F342767

General Info

Members Datasets Scaffolds Average Seq Length
230 186 460 238

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100068451|Ga0070714_1000684514
Length 268
Sequence VGIRTLKTAARGCKTAFIRVPICLLTAYCIRMNLDIKIFADGADKAAMLELYGKPWISGFTTNPTLMRKAGVRDYEAFARDILVAIPDRPISLEVFADEFSEMERQARRIASWADNVYVKIPITNTRREPALDLICRLAHSGVKVNVTAILALAQVHDVVQALAGGAPACVSVFAGRIADTGVDPLPLMTAAVEMLRPHPGVELIWASPREVLNVVQANQIGCHIITVTSDILKKLDLLGRDLGEYSLDTVKMFYDDACRSGFELSED

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
129 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.96
Metatranscriptomes 3.04
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0
Rhizoplane 6.09
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 16.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100068451 3300005435 Bacteria 3063
2 MBSR1b_contig_3150975 2162886012 Bacteria 3062
3 JGI24743J22301_10005397 3300001991 Bacteria 2132
4 JGI24744J21845_10004177 3300002077 Bacteria 2979
5 Ga0065712_10096846 3300005290 Bacteria 2169
6 Ga0065715_10123113 3300005293 Bacteria 2186
7 Ga0070690_100086481 3300005330 Bacteria 2058
8 Ga0070670_100034777 3300005331 Unclassified 4337
9 Ga0070680_100089459 3300005336 Bacteria 2548
10 Ga0070682_100008853 3300005337 Bacteria 5683
11 Ga0068868_100051855 3300005338 Bacteria 3229
12 Ga0068868_100075866 3300005338 Bacteria 2687
13 Ga0068868_100391731 3300005338 Unclassified 1197
14 Ga0070660_100172295 3300005339 Bacteria 1748
15 Ga0070689_100294592 3300005340 Bacteria 1349
16 Ga0070661_100019633 3300005344 Bacteria 4816
17 Ga0070675_100167728 3300005354 Bacteria 1892
18 Ga0070675_100318644 3300005354 Unclassified 1373
19 Ga0070671_100037938 3300005355 Bacteria 3998
20 Ga0070674_100010097 3300005356 Bacteria 5688
21 Ga0070673_100434832 3300005364 Unclassified 1178
22 Ga0070688_100119407 3300005365 Bacteria 1763
23 Ga0070667_100063306 3300005367 Bacteria 3134
24 Ga0070714_100101128 3300005435 Bacteria 2540
25 Ga0070710_10388367 3300005437 Unclassified 933
26 Ga0070701_10047281 3300005438 Bacteria 2216
27 Ga0070711_100333617 3300005439 Unclassified 1215
28 Ga0070705_100254488 3300005440 Unclassified 1235
29 Ga0070700_100004637 3300005441 Bacteria 7200
30 Ga0070694_100116076 3300005444 Bacteria 1914
31 Ga0070663_100006399 3300005455 Bacteria 7081
32 Ga0070678_100004607 3300005456 Bacteria 7834
33 Ga0070662_100152554 3300005457 Bacteria 1800
34 Ga0068867_100041979 3300005459 Bacteria 3343
35 Ga0068867_100105181 3300005459 Bacteria 2161
36 Ga0070685_10028920 3300005466 Bacteria 3075
37 Ga0070706_100312282 3300005467 Bacteria 1466
38 Ga0070698_100060201 3300005471 Bacteria 3832
39 Ga0070698_100792859 3300005471 Unclassified 891
40 Ga0070699_100014008 3300005518 Bacteria 6898
41 Ga0070684_100001324 3300005535 Bacteria 17753
42 Ga0070684_100108322 3300005535 Unclassified 2489
43 Ga0070697_100005002 3300005536 Bacteria 10180
44 Ga0068853_100368751 3300005539 Bacteria 1339
45 Ga0070672_100546538 3300005543 Unclassified 1005
46 Ga0070686_100001301 3300005544 Bacteria 14093
47 Ga0070696_100081586 3300005546 Bacteria 2291
48 Ga0070665_100015608 3300005548 Bacteria 7629
49 Ga0070665_100439770 3300005548 Bacteria 1313
50 Ga0070704_100002475 3300005549 Bacteria 10380
51 Ga0070664_100001423 3300005564 Bacteria 19088
52 Ga0068857_100018623 3300005577 Bacteria 6093
53 Ga0068854_100239422 3300005578 Bacteria 1444
54 Ga0068856_100256253 3300005614 Unclassified 1765
55 Ga0068852_100121404 3300005616 Bacteria 2393
56 Ga0068852_100254330 3300005616 Unclassified 1684
57 Ga0068866_10003588 3300005718 Bacteria 6353
58 Ga0068858_100537526 3300005842 Unclassified 1131
59 Ga0068862_100039171 3300005844 Bacteria 4024
60 Ga0081540_1051200 3300005983 Bacteria 2044
61 Ga0070717_10002494 3300006028 Bacteria 12990
62 Ga0097621_100036885 3300006237 Bacteria 3913
63 Ga0075428_100004174 3300006844 Bacteria 15901
64 Ga0075428_100282294 3300006844 Bacteria 1786
65 Ga0075430_100075061 3300006846 Bacteria 2835
66 Ga0075431_100000173 3300006847 Bacteria 45790
67 Ga0075433_10109514 3300006852 Bacteria 2450
68 Ga0075429_100060299 3300006880 Bacteria 3305
69 Ga0075429_100131531 3300006880 Bacteria 2189
70 Ga0068865_100000383 3300006881 Bacteria 24592
71 Ga0075436_100175572 3300006914 Bacteria 1513
72 Ga0105240_10027110 3300009093 Bacteria 7507
73 Ga0105240_10064468 3300009093 Bacteria 4552
74 Ga0111539_10191634 3300009094 Bacteria 2385
75 Ga0114129_10525315 3300009147 Bacteria 1542
76 Ga0114129_10617333 3300009147 Bacteria 1403
77 Ga0105243_10002898 3300009148 Bacteria 14202
78 Ga0105242_10003009 3300009176 Bacteria 13170
79 Ga0105248_10795399 3300009177 Unclassified 1067
80 Ga0105237_10532977 3300009545 Unclassified 1181
81 Ga0105238_10211374 3300009551 Bacteria 1916
82 Ga0105249_10007218 3300009553 Bacteria 9694
83 Ga0105239_10022105 3300010375 Bacteria 7011
84 Ga0105239_10697640 3300010375 Bacteria 1160
85 Ga0105239_11139112 3300010375 Unclassified 898
86 Ga0105246_10318187 3300011119 Bacteria 1263
87 Ga0157378_10024646 3300013297 Bacteria 5297
88 Ga0157378_10094594 3300013297 Bacteria 2721
89 Ga0163162_10024950 3300013306 Bacteria 5906
90 Ga0163162_10191619 3300013306 Bacteria 2172
91 Ga0163162_10390799 3300013306 Bacteria 1524
92 Ga0163162_10560943 3300013306 Bacteria 1270
93 Ga0157375_10694644 3300013308 Unclassified 1171
94 Ga0163163_10419556 3300014325 Bacteria 1397
95 Ga0157379_10149051 3300014968 Bacteria 2110
96 Ga0206350_11591093 3300020080 Bacteria 1069
97 Ga0213876_10003441 3300021384 Bacteria 9056
98 Ga0213875_10000106 3300021388 Bacteria 95400
99 Ga0213875_10056427 3300021388 Bacteria 1840
100 Ga0224712_10079196 3300022467 Bacteria 1352
101 Ga0207697_10000304 3300025315 Bacteria 27532
102 Ga0207692_10291482 3300025898 Unclassified 990
103 Ga0207642_10022590 3300025899 Bacteria 2498
104 Ga0207688_10004795 3300025901 Bacteria 7368
105 Ga0207684_10001512 3300025910 Bacteria 24934
106 Ga0207695_10043481 3300025913 Bacteria 4787
107 Ga0207695_10207915 3300025913 Bacteria 1869
108 Ga0207671_10352556 3300025914 Unclassified 1167
109 Ga0207693_10118766 3300025915 Bacteria 2076
110 Ga0207663_10355871 3300025916 Unclassified 1109
111 Ga0207660_10182414 3300025917 Bacteria 1631
112 Ga0207649_10002185 3300025920 Bacteria 11051
113 Ga0207646_10016113 3300025922 Bacteria 7024
114 Ga0207650_10080843 3300025925 Bacteria 2464
115 Ga0207650_10388519 3300025925 Bacteria 1153
116 Ga0207659_10061290 3300025926 Bacteria 2711
117 Ga0207659_10314749 3300025926 Unclassified 1290
118 Ga0207700_10052560 3300025928 Unclassified 3047
119 Ga0207664_10566650 3300025929 Bacteria 1019
120 Ga0207706_10287044 3300025933 Bacteria 1435
121 Ga0207686_10007921 3300025934 Bacteria 5729
122 Ga0207709_10001447 3300025935 Bacteria 16563
123 Ga0207670_10251950 3300025936 Bacteria 1365
124 Ga0207669_10006255 3300025937 Bacteria 5426
125 Ga0207711_10549101 3300025941 Unclassified 1078
126 Ga0207711_10908613 3300025941 Bacteria 818
127 Ga0207679_10000400 3300025945 Bacteria 31140
128 Ga0207679_10058527 3300025945 Bacteria 2856
129 Ga0207651_10372407 3300025960 Unclassified 1208
130 Ga0207712_10014445 3300025961 Bacteria 5081
131 Ga0207712_10050869 3300025961 Bacteria 2895
132 Ga0207712_10067263 3300025961 Bacteria 2564
133 Ga0207668_10017966 3300025972 Bacteria 4441
134 Ga0207640_10133937 3300025981 Bacteria 1796
135 Ga0207658_10187727 3300025986 Bacteria 1716
136 Ga0207658_10271649 3300025986 Bacteria 1449
137 Ga0207677_10084899 3300026023 Bacteria 2284
138 Ga0207677_10104687 3300026023 Bacteria 2092
139 Ga0207703_10506538 3300026035 Unclassified 1134
140 Ga0207639_10008034 3300026041 Bacteria 7211
141 Ga0207678_10041390 3300026067 Bacteria 3995
142 Ga0207678_10250258 3300026067 Bacteria 1517
143 Ga0207708_10001887 3300026075 Bacteria 15483
144 Ga0207708_10121533 3300026075 Bacteria 2035
145 Ga0207702_10218312 3300026078 Unclassified 1776
146 Ga0207648_10104922 3300026089 Unclassified 2479
147 Ga0207648_10186100 3300026089 Bacteria 1839
148 Ga0207674_10006456 3300026116 Bacteria 13785
149 Ga0207683_10010412 3300026121 Bacteria 7931
150 Ga0207698_10221284 3300026142 Unclassified 1711
151 Ga0265356_1002665 3300028017 Unclassified 2332
152 Ga0268266_10017197 3300028379 Bacteria 6175
153 Ga0268266_10057136 3300028379 Bacteria 3357
154 Ga0268265_10027804 3300028380 Bacteria 4041
155 Ga0265338_10003361 3300028800 Bacteria 22584
156 Ga0265770_1000330 3300030878 Bacteria 6457
157 Ga0265765_1000647 3300030879 Bacteria 2864
158 Ga0265760_10003076 3300031090 Bacteria 4869
159 Ga0265760_10042255 3300031090 Unclassified 1361
160 Ga0265760_10069951 3300031090 Unclassified 1075
161 Ga0265330_10000317 3300031235 Bacteria 34538
162 Ga0265332_10001593 3300031238 Bacteria 12435
163 Ga0265320_10039153 3300031240 Bacteria 2372
164 Ga0265329_10002813 3300031242 Bacteria 7769
165 Ga0265340_10043750 3300031247 Bacteria 2194
166 Ga0265339_10029394 3300031249 Bacteria 3118
167 Ga0265316_10000399 3300031344 Bacteria 49576
168 Ga0265314_10000532 3300031711 Bacteria 49131
169 Ga0265342_10000369 3300031712 Bacteria 49518
170 Ga0307405_10029775 3300031731 Unclassified 3194
171 Ga0307410_10034595 3300031852 Unclassified 3274
172 Ga0307407_10099893 3300031903 Unclassified 1798
173 Ga0307409_100002293 3300031995 Bacteria 9912
174 Ga0307416_100000555 3300032002 Bacteria 19054
175 Ga0307411_10052671 3300032005 Bacteria 2662
176 Ga0307415_100017154 3300032126 Bacteria 4335
177 Ga0373947_0354910 3300035725 Bacteria 984
178 Ga0395900_0322502 3300037418 Unclassified 1525
179 Ga0395900_0409397 3300037418 Unclassified 1319
180 Ga0436364_0737248 3300037853 Bacteria 154680
181 Ga0436364_1338500 3300037853 Bacteria 1305
182 Ga0436364_1424982 3300037853 Bacteria 2542
183 Ga0436365_0653044 3300039437 Bacteria 14043
184 Ga0436362_0504052 3300039453 Bacteria 6368
185 Ga0439433_0017097 3300041999 Bacteria 1609
186 Ga0451577_0040639 3300042876 Bacteria 4175
187 Ga0466963_0185679 3300044694 Bacteria 1452
188 Ga0453684_0026395 3300044712 Bacteria 8394
189 Ga0451576_0027913 3300045051 Bacteria 6055
190 Ga0451576_0564192 3300045051 Unclassified 1196
191 Ga0466958_0407927 3300045836 Bacteria 878
192 Ga0495629_0002437 3300046459 Bacteria 14277
193 Ga0495629_0375666 3300046459 Bacteria 968
194 Ga0495582_0175660 3300046473 Bacteria 1220
195 Ga0495662_0148755 3300046476 Bacteria 1153
196 Ga0495665_0040534 3300046531 Bacteria 2479
197 Ga0495598_0139947 3300046537 Bacteria 837
198 Ga0495599_0280767 3300046678 Bacteria 1009
199 Ga0495647_0143649 3300046681 Bacteria 1019
200 Ga0495581_0008805 3300047315 Bacteria 5841
201 Ga0495676_0456403 3300047321 Bacteria 842
202 Ga0496100_0003093 3300048903 Bacteria 8611
203 Ga0496101_0000715 3300048904 Bacteria 19830
204 Ga0496102_0007875 3300048905 Bacteria 9102
205 Ga0496103_0001917 3300048906 Bacteria 13507
206 Ga0496104_0133684 3300048907 Bacteria 2383
207 Ga0496106_0003844 3300048909 Bacteria 11193
208 Ga0496107_0062821 3300048910 Bacteria 2690
209 Ga0496108_0130424 3300048911 Bacteria 2161
210 Ga0496109_0002574 3300048912 Bacteria 15193
211 Ga0496110_0026021 3300048913 Bacteria 5003
212 Ga0496110_0154275 3300048913 Unclassified 2080
213 Ga0496112_0026104 3300048915 Bacteria 5617
214 Ga0496114_0001584 3300048917 Bacteria 17259
215 Ga0496115_0001697 3300048918 Bacteria 15784
216 Ga0501263_008295 3300049760 Bacteria 1237
217 nmdc:mga00v17_170124_c1 3300050491 Bacteria 1405
218 nmdc:mga05p37_1364339_c1 3300050507 Bacteria 717
219 nmdc:mga09592_89459_c1 3300050508 Bacteria 2630
220 nmdc:mga0qj67_26336_c1 3300050509 Bacteria 4501
221 nmdc:mga06r32_12024_c1 3300050510 Bacteria 7800
222 nmdc:mga06r32_224_c1 3300050510 Bacteria 45758
223 nmdc:mga06r32_317966_c1 3300050510 Bacteria 1542
224 nmdc:mga08y16_287955_c1 3300050511 Bacteria 1694
225 nmdc:mga08y16_331674_c1 3300050511 Bacteria 1565
226 nmdc:mga0rr50_28209_c1 3300050513 Bacteria 3943
227 nmdc:mga08x19_332067_c1 3300050514 Unclassified 1059
228 Ga0495601_0259253 3300053077 Bacteria 1135
229 Ga0500556_0177556 3300053104 Bacteria 841
230 Ga0466962_0076464 3300061719 Bacteria 1600
231 Ga0070714_100068451
232 MBSR1b_contig_3150975
233 JGI24743J22301_10005397
234 JGI24744J21845_10004177
235 Ga0065712_10096846
236 Ga0065715_10123113
237 Ga0070690_100086481
238 Ga0070670_100034777
239 Ga0070680_100089459
240 Ga0070682_100008853
241 Ga0068868_100051855
242 Ga0068868_100075866
243 Ga0068868_100391731
244 Ga0070660_100172295
245 Ga0070689_100294592
246 Ga0070661_100019633
247 Ga0070675_100167728
248 Ga0070675_100318644
249 Ga0070671_100037938
250 Ga0070674_100010097
251 Ga0070673_100434832
252 Ga0070688_100119407
253 Ga0070667_100063306
254 Ga0070714_100101128
255 Ga0070710_10388367
256 Ga0070701_10047281
257 Ga0070711_100333617
258 Ga0070705_100254488
259 Ga0070700_100004637
260 Ga0070694_100116076
261 Ga0070663_100006399
262 Ga0070678_100004607
263 Ga0070662_100152554
264 Ga0068867_100041979
265 Ga0068867_100105181
266 Ga0070685_10028920
267 Ga0070706_100312282
268 Ga0070698_100060201
269 Ga0070698_100792859
270 Ga0070699_100014008
271 Ga0070684_100001324
272 Ga0070684_100108322
273 Ga0070697_100005002
274 Ga0068853_100368751
275 Ga0070672_100546538
276 Ga0070686_100001301
277 Ga0070696_100081586
278 Ga0070665_100015608
279 Ga0070665_100439770
280 Ga0070704_100002475
281 Ga0070664_100001423
282 Ga0068857_100018623
283 Ga0068854_100239422
284 Ga0068856_100256253
285 Ga0068852_100121404
286 Ga0068852_100254330
287 Ga0068866_10003588
288 Ga0068858_100537526
289 Ga0068862_100039171
290 Ga0081540_1051200
291 Ga0070717_10002494
292 Ga0097621_100036885
293 Ga0075428_100004174
294 Ga0075428_100282294
295 Ga0075430_100075061
296 Ga0075431_100000173
297 Ga0075433_10109514
298 Ga0075429_100060299
299 Ga0075429_100131531
300 Ga0068865_100000383
301 Ga0075436_100175572
302 Ga0105240_10027110
303 Ga0105240_10064468
304 Ga0111539_10191634
305 Ga0114129_10525315
306 Ga0114129_10617333
307 Ga0105243_10002898
308 Ga0105242_10003009
309 Ga0105248_10795399
310 Ga0105237_10532977
311 Ga0105238_10211374
312 Ga0105249_10007218
313 Ga0105239_10022105
314 Ga0105239_10697640
315 Ga0105239_11139112
316 Ga0105246_10318187
317 Ga0157378_10024646
318 Ga0157378_10094594
319 Ga0163162_10024950
320 Ga0163162_10191619
321 Ga0163162_10390799
322 Ga0163162_10560943
323 Ga0157375_10694644
324 Ga0163163_10419556
325 Ga0157379_10149051
326 Ga0206350_11591093
327 Ga0213876_10003441
328 Ga0213875_10000106
329 Ga0213875_10056427
330 Ga0224712_10079196
331 Ga0207697_10000304
332 Ga0207692_10291482
333 Ga0207642_10022590
334 Ga0207688_10004795
335 Ga0207684_10001512
336 Ga0207695_10043481
337 Ga0207695_10207915
338 Ga0207671_10352556
339 Ga0207693_10118766
340 Ga0207663_10355871
341 Ga0207660_10182414
342 Ga0207649_10002185
343 Ga0207646_10016113
344 Ga0207650_10080843
345 Ga0207650_10388519
346 Ga0207659_10061290
347 Ga0207659_10314749
348 Ga0207700_10052560
349 Ga0207664_10566650
350 Ga0207706_10287044
351 Ga0207686_10007921
352 Ga0207709_10001447
353 Ga0207670_10251950
354 Ga0207669_10006255
355 Ga0207711_10549101
356 Ga0207711_10908613
357 Ga0207679_10000400
358 Ga0207679_10058527
359 Ga0207651_10372407
360 Ga0207712_10014445
361 Ga0207712_10050869
362 Ga0207712_10067263
363 Ga0207668_10017966
364 Ga0207640_10133937
365 Ga0207658_10187727
366 Ga0207658_10271649
367 Ga0207677_10084899
368 Ga0207677_10104687
369 Ga0207703_10506538
370 Ga0207639_10008034
371 Ga0207678_10041390
372 Ga0207678_10250258
373 Ga0207708_10001887
374 Ga0207708_10121533
375 Ga0207702_10218312
376 Ga0207648_10104922
377 Ga0207648_10186100
378 Ga0207674_10006456
379 Ga0207683_10010412
380 Ga0207698_10221284
381 Ga0265356_1002665
382 Ga0268266_10017197
383 Ga0268266_10057136
384 Ga0268265_10027804
385 Ga0265338_10003361
386 Ga0265770_1000330
387 Ga0265765_1000647
388 Ga0265760_10003076
389 Ga0265760_10042255
390 Ga0265760_10069951
391 Ga0265330_10000317
392 Ga0265332_10001593
393 Ga0265320_10039153
394 Ga0265329_10002813
395 Ga0265340_10043750
396 Ga0265339_10029394
397 Ga0265316_10000399
398 Ga0265314_10000532
399 Ga0265342_10000369
400 Ga0307405_10029775
401 Ga0307410_10034595
402 Ga0307407_10099893
403 Ga0307409_100002293
404 Ga0307416_100000555
405 Ga0307411_10052671
406 Ga0307415_100017154
407 Ga0373947_0354910
408 Ga0395900_0322502
409 Ga0395900_0409397
410 Ga0436364_0737248
411 Ga0436364_1338500
412 Ga0436364_1424982
413 Ga0436365_0653044
414 Ga0436362_0504052
415 Ga0439433_0017097
416 Ga0451577_0040639
417 Ga0466963_0185679
418 Ga0453684_0026395
419 Ga0451576_0027913
420 Ga0451576_0564192
421 Ga0466958_0407927
422 Ga0495629_0002437
423 Ga0495629_0375666
424 Ga0495582_0175660
425 Ga0495662_0148755
426 Ga0495665_0040534
427 Ga0495598_0139947
428 Ga0495599_0280767
429 Ga0495647_0143649
430 Ga0495581_0008805
431 Ga0495676_0456403
432 Ga0496100_0003093
433 Ga0496101_0000715
434 Ga0496102_0007875
435 Ga0496103_0001917
436 Ga0496104_0133684
437 Ga0496106_0003844
438 Ga0496107_0062821
439 Ga0496108_0130424
440 Ga0496109_0002574
441 Ga0496110_0026021
442 Ga0496110_0154275
443 Ga0496112_0026104
444 Ga0496114_0001584
445 Ga0496115_0001697
446 Ga0501263_008295
447 nmdc:mga00v17_170124_c1
448 nmdc:mga05p37_1364339_c1
449 nmdc:mga09592_89459_c1
450 nmdc:mga0qj67_26336_c1
451 nmdc:mga06r32_12024_c1
452 nmdc:mga06r32_224_c1
453 nmdc:mga06r32_317966_c1
454 nmdc:mga08y16_287955_c1
455 nmdc:mga08y16_331674_c1
456 nmdc:mga0rr50_28209_c1
457 nmdc:mga08x19_332067_c1
458 Ga0495601_0259253
459 Ga0500556_0177556
460 Ga0466962_0076464

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

38

265

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpx-assembly1.cif.gz_H crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.8879 8 222
1vpx-assembly2.cif.gz_M crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.8874 8 221
1vpx-assembly2.cif.gz_L crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.8805 8 223
1vpx-assembly2.cif.gz_N crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.8798 8 223
1vpx-assembly1.cif.gz_D crystal structure of transaldolase (ec 2.2.1.2) (tm0295) from thermotoga maritima at 2.40 a resolution 0.8775 8 225
ID Description Score Start End Superfamily
af_Q2FXE8_2_234_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9756 5 235 3.20.20.70
af_Q2FXE8_2_234_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9633 5 235 3.20.20.70
3r8rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8694 8 228 3.20.20.70
3r8rB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8616 8 228 3.20.20.70
1l6wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8275 8 235 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A382YD26-F1-model_v4 Transaldolase 0.9971 9 187 GO:0005975
AF-A0A383AHD2-F1-model_v4 Transaldolase 0.9942 18 115 GO:0005975
AF-A0A7V8T0R9-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.9925 1 111 GO:0004801
GO:0005975
AF-A0A1F3Y0P6-F1-model_v4 Transaldolase 0.9922 7 214 GO:0005975
AF-A0A383ER18-F1-model_v4 Transaldolase 0.9922 5 135 GO:0005975

Map