F343028

General Info

Members Datasets Scaffolds Average Seq Length
230 148 228 324

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10107761|Ga0157372_101077612
Length 356
Sequence MEMRVVSHCEKRQKRLPSAFMRNQLDFEKPIVELQNKLAELKKHPETHSMDISFDEEVALIEKKIEEERRRIYSTLSAWDRVKIARHPKRPFTLDYLKLAFEDFAELHGDRLYSEDRAVVGGFAKLGEQRVMVIGTQKGRDTKENILRNFGSAHPEGYRKALRLMRMADKFGLPIITLIDTAGAYPGIGAEERHIAEAIAVNLREMMLFEVPILAAVIGEGGSGGALGIGVADRVLILENAYYSVISPEGCAAILWKDRSAAGKAAQALKIAAKDLLELKLVDEIVAEPLGGAHYDADKTAAILKEHLAKHLDELIKMSPEERLKGRYEKFRAFGHFEEKVAPVEAEVPQAGPAST

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
62 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
63 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
64 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
65 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
66 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
69 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
70 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
87 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 0
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 2.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10260211 3300003323 Bacteria 1270
2 Ga0055530_10005536 3300003791 Bacteria 5961
3 Ga0070658_10010263 3300005327 Bacteria 7510
4 Ga0068869_100000381 3300005334 Bacteria 24096
5 Ga0068868_100004979 3300005338 Bacteria 9331
6 Ga0068868_100110638 3300005338 Bacteria 2232
7 Ga0070689_100064841 3300005340 Bacteria 2844
8 Ga0070675_100084335 3300005354 Bacteria 2653
9 Ga0070688_100066366 3300005365 Bacteria 2296
10 Ga0070694_100106238 3300005444 Bacteria 1993
11 Ga0068867_100003532 3300005459 Bacteria 10992
12 Ga0070707_100374731 3300005468 Bacteria 1383
13 Ga0070698_100016887 3300005471 Bacteria 7697
14 Ga0070699_100000001 3300005518 Bacteria 910751
15 Ga0070679_100101475 3300005530 Bacteria 2864
16 Ga0070679_100200224 3300005530 Bacteria 1963
17 Ga0070679_100339747 3300005530 Bacteria 1450
18 Ga0070686_100002986 3300005544 Bacteria 9270
19 Ga0068855_100070336 3300005563 Bacteria 4071
20 Ga0068855_100240231 3300005563 Bacteria 2024
21 Ga0070664_100385944 3300005564 Bacteria 1279
22 Ga0068857_100014303 3300005577 Bacteria 6916
23 Ga0068857_100390873 3300005577 Bacteria 1293
24 Ga0068852_100568707 3300005616 Bacteria 1135
25 Ga0068859_100072061 3300005617 Bacteria 3491
26 Ga0068859_100184711 3300005617 Bacteria 2168
27 Ga0068864_100061057 3300005618 Bacteria 3265
28 Ga0068866_10093287 3300005718 Bacteria 1644
29 Ga0068863_100009640 3300005841 Bacteria 9421
30 Ga0070712_100414355 3300006175 Unclassified 1115
31 Ga0097621_100002164 3300006237 Bacteria 13447
32 Ga0068871_100044138 3300006358 Bacteria 3583
33 Ga0075428_100008404 3300006844 Bacteria 11446
34 Ga0075428_100044245 3300006844 Bacteria 4893
35 Ga0075431_100275734 3300006847 Bacteria 1703
36 Ga0075433_10007583 3300006852 Bacteria 8611
37 Ga0075434_100005544 3300006871 Bacteria 11498
38 Ga0068865_100001179 3300006881 Bacteria 15190
39 Ga0097620_100072063 3300006931 Bacteria 3491
40 Ga0097620_100184712 3300006931 Bacteria 2168
41 Ga0075435_100079577 3300007076 Bacteria 2690
42 Ga0099794_10028932 3300007265 Bacteria 2579
43 Ga0105240_10013184 3300009093 Bacteria 11370
44 Ga0105240_10125312 3300009093 Bacteria 3088
45 Ga0105245_10068307 3300009098 Bacteria 3220
46 Ga0105238_10448868 3300009551 Unclassified 1286
47 Ga0157372_10107761 3300013307 Unclassified 3188
48 Ga0163163_10016024 3300014325 Bacteria 6950
49 Ga0163163_10557244 3300014325 Bacteria 1209
50 Ga0182008_10085796 3300014497 Bacteria 1550
51 Ga0213875_10053166 3300021388 Bacteria 1897
52 Ga0209050_1000630 3300025298 Bacteria 54802
53 Ga0207642_10095453 3300025899 Bacteria 1480
54 Ga0207695_10321126 3300025913 Bacteria 1438
55 Ga0207652_10079086 3300025921 Bacteria 2872
56 Ga0207659_10228310 3300025926 Bacteria 1500
57 Ga0207686_10270123 3300025934 Bacteria 1251
58 Ga0207670_10006967 3300025936 Bacteria 6292
59 Ga0207704_10004059 3300025938 Bacteria 6673
60 Ga0207665_10282750 3300025939 Bacteria 1235
61 Ga0207689_10003877 3300025942 Bacteria 13628
62 Ga0207679_10244004 3300025945 Bacteria 1524
63 Ga0207667_10060507 3300025949 Bacteria 3963
64 Ga0207677_10002550 3300026023 Bacteria 9564
65 Ga0207641_10010974 3300026088 Bacteria 7426
66 Ga0207648_10008410 3300026089 Bacteria 9995
67 Ga0207674_10027960 3300026116 Bacteria 5959
68 Ga0207674_10167639 3300026116 Bacteria 2150
69 Ga0207428_10323122 3300027907 Bacteria 1139
70 Ga0265337_1001306 3300028556 Bacteria 12432
71 Ga0265319_1003559 3300028563 Bacteria 8078
72 Ga0265319_1007820 3300028563 Bacteria 4756
73 Ga0265319_1009214 3300028563 Bacteria 4229
74 Ga0265319_1016916 3300028563 Bacteria 2788
75 Ga0265318_10000004 3300028577 Bacteria 319325
76 Ga0265318_10001336 3300028577 Bacteria 14740
77 Ga0265323_10000052 3300028653 Bacteria 63341
78 Ga0265323_10003987 3300028653 Bacteria 6407
79 Ga0265323_10015585 3300028653 Bacteria 2986
80 Ga0265323_10041655 3300028653 Bacteria 1665
81 Ga0265322_10004045 3300028654 Bacteria 4393
82 Ga0265336_10002168 3300028666 Bacteria 8297
83 Ga0265338_10000177 3300028800 Bacteria 118670
84 Ga0265338_10000242 3300028800 Bacteria 101378
85 Ga0265338_10000856 3300028800 Bacteria 51432
86 Ga0265338_10001889 3300028800 Bacteria 32790
87 Ga0265338_10007464 3300028800 Bacteria 13558
88 Ga0265338_10013425 3300028800 Bacteria 9254
89 Ga0265338_10053719 3300028800 Bacteria 3600
90 Ga0265338_10079291 3300028800 Bacteria 2764
91 Ga0265338_10124466 3300028800 Bacteria 2048
92 Ga0265324_10000880 3300029957 Bacteria 19203
93 Ga0265324_10001613 3300029957 Bacteria 12547
94 Ga0265324_10007030 3300029957 Bacteria 4623
95 Ga0265332_10020981 3300031238 Bacteria 2885
96 Ga0265320_10001617 3300031240 Bacteria 16135
97 Ga0265320_10004509 3300031240 Bacteria 9113
98 Ga0265320_10009873 3300031240 Bacteria 5719
99 Ga0265320_10012496 3300031240 Bacteria 4936
100 Ga0265320_10021309 3300031240 Bacteria 3490
101 Ga0265320_10069896 3300031240 Bacteria 1656
102 Ga0265339_10012793 3300031249 Bacteria 5102
103 Ga0265339_10015443 3300031249 Bacteria 4576
104 Ga0265331_10006394 3300031250 Bacteria 6974
105 Ga0265327_10000092 3300031251 Bacteria 195619
106 Ga0265327_10000555 3300031251 Bacteria 63987
107 Ga0265316_10000244 3300031344 Bacteria 62621
108 Ga0265316_10040569 3300031344 Bacteria 3731
109 Ga0265316_10220483 3300031344 Bacteria 1400
110 Ga0307408_100000007 3300031548 Bacteria 463086
111 Ga0265313_10001136 3300031595 Bacteria 25421
112 Ga0265313_10004033 3300031595 Bacteria 11465
113 Ga0265314_10003791 3300031711 Bacteria 14437
114 Ga0265314_10005712 3300031711 Bacteria 11160
115 Ga0265342_10001587 3300031712 Bacteria 20980
116 Ga0265342_10088175 3300031712 Bacteria 1782
117 Ga0307405_10140918 3300031731 Bacteria 1681
118 Ga0316577_10088582 3300031733 Bacteria 1732
119 Ga0307410_10000172 3300031852 Bacteria 23629
120 Ga0307410_10245712 3300031852 Bacteria 1389
121 Ga0307412_10104678 3300031911 Bacteria 2008
122 Ga0307409_100000152 3300031995 Bacteria 26310
123 Ga0307416_100002672 3300032002 Bacteria 10320
124 Ga0307411_10094322 3300032005 Bacteria 2098
125 Ga0316583_10000367 3300032133 Bacteria 12955
126 Ga0373926_0045766 3300035083 Bacteria 1569
127 Ga0373943_0007324 3300035170 Bacteria 4953
128 Ga0373935_0001001 3300035692 Bacteria 15376
129 Ga0373927_0004597 3300035695 Bacteria 9622
130 Ga0373947_0016774 3300035725 Bacteria 4208
131 Ga0373925_0003282 3300037068 Bacteria 12581
132 Ga0395900_0008542 3300037418 Bacteria 10528
133 Ga0395900_0198106 3300037418 Bacteria 2034
134 Ga0395905_0000010 3300037471 Bacteria 460729
135 Ga0436364_1179497 3300037853 Bacteria 3968
136 Ga0436364_1460516 3300037853 Bacteria 8992
137 Ga0436360_0168014 3300039438 Bacteria 1642
138 Ga0436360_0986601 3300039438 Bacteria 2701
139 Ga0436361_0626111 3300039447 Bacteria 2075
140 Ga0436361_0783395 3300039447 Bacteria 1893
141 Ga0436362_0717366 3300039453 Bacteria 2318
142 Ga0436362_0755511 3300039453 Bacteria 1207
143 Ga0451577_0000025 3300042876 Bacteria 403632
144 Ga0451577_0000896 3300042876 Bacteria 44127
145 Ga0451577_0010296 3300042876 Bacteria 8952
146 Ga0451577_0023547 3300042876 Bacteria 5614
147 Ga0451577_0038157 3300042876 Bacteria 4321
148 Ga0451577_0144260 3300042876 Bacteria 2140
149 Ga0451577_0287509 3300042876 Bacteria 1490
150 Ga0453683_0000847 3300044673 Bacteria 29561
151 Ga0453683_0049360 3300044673 Bacteria 2638
152 Ga0466966_0130488 3300044684 Bacteria 1539
153 Ga0466961_0020618 3300044693 Bacteria 4242
154 Ga0453684_0000192 3300044712 Bacteria 266757
155 Ga0453684_0000221 3300044712 Bacteria 249908
156 Ga0453684_0000266 3300044712 Bacteria 225447
157 Ga0453684_0002956 3300044712 Bacteria 39829
158 Ga0453684_0009887 3300044712 Bacteria 16488
159 Ga0453684_0027190 3300044712 Bacteria 8215
160 Ga0453684_0055116 3300044712 Bacteria 5171
161 Ga0453684_0116409 3300044712 Bacteria 3237
162 Ga0453684_0117272 3300044712 Bacteria 3222
163 Ga0453684_0162712 3300044712 Bacteria 2638
164 Ga0466957_0146482 3300044842 Bacteria 1525
165 Ga0466959_0098548 3300045049 Bacteria 2094
166 Ga0451576_0000214 3300045051 Bacteria 144183
167 Ga0451576_0001987 3300045051 Bacteria 32437
168 Ga0451576_0034538 3300045051 Bacteria 5369
169 Ga0451576_0042820 3300045051 Bacteria 4781
170 Ga0451576_0043176 3300045051 Bacteria 4757
171 Ga0451576_0079897 3300045051 Bacteria 3403
172 Ga0451576_0123837 3300045051 Bacteria 2693
173 Ga0451576_0140639 3300045051 Bacteria 2517
174 Ga0451576_0144547 3300045051 Bacteria 2480
175 Ga0451576_0342050 3300045051 Bacteria 1566
176 Ga0451576_0360633 3300045051 Bacteria 1522
177 Ga0495592_0000101 3300046454 Bacteria 75856
178 Ga0495629_0011503 3300046459 Bacteria 6428
179 Ga0495641_0029867 3300046461 Unclassified 2621
180 Ga0495639_0010972 3300046475 Bacteria 3901
181 Ga0495662_0007723 3300046476 Bacteria 5297
182 Ga0495664_0015778 3300046477 Bacteria 4299
183 Ga0495628_0001128 3300046516 Bacteria 24354
184 Ga0495630_0048278 3300046517 Bacteria 3185
185 Ga0495630_0105064 3300046517 Bacteria 2138
186 Ga0495666_0064389 3300046526 Bacteria 1750
187 Ga0495586_0003123 3300046535 Bacteria 8909
188 Ga0495645_0040394 3300046543 Bacteria 3404
189 Ga0495634_0095589 3300046642 Unclassified 1925
190 Ga0495634_0097573 3300046642 Bacteria 1902
191 Ga0495635_0198108 3300046663 Bacteria 1363
192 Ga0495599_0016512 3300046678 Bacteria 4584
193 Ga0495599_0030456 3300046678 Bacteria 3385
194 Ga0495647_0018752 3300046681 Bacteria 2468
195 Ga0495647_0041556 3300046681 Unclassified 1751
196 Ga0495658_0076054 3300046683 Bacteria 1961
197 Ga0495613_0208657 3300046689 Unclassified 1374
198 Ga0495624_0002229 3300046690 Bacteria 14761
199 Ga0495581_0075074 3300047315 Bacteria 1956
200 Ga0495604_0220747 3300047317 Bacteria 1305
201 Ga0495674_0091909 3300047319 Bacteria 2592
202 Ga0495674_0263308 3300047319 Bacteria 1416
203 Ga0495676_0035784 3300047321 Bacteria 4151
204 Ga0495593_0194413 3300047673 Bacteria 1020
205 Ga0496126_0064610 3300048929 Bacteria 3278
206 Ga0501031_0132364 3300049568 Bacteria 1629
207 Ga0501032_0010057 3300049569 Bacteria 6830
208 Ga0501033_0004391 3300049570 Bacteria 11301
209 Ga0501033_0129134 3300049570 Bacteria 1832
210 Ga0501038_0001215 3300049574 Bacteria 23337
211 Ga0501039_0202815 3300049575 Bacteria 1559
212 Ga0501043_0072708 3300049579 Bacteria 2701
213 Ga0501043_0309242 3300049579 Bacteria 1206
214 Ga0501047_0126637 3300049581 Bacteria 2434
215 Ga0501047_0158022 3300049581 Bacteria 2139
216 Ga0501048_0041955 3300049582 Bacteria 3277
217 Ga0501075_0058305 3300049591 Bacteria 2908
218 Ga0501035_0019684 3300049822 Bacteria 6203
219 Ga0501035_0296759 3300049822 Bacteria 1363
220 Ga0501044_0007094 3300049823 Bacteria 12331
221 Ga0501044_0019867 3300049823 Bacteria 7175
222 Ga0501045_0051774 3300049824 Bacteria 2997
223 nmdc:mga06r32_118422_c1 3300050510 Bacteria 2611
224 nmdc:mga0n895_110493_c1 3300050512 Bacteria 2765
225 nmdc:mga0a205_13947_c2 3300050515 Bacteria 6177
226 nmdc:mga0sz30_80007_c1 3300050516 Bacteria 1413
227 Ga0495601_0045638 3300053077 Bacteria 2756
228 Ga0500568_0004238 3300053139 Bacteria 7714

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047673 Ga0495593_0194413 Ga0495593_0194413_176_997 243
2 3300046459 Ga0495629_0011503 Ga0495629_0011503_2242_3201 284
3 3300046475 Ga0495639_0010972 Ga0495639_0010972_1625_2584 284
4 3300047315 Ga0495581_0075074 Ga0495581_0075074_408_1367 284
5 3300047321 Ga0495676_0035784 Ga0495676_0035784_1833_2792 284
6 3300049579 Ga0501043_0309242 Ga0501043_0309242_61_1056 291
7 3300049822 Ga0501035_0296759 Ga0501035_0296759_331_1326 291
8 3300044842 Ga0466957_0146482 Ga0466957_0146482_115_1071 293
9 3300021388 Ga0213875_10053166 Ga0213875_100531662 296
10 3300037853 Ga0436364_1179497 Ga0436364_1179497_2271_3227 296
11 3300005444 Ga0070694_100106238 Ga0070694_1001062382 298
12 3300005471 Ga0070698_100016887 Ga0070698_1000168876 298
13 3300005518 Ga0070699_100000001 Ga0070699_100000001575 298
14 3300006847 Ga0075431_100275734 Ga0075431_1002757342 298
15 3300042876 Ga0451577_0038157 Ga0451577_0038157_667_1647 300
16 3300044712 Ga0453684_0000221 Ga0453684_0000221_74336_75316 300
17 3300003791 Ga0055530_10005536 Ga0055530_100055365 301
18 3300025298 Ga0209050_1000630 Ga0209050_100063034 301
19 3300006852 Ga0075433_10007583 Ga0075433_100075836 302
20 3300006871 Ga0075434_100005544 Ga0075434_1000055444 302
21 3300007076 Ga0075435_100079577 Ga0075435_1000795772 302
22 3300014325 Ga0163163_10016024 Ga0163163_100160244 302
23 3300050512 nmdc:mga0n895_110493_c1 nmdc:mga0n895_110493_c1_1223_2185 302
24 3300050515 nmdc:mga0a205_13947_c2 nmdc:mga0a205_13947_c2_3497_4459 302
25 3300025939 Ga0207665_10282750 Ga0207665_102827501 303
26 3300031731 Ga0307405_10140918 Ga0307405_101409182 303
27 3300031852 Ga0307410_10245712 Ga0307410_102457122 303
28 3300005544 Ga0070686_100002986 Ga0070686_1000029865 304
29 3300028800 Ga0265338_10079291 Ga0265338_100792912 304
30 3300028800 Ga0265338_10124466 Ga0265338_101244662 304
31 3300005577 Ga0068857_100014303 Ga0068857_1000143034 305
32 3300006175 Ga0070712_100414355 Ga0070712_1004143551 305
33 3300026116 Ga0207674_10027960 Ga0207674_100279604 305
34 3300045051 Ga0451576_0042820 Ga0451576_0042820_3727_4716 305
35 3300046461 Ga0495641_0029867 Ga0495641_0029867_148_1134 305
36 3300046642 Ga0495634_0095589 Ga0495634_0095589_673_1659 305
37 3300046681 Ga0495647_0041556 Ga0495647_0041556_215_1201 305
38 3300046683 Ga0495658_0076054 Ga0495658_0076054_265_1251 305
39 3300046689 Ga0495613_0208657 Ga0495613_0208657_321_1307 305
40 3300028800 Ga0265338_10000242 Ga0265338_1000024218 306
41 3300031344 Ga0265316_10220483 Ga0265316_102204831 306
42 3300044712 Ga0453684_0009887 Ga0453684_0009887_120_1106 306
43 3300049570 Ga0501033_0129134 Ga0501033_0129134_686_1696 306
44 3300042876 Ga0451577_0287509 Ga0451577_0287509_334_1326 307
45 3300045051 Ga0451576_0144547 Ga0451576_0144547_931_1923 307
46 3300049568 Ga0501031_0132364 Ga0501031_0132364_106_1113 307
47 3300049569 Ga0501032_0010057 Ga0501032_0010057_22_1029 307
48 3300049579 Ga0501043_0072708 Ga0501043_0072708_1616_2623 307
49 3300049822 Ga0501035_0019684 Ga0501035_0019684_216_1223 307
50 3300049823 Ga0501044_0019867 Ga0501044_0019867_327_1334 307
51 3300028653 Ga0265323_10041655 Ga0265323_100416552 309
52 3300031733 Ga0316577_10088582 Ga0316577_100885822 309
53 3300007265 Ga0099794_10028932 Ga0099794_100289322 310
54 3300042876 Ga0451577_0000896 Ga0451577_0000896_42935_43927 310
55 3300044712 Ga0453684_0002956 Ga0453684_0002956_99_1091 310
56 3300045051 Ga0451576_0079897 Ga0451576_0079897_137_1150 310
57 3300047317 Ga0495604_0220747 Ga0495604_0220747_193_1182 310
58 3300053077 Ga0495601_0045638 Ga0495601_0045638_188_1177 310
59 3300005354 Ga0070675_100084335 Ga0070675_1000843352 311
60 3300005564 Ga0070664_100385944 Ga0070664_1003859442 311
61 3300025926 Ga0207659_10228310 Ga0207659_102283102 311
62 3300025945 Ga0207679_10244004 Ga0207679_102440042 311
63 3300046678 Ga0495599_0030456 Ga0495599_0030456_406_1437 312
64 3300005468 Ga0070707_100374731 Ga0070707_1003747311 314
65 3300031251 Ga0265327_10000555 Ga0265327_100005557 314
66 3300039438 Ga0436360_0168014 Ga0436360_0168014_510_1478 314
67 3300039453 Ga0436362_0717366 Ga0436362_0717366_718_1692 314
68 3300046681 Ga0495647_0018752 Ga0495647_0018752_594_1577 314
69 iso_pu_bacteria 3000017691 3000019891 315
70 3300028653 Ga0265323_10015585 Ga0265323_100155853 317
71 3300031240 Ga0265320_10069896 Ga0265320_100698962 317
72 3300044673 Ga0453683_0049360 Ga0453683_0049360_1639_2592 317
73 3300045051 Ga0451576_0001987 Ga0451576_0001987_3213_4166 317
74 3300005616 Ga0068852_100568707 Ga0068852_1005687072 318
75 3300014325 Ga0163163_10557244 Ga0163163_105572441 318
76 3300014497 Ga0182008_10085796 Ga0182008_100857962 318
77 3300028577 Ga0265318_10001336 Ga0265318_100013363 318
78 3300031240 Ga0265320_10001617 Ga0265320_100016175 318
79 3300031711 Ga0265314_10003791 Ga0265314_100037915 318
80 3300039447 Ga0436361_0783395 Ga0436361_0783395_116_1072 318
81 3300044712 Ga0453684_0162712 Ga0453684_0162712_894_1928 318
82 3300046663 Ga0495635_0198108 Ga0495635_0198108_99_1055 318
83 3300048929 Ga0496126_0064610 Ga0496126_0064610_2233_3189 318
84 3300050516 nmdc:mga0sz30_80007_c1 nmdc:mga0sz30_80007_c1_190_1146 318
85 3300032133 Ga0316583_10000367 Ga0316583_100003674 320
86 3300039453 Ga0436362_0755511 Ga0436362_0755511_188_1162 320
87 3300042876 Ga0451577_0023547 Ga0451577_0023547_4537_5538 320
88 3300046454 Ga0495592_0000101 Ga0495592_0000101_33774_34769 320
89 3300046476 Ga0495662_0007723 Ga0495662_0007723_2679_3674 320
90 3300046477 Ga0495664_0015778 Ga0495664_0015778_1198_2193 320
91 3300046516 Ga0495628_0001128 Ga0495628_0001128_20472_21467 320
92 3300046517 Ga0495630_0048278 Ga0495630_0048278_2032_3027 320
93 3300046526 Ga0495666_0064389 Ga0495666_0064389_123_1118 320
94 3300046535 Ga0495586_0003123 Ga0495586_0003123_5031_6026 320
95 3300046543 Ga0495645_0040394 Ga0495645_0040394_1376_2371 320
96 3300046642 Ga0495634_0097573 Ga0495634_0097573_370_1365 320
97 3300046678 Ga0495599_0016512 Ga0495599_0016512_1701_2696 320
98 3300046690 Ga0495624_0002229 Ga0495624_0002229_11025_12020 320
99 3300047319 Ga0495674_0091909 Ga0495674_0091909_178_1173 320
100 3300049591 Ga0501075_0058305 Ga0501075_0058305_1027_1989 320
101 3300006844 Ga0075428_100044245 Ga0075428_1000442454 321
102 3300031238 Ga0265332_10020981 Ga0265332_100209813 321
103 3300031249 Ga0265339_10012793 Ga0265339_100127933 321
104 3300031344 Ga0265316_10000244 Ga0265316_1000024440 321
105 3300031712 Ga0265342_10001587 Ga0265342_1000158718 321
106 3300037418 Ga0395900_0008542 Ga0395900_0008542_4150_5115 321
107 3300005340 Ga0070689_100064841 Ga0070689_1000648412 322
108 3300005530 Ga0070679_100200224 Ga0070679_1002002243 322
109 3300005530 Ga0070679_100339747 Ga0070679_1003397472 322
110 3300005563 Ga0068855_100070336 Ga0068855_1000703363 322
111 3300005563 Ga0068855_100240231 Ga0068855_1002402311 322
112 3300005617 Ga0068859_100072061 Ga0068859_1000720612 322
113 3300005617 Ga0068859_100184711 Ga0068859_1001847112 322
114 3300005618 Ga0068864_100061057 Ga0068864_1000610572 322
115 3300005841 Ga0068863_100009640 Ga0068863_1000096409 322
116 3300006931 Ga0097620_100072063 Ga0097620_1000720632 322
117 3300006931 Ga0097620_100184712 Ga0097620_1001847122 322
118 3300009093 Ga0105240_10013184 Ga0105240_100131844 322
119 3300009093 Ga0105240_10125312 Ga0105240_101253123 322
120 3300009098 Ga0105245_10068307 Ga0105245_100683073 322
121 3300009551 Ga0105238_10448868 Ga0105238_104488681 322
122 3300013307 Ga0157372_10107761 Ga0157372_101077612 322
123 3300025913 Ga0207695_10321126 Ga0207695_103211261 322
124 3300025934 Ga0207686_10270123 Ga0207686_102701231 322
125 3300025949 Ga0207667_10060507 Ga0207667_100605072 322
126 3300026088 Ga0207641_10010974 Ga0207641_100109747 322
127 3300026116 Ga0207674_10167639 Ga0207674_101676391 322
128 3300028556 Ga0265337_1001306 Ga0265337_10013063 322
129 3300028563 Ga0265319_1009214 Ga0265319_10092145 322
130 3300028563 Ga0265319_1016916 Ga0265319_10169162 322
131 3300028653 Ga0265323_10000052 Ga0265323_1000005223 322
132 3300028654 Ga0265322_10004045 Ga0265322_100040454 322
133 3300028666 Ga0265336_10002168 Ga0265336_100021686 322
134 3300028800 Ga0265338_10000177 Ga0265338_100001771 322
135 3300028800 Ga0265338_10000856 Ga0265338_1000085646 322
136 3300028800 Ga0265338_10001889 Ga0265338_1000188923 322
137 3300028800 Ga0265338_10007464 Ga0265338_100074644 322
138 3300028800 Ga0265338_10013425 Ga0265338_1001342510 322
139 3300028800 Ga0265338_10053719 Ga0265338_100537193 322
140 3300029957 Ga0265324_10000880 Ga0265324_100008802 322
141 3300029957 Ga0265324_10001613 Ga0265324_100016137 322
142 3300031240 Ga0265320_10021309 Ga0265320_100213092 322
143 3300031249 Ga0265339_10015443 Ga0265339_100154434 322
144 3300031344 Ga0265316_10040569 Ga0265316_100405695 322
145 3300031712 Ga0265342_10088175 Ga0265342_100881752 322
146 3300035083 Ga0373926_0045766 Ga0373926_0045766_36_1058 322
147 3300035170 Ga0373943_0007324 Ga0373943_0007324_212_1234 322
148 3300035692 Ga0373935_0001001 Ga0373935_0001001_13438_14460 322
149 3300035695 Ga0373927_0004597 Ga0373927_0004597_4943_5965 322
150 3300035725 Ga0373947_0016774 Ga0373947_0016774_403_1425 322
151 3300037068 Ga0373925_0003282 Ga0373925_0003282_465_1487 322
152 3300037418 Ga0395900_0198106 Ga0395900_0198106_811_1803 322
153 3300037853 Ga0436364_1460516 Ga0436364_1460516_7049_8032 322
154 3300039438 Ga0436360_0986601 Ga0436360_0986601_1174_2154 322
155 3300039447 Ga0436361_0626111 Ga0436361_0626111_576_1556 322
156 3300044712 Ga0453684_0116409 Ga0453684_0116409_1951_2964 322
157 3300046517 Ga0495630_0105064 Ga0495630_0105064_369_1391 322
158 3300047319 Ga0495674_0263308 Ga0495674_0263308_203_1195 322
159 3300050510 nmdc:mga06r32_118422_c1 nmdc:mga06r32_118422_c1_156_1145 322
160 iso_pu_bacteria 2786546940 2788436454 322
161 3300005365 Ga0070688_100066366 Ga0070688_1000663662 323
162 3300025936 Ga0207670_10006967 Ga0207670_100069672 323
163 3300029957 Ga0265324_10007030 Ga0265324_100070306 323
164 3300042876 Ga0451577_0010296 Ga0451577_0010296_4452_5513 323
165 3300044712 Ga0453684_0000192 Ga0453684_0000192_70704_71765 323
166 3300044712 Ga0453684_0000266 Ga0453684_0000266_26856_27875 323
167 3300028577 Ga0265318_10000004 Ga0265318_1000000491 324
168 3300031240 Ga0265320_10004509 Ga0265320_100045094 324
169 3300031250 Ga0265331_10006394 Ga0265331_100063943 324
170 3300031251 Ga0265327_10000092 Ga0265327_10000092172 324
171 3300031595 Ga0265313_10001136 Ga0265313_1000113612 324
172 3300031711 Ga0265314_10005712 Ga0265314_100057125 324
173 3300042876 Ga0451577_0000025 Ga0451577_0000025_245116_246090 324
174 3300042876 Ga0451577_0144260 Ga0451577_0144260_973_1947 324
175 3300045051 Ga0451576_0342050 Ga0451576_0342050_225_1199 324
176 3300045051 Ga0451576_0360633 Ga0451576_0360633_323_1297 324
177 3300053139 Ga0500568_0004238 Ga0500568_0004238_6730_7704 324
178 3300005577 Ga0068857_100390873 Ga0068857_1003908732 325
179 3300044712 Ga0453684_0055116 Ga0453684_0055116_2489_3505 325
180 3300003323 rootH1_10260211 rootH1_102602111 326
181 3300005327 Ga0070658_10010263 Ga0070658_100102636 326
182 3300005334 Ga0068869_100000381 Ga0068869_10000038112 326
183 3300005338 Ga0068868_100004979 Ga0068868_1000049793 326
184 3300005338 Ga0068868_100110638 Ga0068868_1001106383 326
185 3300005459 Ga0068867_100003532 Ga0068867_10000353214 326
186 3300005530 Ga0070679_100101475 Ga0070679_1001014752 326
187 3300005718 Ga0068866_10093287 Ga0068866_100932872 326
188 3300006237 Ga0097621_100002164 Ga0097621_1000021646 326
189 3300006358 Ga0068871_100044138 Ga0068871_1000441382 326
190 3300006844 Ga0075428_100008404 Ga0075428_1000084044 326
191 3300006881 Ga0068865_100001179 Ga0068865_10000117913 326
192 3300025899 Ga0207642_10095453 Ga0207642_100954531 326
193 3300025921 Ga0207652_10079086 Ga0207652_100790863 326
194 3300025938 Ga0207704_10004059 Ga0207704_100040593 326
195 3300025942 Ga0207689_10003877 Ga0207689_1000387713 326
196 3300026023 Ga0207677_10002550 Ga0207677_1000255010 326
197 3300026089 Ga0207648_10008410 Ga0207648_100084107 326
198 3300027907 Ga0207428_10323122 Ga0207428_103231221 326
199 3300028563 Ga0265319_1003559 Ga0265319_10035593 326
200 3300028563 Ga0265319_1007820 Ga0265319_10078205 326
201 3300028653 Ga0265323_10003987 Ga0265323_100039874 326
202 3300031240 Ga0265320_10009873 Ga0265320_100098735 326
203 3300031240 Ga0265320_10012496 Ga0265320_100124965 326
204 3300031548 Ga0307408_100000007 Ga0307408_1000000079 326
205 3300031595 Ga0265313_10004033 Ga0265313_100040338 326
206 3300031852 Ga0307410_10000172 Ga0307410_100001723 326
207 3300031911 Ga0307412_10104678 Ga0307412_101046781 326
208 3300031995 Ga0307409_100000152 Ga0307409_10000015221 326
209 3300032002 Ga0307416_100002672 Ga0307416_1000026724 326
210 3300032005 Ga0307411_10094322 Ga0307411_100943221 326
211 3300037471 Ga0395905_0000010 Ga0395905_0000010_353349_354329 326
212 3300044673 Ga0453683_0000847 Ga0453683_0000847_27480_28460 326
213 3300044684 Ga0466966_0130488 Ga0466966_0130488_431_1411 326
214 3300044693 Ga0466961_0020618 Ga0466961_0020618_2632_3612 326
215 3300044712 Ga0453684_0027190 Ga0453684_0027190_1697_2677 326
216 3300044712 Ga0453684_0117272 Ga0453684_0117272_1253_2233 326
217 3300045049 Ga0466959_0098548 Ga0466959_0098548_310_1290 326
218 3300045051 Ga0451576_0000214 Ga0451576_0000214_103372_104352 326
219 3300045051 Ga0451576_0034538 Ga0451576_0034538_1573_2553 326
220 3300045051 Ga0451576_0043176 Ga0451576_0043176_673_1653 326
221 3300045051 Ga0451576_0123837 Ga0451576_0123837_307_1287 326
222 3300045051 Ga0451576_0140639 Ga0451576_0140639_907_1887 326
223 3300049570 Ga0501033_0004391 Ga0501033_0004391_4177_5157 326
224 3300049574 Ga0501038_0001215 Ga0501038_0001215_8115_9095 326
225 3300049575 Ga0501039_0202815 Ga0501039_0202815_405_1385 326
226 3300049581 Ga0501047_0126637 Ga0501047_0126637_586_1566 326
227 3300049581 Ga0501047_0158022 Ga0501047_0158022_743_1723 326
228 3300049582 Ga0501048_0041955 Ga0501048_0041955_447_1427 326
229 3300049823 Ga0501044_0007094 Ga0501044_0007094_7403_8383 326
230 3300049824 Ga0501045_0051774 Ga0501045_0051774_571_1551 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

24

335

0.98

PF01039

Carboxyl_trans

Carboxyl transferase domain

58

318

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9y-assembly1.cif.gz_A-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9472 8 313
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.946 7 320
5kdr-assembly1.cif.gz_A-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.9434 8 320
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9429 7 320
2f9i-assembly1.cif.gz_A crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9417 7 320
ID Description Score Start End Superfamily
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9559 7 320 3.90.226.10
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.953 7 320 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9264 56 317 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9193 56 317 3.90.226.10
4l6lY00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8661 10 47 1.10.287.310
ID Description Score Start End GO Terms
AF-A0A080K7Q6-F1-model_v4 deleted 0.9822 193 283
AF-A0A659QMM8-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9808 177 282 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A7C6HFE7-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9787 56 313 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-J9CS08-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.9784 192 319 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-Q1YGC9-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9782 8 316 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295

Feature Viewer

pLDDT pTM Quality
90.2 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map