F343018

General Info

Members Datasets Scaffolds Average Seq Length
230 167 460 394

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10068109|Ga0157370_100681092
Length 435
Sequence VSCWKLRLPSGRRGPDDNPAGADAEPPASTIWQYCLTMTAAFRKLPGFRRNRPVSLPGVSATARMDKRTKNLTKRLRSGDIAVIDHTDLDRVSAEALIQHEVAAVVNAAVSISGRYPNMGPQLLLEAGIPLVDDVGPDLFEHVREGQPVRLDGGTLYDGDEVLAKGTVQDADSVRSAMAAAKAGLADQLKAFAANTIEYISRDSEMLIEGGIRPPELRTAMEGKHVLVIARGYRHRDDLLALRAYIREFKPVMVAVDGGADALLEAGYKPDLIVGDMDSVSDDALAGGAELAVHAYPNGVAPGLTRVQDLGLPSVLCPATGTSEDLAVLLADELGATLIVAVGMRFSMAEFLEKGRAGMASAVLTRMKVGDKIVDAKGVSRLYRSRISGWALFTLVLAALVAVLAAASVSGAIKVLIGFFLAEWDTFTYWLTGLF

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
80 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
115 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
145 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
146 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
147 2643221711 Terrabacter sp. Root85 Isolate Unclassified
148 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
149 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
150 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
151 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
152 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
153 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
154 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
155 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
156 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
157 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
158 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
159 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
160 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
161 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
162 2891562705 Microbispora tritici MT50 Isolate Unclassified
163 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
164 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
165 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
166 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
167 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.26
Metatranscriptomes 2.17
Isolates 9.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.57
Rhizosphere 81.74
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10068109 3300013104 Bacteria 3364
2 Ga0070658_10001000 3300005327 Bacteria 24258
3 Ga0070658_10009704 3300005327 Bacteria 7729
4 Ga0070658_10013941 3300005327 Bacteria 6453
5 Ga0070658_10231842 3300005327 Bacteria 1563
6 Ga0070683_100045024 3300005329 Bacteria 4073
7 Ga0070680_100003108 3300005336 Bacteria 12321
8 Ga0070682_100139718 3300005337 Bacteria 1649
9 Ga0068868_100006265 3300005338 Bacteria 8415
10 Ga0070659_100001157 3300005366 Bacteria 19271
11 Ga0070667_100016726 3300005367 Bacteria 6071
12 Ga0070709_10013895 3300005434 Bacteria 4539
13 Ga0070714_100002240 3300005435 Bacteria 14227
14 Ga0070714_100139994 3300005435 Bacteria 2171
15 Ga0070714_100158280 3300005435 Bacteria 2047
16 Ga0070713_100071219 3300005436 Bacteria 2937
17 Ga0070708_100001980 3300005445 Bacteria 15775
18 Ga0070708_100049652 3300005445 Bacteria 3713
19 Ga0070708_100083570 3300005445 Bacteria 2895
20 Ga0070681_10011145 3300005458 Bacteria 8896
21 Ga0070706_100005000 3300005467 Bacteria 12679
22 Ga0070706_100029209 3300005467 Bacteria 5080
23 Ga0070706_100089357 3300005467 Bacteria 2856
24 Ga0070707_100013878 3300005468 Bacteria 7544
25 Ga0070707_100024037 3300005468 Bacteria 5767
26 Ga0070707_100061950 3300005468 Bacteria 3588
27 Ga0070698_100000528 3300005471 Bacteria 40773
28 Ga0070698_100050245 3300005471 Bacteria 4252
29 Ga0070679_100004127 3300005530 Bacteria 13386
30 Ga0070679_100005181 3300005530 Bacteria 12063
31 Ga0070684_100124519 3300005535 Bacteria 2320
32 Ga0070684_100130546 3300005535 Bacteria 2266
33 Ga0070686_100103968 3300005544 Bacteria 1923
34 Ga0068855_100239704 3300005563 Bacteria 2027
35 Ga0068857_100122525 3300005577 Bacteria 2342
36 Ga0068856_100055403 3300005614 Bacteria 3913
37 Ga0068852_100391022 3300005616 Bacteria 1366
38 Ga0068858_100044759 3300005842 Bacteria 4102
39 Ga0081455_10084840 3300005937 Bacteria 2584
40 Ga0070717_10097105 3300006028 Bacteria 2496
41 Ga0070717_10124183 3300006028 Bacteria 2214
42 Ga0070717_10290713 3300006028 Unclassified 1451
43 Ga0070712_100103171 3300006175 Bacteria 2114
44 Ga0075428_100002402 3300006844 Bacteria 20332
45 Ga0075430_100018673 3300006846 Bacteria 5901
46 Ga0075431_100015894 3300006847 Bacteria 7633
47 Ga0075431_100035269 3300006847 Bacteria 5149
48 Ga0075429_100013895 3300006880 Bacteria 6983
49 Ga0105245_10130741 3300009098 Bacteria 2354
50 Ga0105247_10078503 3300009101 Bacteria 2077
51 Ga0114129_10014034 3300009147 Bacteria 11412
52 Ga0105242_10193300 3300009176 Bacteria 1803
53 Ga0105238_10162301 3300009551 Bacteria 2210
54 Ga0105249_10285852 3300009553 Bacteria 1649
55 Ga0157369_10001724 3300013105 Bacteria 26620
56 Ga0157369_10019875 3300013105 Bacteria 7514
57 Ga0157369_10241861 3300013105 Bacteria 1885
58 Ga0157374_10033122 3300013296 Bacteria 4712
59 Ga0157372_10228820 3300013307 Bacteria 2155
60 Ga0163163_10041264 3300014325 Bacteria 4511
61 Ga0157376_10107370 3300014969 Bacteria 2450
62 Ga0197907_11240422 3300020069 Bacteria 4123
63 Ga0206356_11128427 3300020070 Bacteria 1722
64 Ga0206353_10422245 3300020082 Bacteria 3286
65 Ga0206353_12059007 3300020082 Bacteria 5931
66 Ga0213875_10000499 3300021388 Bacteria 32899
67 Ga0224712_10037060 3300022467 Bacteria 1812
68 Ga0207692_10016915 3300025898 Bacteria 3242
69 Ga0207685_10007501 3300025905 Bacteria 3044
70 Ga0207699_10050372 3300025906 Bacteria 2455
71 Ga0207705_10003121 3300025909 Bacteria 12632
72 Ga0207705_10011270 3300025909 Bacteria 6479
73 Ga0207705_10212344 3300025909 Bacteria 1468
74 Ga0207684_10002464 3300025910 Bacteria 18638
75 Ga0207684_10047508 3300025910 Bacteria 3640
76 Ga0207684_10073961 3300025910 Bacteria 2894
77 Ga0207707_10001324 3300025912 Bacteria 23015
78 Ga0207707_10032456 3300025912 Bacteria 4571
79 Ga0207693_10116544 3300025915 Bacteria 2097
80 Ga0207660_10019528 3300025917 Bacteria 4531
81 Ga0207660_10045319 3300025917 Bacteria 3098
82 Ga0207660_10219944 3300025917 Bacteria 1490
83 Ga0207657_10070228 3300025919 Bacteria 2969
84 Ga0207652_10003495 3300025921 Bacteria 12952
85 Ga0207652_10007137 3300025921 Bacteria 9010
86 Ga0207646_10004475 3300025922 Bacteria 15148
87 Ga0207646_10147887 3300025922 Bacteria 2117
88 Ga0207700_10155345 3300025928 Bacteria 1895
89 Ga0207664_10009455 3300025929 Bacteria 6843
90 Ga0207664_10083455 3300025929 Bacteria 2604
91 Ga0207664_10127425 3300025929 Bacteria 2139
92 Ga0207690_10002621 3300025932 Bacteria 10832
93 Ga0207661_10095302 3300025944 Bacteria 2488
94 Ga0207677_10046214 3300026023 Bacteria 2914
95 Ga0207677_10057621 3300026023 Bacteria 2669
96 Ga0207703_10011802 3300026035 Bacteria 6801
97 Ga0207678_10091387 3300026067 Bacteria 2601
98 Ga0207702_10018031 3300026078 Bacteria 5842
99 Ga0207674_10135674 3300026116 Bacteria 2423
100 Ga0207683_10201076 3300026121 Bacteria 1811
101 Ga0265336_10001635 3300028666 Bacteria 9928
102 Ga0265338_10004968 3300028800 Bacteria 17609
103 Ga0307405_10018773 3300031731 Bacteria 3823
104 Ga0307410_10002615 3300031852 Bacteria 8762
105 Ga0307410_10150603 3300031852 Bacteria 1731
106 Ga0307406_10031733 3300031901 Bacteria 3219
107 Ga0307407_10059294 3300031903 Bacteria 2228
108 Ga0307409_100047751 3300031995 Bacteria 3252
109 Ga0307409_100052897 3300031995 Bacteria 3117
110 Ga0307409_100078532 3300031995 Bacteria 2656
111 Ga0307416_100027202 3300032002 Bacteria 4231
112 Ga0307416_100314518 3300032002 Bacteria 1564
113 Ga0307411_10022147 3300032005 Bacteria 3735
114 Ga0307415_100122274 3300032126 Bacteria 1954
115 Ga0373926_0001431 3300035083 Bacteria 7255
116 Ga0373934_0015313 3300035086 Bacteria 2909
117 Ga0373955_0203054 3300035172 Bacteria 1180
118 Ga0373931_0159358 3300035691 Bacteria 1322
119 Ga0373935_0001343 3300035692 Bacteria 13621
120 Ga0373935_0219017 3300035692 Bacteria 1321
121 Ga0373947_0000032 3300035725 Bacteria 72445
122 Ga0395900_0061195 3300037418 Bacteria 3872
123 Ga0395900_0259453 3300037418 Bacteria 1736
124 Ga0395898_0030999 3300037466 Bacteria 5347
125 Ga0395898_0445584 3300037466 Bacteria 1233
126 Ga0436364_1148384 3300037853 Bacteria 1746
127 Ga0436364_1386442 3300037853 Bacteria 37433
128 Ga0436364_1541853 3300037853 Bacteria 1785
129 Ga0436364_1553152 3300037853 Bacteria 4281
130 Ga0395901_0003926 3300038443 Bacteria 14954
131 Ga0395901_0022214 3300038443 Bacteria 6501
132 Ga0451853_1196794 3300041512 Bacteria 2665
133 Ga0466966_0013449 3300044684 Bacteria 5417
134 Ga0466966_0021634 3300044684 Bacteria 4223
135 Ga0466961_0010425 3300044693 Bacteria 5930
136 Ga0466961_0115853 3300044693 Bacteria 1684
137 Ga0466957_0038363 3300044842 Bacteria 2886
138 Ga0466957_0048362 3300044842 Bacteria 2585
139 Ga0466960_0032107 3300044901 Bacteria 2428
140 Ga0466960_0095094 3300044901 Bacteria 1525
141 Ga0466958_0004501 3300045836 Bacteria 7363
142 Ga0466958_0198291 3300045836 Bacteria 1277
143 Ga0466967_0019851 3300045976 Bacteria 5415
144 Ga0495627_018137 3300046453 Bacteria 2381
145 Ga0495592_0026883 3300046454 Bacteria 4362
146 Ga0495629_0018999 3300046459 Bacteria 4915
147 Ga0495629_0095344 3300046459 Bacteria 2076
148 Ga0495651_0003976 3300046462 Bacteria 11299
149 Ga0495653_0052360 3300046463 Bacteria 3128
150 Ga0495664_0039282 3300046477 Bacteria 2796
151 Ga0495664_0074750 3300046477 Bacteria 2027
152 Ga0495585_0099486 3300046492 Bacteria 1557
153 Ga0495608_0064232 3300046511 Bacteria 2406
154 Ga0495628_0045516 3300046516 Bacteria 3488
155 Ga0495630_0141344 3300046517 Bacteria 1830
156 Ga0495640_0076895 3300046533 Bacteria 2226
157 Ga0495587_0066489 3300046536 Bacteria 2102
158 Ga0495645_0049437 3300046543 Bacteria 3062
159 Ga0495667_0036262 3300046559 Bacteria 3292
160 Ga0495667_0187812 3300046559 Bacteria 1325
161 Ga0495634_0060429 3300046642 Bacteria 2521
162 Ga0495635_0077591 3300046663 Bacteria 2275
163 Ga0495657_0019900 3300046675 Bacteria 4835
164 Ga0495646_0051640 3300046680 Bacteria 2487
165 Ga0495647_0024379 3300046681 Bacteria 2202
166 Ga0495600_0100700 3300046809 Bacteria 1883
167 Ga0495604_0030456 3300047317 Bacteria 4285
168 Ga0495674_0062007 3300047319 Bacteria 3256
169 Ga0495674_0168048 3300047319 Bacteria 1832
170 Ga0495676_0124168 3300047321 Bacteria 1873
171 Ga0495680_0036199 3300047322 Bacteria 3965
172 Ga0495675_0026721 3300047444 Bacteria 3680
173 Ga0495684_0002094 3300047471 Bacteria 16010
174 Ga0496100_0040033 3300048903 Bacteria 2979
175 Ga0496100_0080741 3300048903 Bacteria 2195
176 Ga0496101_0005615 3300048904 Bacteria 8000
177 Ga0496102_0011852 3300048905 Bacteria 7525
178 Ga0496102_0069036 3300048905 Bacteria 3244
179 Ga0496102_0249889 3300048905 Bacteria 1672
180 Ga0496103_0015985 3300048906 Bacteria 4476
181 Ga0496104_0022391 3300048907 Bacteria 5804
182 Ga0496104_0099856 3300048907 Bacteria 2778
183 Ga0496104_0130216 3300048907 Bacteria 2417
184 Ga0496105_0027697 3300048908 Bacteria 4631
185 Ga0496105_0031891 3300048908 Bacteria 4321
186 Ga0496105_0050582 3300048908 Bacteria 3432
187 Ga0496108_0029410 3300048911 Bacteria 4549
188 Ga0496109_0047784 3300048912 Bacteria 3892
189 Ga0496109_0176562 3300048912 Bacteria 2005
190 Ga0496110_0048050 3300048913 Bacteria 3739
191 Ga0496110_0095328 3300048913 Bacteria 2665
192 Ga0496111_0050751 3300048914 Bacteria 2993
193 Ga0496111_0107487 3300048914 Bacteria 2054
194 Ga0496112_0081572 3300048915 Bacteria 3199
195 Ga0496114_0064495 3300048917 Bacteria 3067
196 Ga0496118_0037254 3300048921 Bacteria 3918
197 Ga0496119_0042370 3300048922 Bacteria 2887
198 Ga0496122_0001610 3300048925 Bacteria 35298
199 Ga0496125_0004984 3300048928 Bacteria 15012
200 Ga0501036_0005318 3300049572 Bacteria 10414
201 Ga0501047_0000107 3300049581 Bacteria 102041
202 Ga0501047_0025979 3300049581 Bacteria 5631
203 Ga0501048_0158357 3300049582 Bacteria 1602
204 nmdc:mga05p37_64648_c1 3300050507 Bacteria 4502
205 nmdc:mga0qj67_17473_c1 3300050509 Bacteria 5454
206 nmdc:mga06r32_198_c1 3300050510 Bacteria 26154
207 Ga0495601_0027954 3300053077 Bacteria 3490
208 Ga0495595_0037186 3300053084 Bacteria 2212
209 2623498643 2622736605 Bacteria 4992138
210 2644610974 2643221711 Bacteria 4865335
211 2676484547 2675903059 Bacteria 8644972
212 2776375076 2775506925 Bacteria 7237746
213 2799186524 2799112218 Bacteria 4315149
214 2812365397 2811994880 Bacteria 4147780
215 2812375194 2811994882 Bacteria 4688362
216 2816426729 2816332119 Bacteria 8120218
217 2819666824 2818991458 Bacteria 4794049
218 2819691945 2818991462 Bacteria 4320267
219 2819729273 2818991469 Bacteria 4644110
220 2856741649 2856741275 Bacteria 8096094
221 2863072263 2863067949 Bacteria 8541735
222 2873319347 2873314349 Bacteria 8512634
223 2891400715 2891395885 Bacteria 9251614
224 2891560789 2891554331 Bacteria 8812224
225 2891563315 2891562705 Bacteria 8039471
226 3003009585 3002998708 Bacteria 11715108
227 8053954038 8053945823 Bacteria 8962862
228 8055066511 8055066027 Bacteria 9479577
229 8055179805 8055172936 Bacteria 9305943
230 8056212929 8056207758 Bacteria 8639239
231 Ga0157370_10068109
232 Ga0070658_10001000
233 Ga0070658_10009704
234 Ga0070658_10013941
235 Ga0070658_10231842
236 Ga0070683_100045024
237 Ga0070680_100003108
238 Ga0070682_100139718
239 Ga0068868_100006265
240 Ga0070659_100001157
241 Ga0070667_100016726
242 Ga0070709_10013895
243 Ga0070714_100002240
244 Ga0070714_100139994
245 Ga0070714_100158280
246 Ga0070713_100071219
247 Ga0070708_100001980
248 Ga0070708_100049652
249 Ga0070708_100083570
250 Ga0070681_10011145
251 Ga0070706_100005000
252 Ga0070706_100029209
253 Ga0070706_100089357
254 Ga0070707_100013878
255 Ga0070707_100024037
256 Ga0070707_100061950
257 Ga0070698_100000528
258 Ga0070698_100050245
259 Ga0070679_100004127
260 Ga0070679_100005181
261 Ga0070684_100124519
262 Ga0070684_100130546
263 Ga0070686_100103968
264 Ga0068855_100239704
265 Ga0068857_100122525
266 Ga0068856_100055403
267 Ga0068852_100391022
268 Ga0068858_100044759
269 Ga0081455_10084840
270 Ga0070717_10097105
271 Ga0070717_10124183
272 Ga0070717_10290713
273 Ga0070712_100103171
274 Ga0075428_100002402
275 Ga0075430_100018673
276 Ga0075431_100015894
277 Ga0075431_100035269
278 Ga0075429_100013895
279 Ga0105245_10130741
280 Ga0105247_10078503
281 Ga0114129_10014034
282 Ga0105242_10193300
283 Ga0105238_10162301
284 Ga0105249_10285852
285 Ga0157369_10001724
286 Ga0157369_10019875
287 Ga0157369_10241861
288 Ga0157374_10033122
289 Ga0157372_10228820
290 Ga0163163_10041264
291 Ga0157376_10107370
292 Ga0197907_11240422
293 Ga0206356_11128427
294 Ga0206353_10422245
295 Ga0206353_12059007
296 Ga0213875_10000499
297 Ga0224712_10037060
298 Ga0207692_10016915
299 Ga0207685_10007501
300 Ga0207699_10050372
301 Ga0207705_10003121
302 Ga0207705_10011270
303 Ga0207705_10212344
304 Ga0207684_10002464
305 Ga0207684_10047508
306 Ga0207684_10073961
307 Ga0207707_10001324
308 Ga0207707_10032456
309 Ga0207693_10116544
310 Ga0207660_10019528
311 Ga0207660_10045319
312 Ga0207660_10219944
313 Ga0207657_10070228
314 Ga0207652_10003495
315 Ga0207652_10007137
316 Ga0207646_10004475
317 Ga0207646_10147887
318 Ga0207700_10155345
319 Ga0207664_10009455
320 Ga0207664_10083455
321 Ga0207664_10127425
322 Ga0207690_10002621
323 Ga0207661_10095302
324 Ga0207677_10046214
325 Ga0207677_10057621
326 Ga0207703_10011802
327 Ga0207678_10091387
328 Ga0207702_10018031
329 Ga0207674_10135674
330 Ga0207683_10201076
331 Ga0265336_10001635
332 Ga0265338_10004968
333 Ga0307405_10018773
334 Ga0307410_10002615
335 Ga0307410_10150603
336 Ga0307406_10031733
337 Ga0307407_10059294
338 Ga0307409_100047751
339 Ga0307409_100052897
340 Ga0307409_100078532
341 Ga0307416_100027202
342 Ga0307416_100314518
343 Ga0307411_10022147
344 Ga0307415_100122274
345 Ga0373926_0001431
346 Ga0373934_0015313
347 Ga0373955_0203054
348 Ga0373931_0159358
349 Ga0373935_0001343
350 Ga0373935_0219017
351 Ga0373947_0000032
352 Ga0395900_0061195
353 Ga0395900_0259453
354 Ga0395898_0030999
355 Ga0395898_0445584
356 Ga0436364_1148384
357 Ga0436364_1386442
358 Ga0436364_1541853
359 Ga0436364_1553152
360 Ga0395901_0003926
361 Ga0395901_0022214
362 Ga0451853_1196794
363 Ga0466966_0013449
364 Ga0466966_0021634
365 Ga0466961_0010425
366 Ga0466961_0115853
367 Ga0466957_0038363
368 Ga0466957_0048362
369 Ga0466960_0032107
370 Ga0466960_0095094
371 Ga0466958_0004501
372 Ga0466958_0198291
373 Ga0466967_0019851
374 Ga0495627_018137
375 Ga0495592_0026883
376 Ga0495629_0018999
377 Ga0495629_0095344
378 Ga0495651_0003976
379 Ga0495653_0052360
380 Ga0495664_0039282
381 Ga0495664_0074750
382 Ga0495585_0099486
383 Ga0495608_0064232
384 Ga0495628_0045516
385 Ga0495630_0141344
386 Ga0495640_0076895
387 Ga0495587_0066489
388 Ga0495645_0049437
389 Ga0495667_0036262
390 Ga0495667_0187812
391 Ga0495634_0060429
392 Ga0495635_0077591
393 Ga0495657_0019900
394 Ga0495646_0051640
395 Ga0495647_0024379
396 Ga0495600_0100700
397 Ga0495604_0030456
398 Ga0495674_0062007
399 Ga0495674_0168048
400 Ga0495676_0124168
401 Ga0495680_0036199
402 Ga0495675_0026721
403 Ga0495684_0002094
404 Ga0496100_0040033
405 Ga0496100_0080741
406 Ga0496101_0005615
407 Ga0496102_0011852
408 Ga0496102_0069036
409 Ga0496102_0249889
410 Ga0496103_0015985
411 Ga0496104_0022391
412 Ga0496104_0099856
413 Ga0496104_0130216
414 Ga0496105_0027697
415 Ga0496105_0031891
416 Ga0496105_0050582
417 Ga0496108_0029410
418 Ga0496109_0047784
419 Ga0496109_0176562
420 Ga0496110_0048050
421 Ga0496110_0095328
422 Ga0496111_0050751
423 Ga0496111_0107487
424 Ga0496112_0081572
425 Ga0496114_0064495
426 Ga0496118_0037254
427 Ga0496119_0042370
428 Ga0496122_0001610
429 Ga0496125_0004984
430 Ga0501036_0005318
431 Ga0501047_0000107
432 Ga0501047_0025979
433 Ga0501048_0158357
434 nmdc:mga05p37_64648_c1
435 nmdc:mga0qj67_17473_c1
436 nmdc:mga06r32_198_c1
437 Ga0495601_0027954
438 Ga0495595_0037186
439 2623498643
440 2644610974
441 2676484547
442 2776375076
443 2799186524
444 2812365397
445 2812375194
446 2816426729
447 2819666824
448 2819691945
449 2819729273
450 2856741649
451 2863072263
452 2873319347
453 2891400715
454 2891560789
455 2891563315
456 3003009585
457 8053954038
458 8055066511
459 8055179805
460 8056212929

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12555

SteA-like_C

SteA-like C-terminal domain

377

428

0.98

PF04263

TPK_catalytic

Thiamin pyrophosphokinase, catalytic domain

244

297

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sbo-assembly1.cif.gz_B structure of e.coli gdh from native source 0.7398 37 93
3t07-assembly1.cif.gz_C crystal structure of s. aureus pyruvate kinase in complex with a naturally occurring bis-indole alkaloid 0.7093 17 127
4bht-assembly1.cif.gz_D structural determinants of cofactor specificity and domain flexibility in bacterial glutamate dehydrogenases 0.6853 41 93
3lm8-assembly5.cif.gz_C crystal structure of thiamine pyrophosphokinase from bacillus subtilis, northeast structural genomics consortium target sr677 0.6816 183 313
3k94-assembly1.cif.gz_A crystal structure of thiamin pyrophosphokinase from geobacillus thermodenitrificans, northeast structural genomics consortium target gtr2 0.6799 184 313
ID Description Score Start End Superfamily
af_A0A1D6NML6_462_621_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7741 36 93 3.40.50.720
2yfhF03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7167 39 93 3.40.50.720
3t05A04 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Phosphohistidine domain 0.7072 17 126 3.50.30.10
af_Q8VCM8_1_150_3.40.50.2060 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Sec1/Munc18 (SM) protein, domain 1 0.7009 14 66 3.40.50.2060
5ib9A02 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; 0.6987 16 66 3.50.30.30
ID Description Score Start End GO Terms
AF-A0A356BX03-F1-model_v4 Uncharacterized protein 0.9893 20 94
AF-A0A2S9G425-F1-model_v4 Thiamine pyrophosphokinase 0.9827 42 124 GO:0016301
AF-A0A3B8JXS4-F1-model_v4 Uncharacterized protein 0.9823 20 95 GO:0016020
AF-W1VR64-F1-model_v4 deleted 0.9782 18 91
AF-A0A3C0XGL8-F1-model_v4 Uncharacterized protein 0.9777 25 92

Map