501075_0282320
437 Ga0501076_0121539
438 Ga0501077_0161021
439 Ga0501079_0210802
440 Ga0501080_0856563
441 Ga0501081_0038189
442 Ga0501035_0314620
443 Ga0501045_0088607
444 nmdc:mga06z11_256179_c1
445 nmdc:mga09592_482785_c1
446 nmdc:mga0qj67_182629_c1
447 nmdc:mga0qj67_76519_c1
448 nmdc:mga06r32_101465_c1
449 nmdc:mga06r32_113352_c1
450 nmdc:mga06r32_222313_c1
451 nmdc:mga06r32_3710_c1
452 nmdc:mga08y16_103589_c1
453 nmdc:mga08y16_119274_c1
454 nmdc:mga08y16_20140_c1
455 nmdc:mga08y16_625085_c1
456 nmdc:mga0n895_173882_c1
457 Ga0501084_0141715
458 Ga0501082_0000152
459 Ga0501082_0091198
460 Ga0530510_0460691

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ohi-assembly1.cif.gz_B crystal structure of the debrominase bmp8 (apo) 0.8009 14 163
6ohj-assembly1.cif.gz_B crystal structure of the debrominase bmp8 c82a in complex with 2,3,4-tribromopyrrole 0.7963 13 163
6e8l-assembly3.cif.gz_F crystal structure of alkyl hydroperoxidase d (ahpd) from streptococcus pneumoniae (strain d39/ nctc 7466) 0.7877 11 163
3lvy-assembly3.cif.gz_E crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans 0.7875 8 163
3lvy-assembly3.cif.gz_F crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans 0.7853 8 163
ID Description Score Start End Superfamily
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7789 19 158 1.20.1290.10
3lvyC01 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7655 8 163 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7594 19 158 1.20.1290.10
af_E7F0F7_35_189_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7319 2 159 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7175 29 160 1.20.1290.10
ID Description Score Start End GO Terms
AF-Q01N76-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9785 1 177
AF-A0A346MZ61-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9684 1 179
AF-A0A1H4AW90-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9683 1 175
AF-A0A1G6TDA2-F1-model_v4 Alkylhydroperoxidase AhpD family core domain-containing protein 0.9629 1 175
AF-A0A318EDH8-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9628 1 177

Map