F341887

General Info

Members Datasets Scaffolds Average Seq Length
229 162 458 136

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10065244|Ga0075365_100652442
Length 141
Sequence MSREINLPEKPGRLDDGPFYHGTKADLHVGDLLTAGFKSNYRPEITMNHIYFTALVNGAGLAAELSSGTGRERVYIVEPTGEFENDPNVTDKKFPGNPTRSYRSREPLRIVGEVTDWERLTPEQLQIWRDRLANVKGDILN

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
43 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
44 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
45 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
49 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
100 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
104 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
105 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
106 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
110 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
129 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
130 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
131 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
132 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
133 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
134 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
135 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
136 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
137 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
138 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
141 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
142 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
143 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
146 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
147 2643221617 Nocardioides sp. Root79 Isolate Unclassified
148 2643221620 Nocardioides sp. Root240 Isolate Unclassified
149 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
150 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
151 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
152 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
153 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
154 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
155 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
156 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
157 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
158 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
159 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
160 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
161 3004167301 Mesorhizobium loti 582 Isolate Unclassified
162 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.7
Metatranscriptomes 0.44
Isolates 7.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 17.47
Nodule 0.44
Rhizoplane 1.31
Rhizosphere 69.87
Stem 0
Stem Tuber 0
Unclassified 2.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10065244 3300006038 Bacteria 2440
2 JGI24741J21665_1037466 3300001915 Bacteria 718
3 JGI25151J46595_10001770 3300003187 Bacteria 13976
4 JGI25153J46596_10001553 3300003215 Bacteria 13646
5 rootL2_10016286 3300003322 Bacteria 1374
6 rootL2_10162801 3300003322 Bacteria 2927
7 rootH1_10007118 3300003323 Bacteria 3126
8 JGI25404J52841_10115322 3300003659 Bacteria 565
9 Ga0055539_1003517 3300003752 Bacteria 2182
10 Ga0055530_10020403 3300003791 Bacteria 1980
11 Ga0055531_10055639 3300003794 Bacteria 1004
12 Ga0070669_100077006 3300005353 Bacteria 2477
13 Ga0070669_100228311 3300005353 Bacteria 1474
14 Ga0070667_100000062 3300005367 Bacteria 143729
15 Ga0070663_100025180 3300005455 Bacteria 4015
16 Ga0070663_100588498 3300005455 Bacteria 934
17 Ga0070663_100636690 3300005455 Bacteria 900
18 Ga0068853_100000870 3300005539 Bacteria 21105
19 Ga0068853_100006249 3300005539 Bacteria 9441
20 Ga0068853_100040047 3300005539 Bacteria 3997
21 Ga0068853_100122934 3300005539 Bacteria 2317
22 Ga0070665_100368583 3300005548 Bacteria 1443
23 Ga0070665_100435163 3300005548 Bacteria 1321
24 Ga0068855_100011833 3300005563 Bacteria 10548
25 Ga0068855_100154315 3300005563 Bacteria 2610
26 Ga0068855_100235753 3300005563 Bacteria 2046
27 Ga0068855_100588576 3300005563 Bacteria 1201
28 Ga0068857_100043022 3300005577 Bacteria 4007
29 Ga0068857_100353470 3300005577 Bacteria 1361
30 Ga0068857_100378453 3300005577 Bacteria 1314
31 Ga0068854_100019792 3300005578 Bacteria 4543
32 Ga0068854_100345955 3300005578 Bacteria 1215
33 Ga0068856_100349339 3300005614 Bacteria 1497
34 Ga0068852_100005181 3300005616 Bacteria 9297
35 Ga0068852_100167247 3300005616 Bacteria 2058
36 Ga0068851_10002682 3300005834 Bacteria 7840
37 Ga0068851_10342350 3300005834 Bacteria 868
38 Ga0068851_10386612 3300005834 Bacteria 821
39 Ga0068863_100000054 3300005841 Bacteria 124495
40 Ga0068860_100016315 3300005843 Bacteria 7242
41 Ga0068860_100263690 3300005843 Unclassified 1680
42 Ga0081455_10430230 3300005937 Bacteria 907
43 Ga0081540_1000158 3300005983 Bacteria 69951
44 Ga0075367_10434167 3300006178 Bacteria 832
45 Ga0075367_10437157 3300006178 Bacteria 829
46 Ga0075369_10191263 3300006186 Bacteria 943
47 Ga0075370_10167779 3300006353 Bacteria 1290
48 Ga0105240_10001847 3300009093 Bacteria 35457
49 Ga0105245_11373297 3300009098 Bacteria 756
50 Ga0105241_10001554 3300009174 Bacteria 17580
51 Ga0105241_10001769 3300009174 Bacteria 16389
52 Ga0105241_10384951 3300009174 Bacteria 1226
53 Ga0105237_10073532 3300009545 Bacteria 3410
54 Ga0105237_10161694 3300009545 Bacteria 2238
55 Ga0105238_10429939 3300009551 Bacteria 1316
56 Ga0105238_10729083 3300009551 Bacteria 1004
57 Ga0105238_11394839 3300009551 Bacteria 728
58 Ga0105239_10005711 3300010375 Bacteria 14529
59 Ga0105239_10094232 3300010375 Bacteria 3307
60 Ga0105239_10305731 3300010375 Unclassified 1791
61 Ga0157373_10082218 3300013100 Bacteria 2270
62 Ga0157369_12120283 3300013105 Unclassified 570
63 Ga0157374_10933636 3300013296 Bacteria 886
64 Ga0163162_10307662 3300013306 Bacteria 1717
65 Ga0157372_10146779 3300013307 Bacteria 2720
66 Ga0157372_12175678 3300013307 Bacteria 637
67 Ga0157380_10461346 3300014326 Bacteria 1223
68 Ga0182008_10071327 3300014497 Bacteria 1709
69 Ga0182007_10040194 3300015262 Bacteria 1562
70 Ga0182005_1023569 3300015265 Bacteria 1681
71 Ga0163161_10838731 3300017792 Bacteria 775
72 Ga0209563_104872 3300025230 Bacteria 2509
73 Ga0207427_100227 3300025231 Bacteria 47278
74 Ga0209677_119982 3300025253 Bacteria 789
75 Ga0209233_1014830 3300025261 Bacteria 2184
76 Ga0209676_1000759 3300025292 Bacteria 43492
77 Ga0209676_1008564 3300025292 Bacteria 4540
78 Ga0209025_1000321 3300025294 Bacteria 106686
79 Ga0209564_1001440 3300025295 Bacteria 24318
80 Ga0209758_1013218 3300025297 Bacteria 4531
81 Ga0209050_1050925 3300025298 Bacteria 1048
82 Ga0209050_1052204 3300025298 Bacteria 1025
83 Ga0209257_1001016 3300025304 Bacteria 37745
84 Ga0207647_10058915 3300025904 Bacteria 2351
85 Ga0207647_10241554 3300025904 Bacteria 1037
86 Ga0207705_10304447 3300025909 Bacteria 1223
87 Ga0207705_10508551 3300025909 Bacteria 936
88 Ga0207654_10000033 3300025911 Bacteria 115194
89 Ga0207654_10002456 3300025911 Bacteria 9439
90 Ga0207695_10002612 3300025913 Bacteria 26366
91 Ga0207695_10005710 3300025913 Bacteria 16405
92 Ga0207671_10025373 3300025914 Bacteria 4453
93 Ga0207671_10349348 3300025914 Bacteria 1173
94 Ga0207649_10112356 3300025920 Bacteria 1822
95 Ga0207681_10018907 3300025923 Bacteria 4346
96 Ga0207694_10457429 3300025924 Bacteria 1066
97 Ga0207667_10123188 3300025949 Bacteria 2671
98 Ga0207667_11335974 3300025949 Bacteria 692
99 Ga0207668_10030774 3300025972 Bacteria 3529
100 Ga0207640_10015123 3300025981 Bacteria 4460
101 Ga0207658_10000039 3300025986 Bacteria 143707
102 Ga0207639_10000943 3300026041 Bacteria 19681
103 Ga0207639_10241069 3300026041 Unclassified 1572
104 Ga0207639_10552209 3300026041 Bacteria 1058
105 Ga0207639_11024147 3300026041 Bacteria 773
106 Ga0207678_10014962 3300026067 Bacteria 6827
107 Ga0207678_10362095 3300026067 Bacteria 1252
108 Ga0207641_10000095 3300026088 Bacteria 124498
109 Ga0207674_10028381 3300026116 Bacteria 5907
110 Ga0207674_10057476 3300026116 Bacteria 3943
111 Ga0207674_11700799 3300026116 Bacteria 599
112 Ga0207698_10000893 3300026142 Bacteria 17331
113 Ga0207698_10002893 3300026142 Bacteria 10272
114 Ga0207698_10271216 3300026142 Bacteria 1564
115 Ga0268266_10405298 3300028379 Bacteria 1290
116 Ga0268264_10003566 3300028381 Bacteria 13397
117 Ga0265763_1022462 3300030763 Bacteria 672
118 Ga0265332_10009385 3300031238 Bacteria 4369
119 Ga0265325_10020300 3300031241 Bacteria 3663
120 Ga0265340_10008330 3300031247 Bacteria 5602
121 Ga0265339_10011632 3300031249 Bacteria 5408
122 Ga0265339_10014633 3300031249 Bacteria 4723
123 Ga0265331_10003950 3300031250 Bacteria 9369
124 Ga0307408_101990893 3300031548 Unclassified 558
125 Ga0265314_10041429 3300031711 Bacteria 3297
126 Ga0265342_10000360 3300031712 Bacteria 50461
127 Ga0307413_10335156 3300031824 Bacteria 1161
128 Ga0307410_10055203 3300031852 Bacteria 2696
129 Ga0307409_100067905 3300031995 Bacteria 2817
130 Ga0307414_10061083 3300032004 Bacteria 2668
131 Ga0307414_10299414 3300032004 Bacteria 1360
132 Ga0307411_10015854 3300032005 Bacteria 4247
133 Ga0316582_0120021 3300036647 Bacteria 1758
134 Ga0395899_0339658 3300037312 Bacteria 1007
135 Ga0395905_0001159 3300037471 Bacteria 32949
136 Ga0395905_0056445 3300037471 Bacteria 3674
137 Ga0395905_0430117 3300037471 Bacteria 1217
138 Ga0395901_0049250 3300038443 Bacteria 4377
139 Ga0436365_1328176 3300039437 Bacteria 871
140 Ga0436365_1804837 3300039437 Bacteria 842
141 Ga0451849_1111385 3300041505 Bacteria 582
142 Ga0466965_0076941 3300044683 Bacteria 1684
143 Ga0466970_0917047 3300044765 Bacteria 515
144 Ga0466967_0482539 3300045976 Bacteria 1215
145 Ga0466967_0495105 3300045976 Bacteria 1199
146 Ga0466967_0903298 3300045976 Bacteria 878
147 Ga0495607_0025731 3300046501 Bacteria 3658
148 Ga0495610_0012318 3300046512 Bacteria 5157
149 Ga0495620_0000252 3300046515 Bacteria 39718
150 Ga0495632_0000843 3300046519 Bacteria 27042
151 Ga0495643_0090099 3300046522 Bacteria 1583
152 Ga0495588_0000124 3300046674 Bacteria 130833
153 Ga0495589_0000298 3300046794 Bacteria 39398
154 Ga0495672_0182877 3300047320 Bacteria 1060
155 Ga0495672_0213542 3300047320 Bacteria 957
156 Ga0495679_002597 3300047446 Bacteria 9078
157 Ga0495686_0000127 3300047472 Bacteria 156278
158 Ga0496101_0759274 3300048904 Bacteria 765
159 Ga0496101_0954277 3300048904 Bacteria 675
160 Ga0496102_0667244 3300048905 Bacteria 963
161 Ga0496117_0002173 3300048920 Bacteria 25568
162 Ga0496118_0036875 3300048921 Bacteria 3945
163 Ga0496121_0000245 3300048924 Bacteria 116316
164 Ga0496121_0007513 3300048924 Bacteria 13148
165 Ga0496123_0084367 3300048926 Bacteria 1916
166 Ga0496125_0027003 3300048928 Bacteria 5213
167 Ga0496125_0254912 3300048928 Bacteria 1104
168 Ga0496126_0029792 3300048929 Bacteria 5181
169 Ga0496126_0034228 3300048929 Bacteria 4773
170 Ga0501032_0043154 3300049569 Bacteria 3056
171 Ga0501033_0004804 3300049570 Bacteria 10791
172 Ga0501034_0047885 3300049571 Bacteria 4315
173 Ga0501034_0215307 3300049571 Bacteria 1875
174 Ga0501034_0539823 3300049571 Bacteria 1076
175 Ga0501038_0026886 3300049574 Bacteria 5123
176 Ga0501043_0707904 3300049579 Bacteria 735
177 Ga0501047_0239268 3300049581 Bacteria 1666
178 Ga0501047_0765051 3300049581 Bacteria 781
179 Ga0501069_0070970 3300049585 Bacteria 1952
180 Ga0501070_0030830 3300049586 Bacteria 4491
181 Ga0501249_000243 3300049679 Bacteria 16224
182 Ga0501080_1361222 3300049742 Bacteria 606
183 Ga0501080_1563423 3300049742 Bacteria 559
184 Ga0501083_0926884 3300049744 Bacteria 567
185 Ga0501035_0043544 3300049822 Bacteria 4045
186 Ga0501035_0086008 3300049822 Bacteria 2771
187 Ga0501035_0352291 3300049822 Bacteria 1231
188 Ga0501035_0478536 3300049822 Bacteria 1027
189 Ga0501044_0057592 3300049823 Bacteria 3988
190 Ga0501044_0153216 3300049823 Bacteria 2286
191 Ga0501044_1221973 3300049823 Bacteria 619
192 nmdc:mga0yw44_116730_c1 3300050492 Bacteria 1715
193 nmdc:mga0yw44_582302_c1 3300050492 Bacteria 760
194 nmdc:mga06z11_398517_c1 3300050494 Bacteria 828
195 nmdc:mga04h51_532342_c1 3300050495 Unclassified 505
196 nmdc:mga07m45_5192_c1 3300050496 Bacteria 6455
197 nmdc:mga08x19_303315_c1 3300050514 Bacteria 1109
198 nmdc:mga0sz30_278572_c1 3300050516 Bacteria 745
199 Ga0500572_000025 3300053111 Bacteria 45953
200 Ga0500608_211309 3300053122 Bacteria 792
201 Ga0500614_000001 3300053123 Bacteria 1274484
202 Ga0500617_116301 3300053124 Bacteria 1110
203 Ga0500559_0140064 3300053136 Bacteria 1132
204 Ga0500616_0000012 3300053153 Bacteria 681798
205 Ga0500616_0012581 3300053153 Bacteria 4949
206 Ga0500616_0083901 3300053153 Bacteria 1595
207 Ga0500639_145739 3300053163 Bacteria 1099
208 Ga0500636_0000466 3300053177 Bacteria 22002
209 Ga0500649_000022 3300053722 Bacteria 39643
210 Ga0500601_000562 3300053737 Bacteria 5438
211 Ga0501082_0833684 3300060353 Bacteria 807
212 2523469556 2523231067 Bacteria 5230452
213 2585999580 2585427634 Bacteria 6455027
214 2644098795 2643221617 Bacteria 5139111
215 2644114676 2643221620 Bacteria 5134593
216 2644525844 2643221694 Bacteria 4392972
217 2753301452 2751185788 Bacteria 4541048
218 2812333065 2811994874 Bacteria 5367947
219 2852653601 2852653556 Bacteria 4050083
220 2854918287 2854916844 Bacteria 5725939
221 2891378110 2891373044 Bacteria 5202277
222 2919045074 2919042368 Bacteria 3905917
223 2928108345 2928104781 Bacteria 3877447
224 2939670833 2939669807 Bacteria 5028511
225 2945971507 2945968032 Bacteria 4111363
226 2946082034 2946080515 Bacteria 4310960
227 2984553641 2984551494 Bacteria 3877562
228 3004169793 3004167301 Bacteria 8330599
229 8005688463 8005682033 Bacteria 6726518
230 Ga0075365_10065244
231 JGI24741J21665_1037466
232 JGI25151J46595_10001770
233 JGI25153J46596_10001553
234 rootL2_10016286
235 rootL2_10162801
236 rootH1_10007118
237 JGI25404J52841_10115322
238 Ga0055539_1003517
239 Ga0055530_10020403
240 Ga0055531_10055639
241 Ga0070669_100077006
242 Ga0070669_100228311
243 Ga0070667_100000062
244 Ga0070663_100025180
245 Ga0070663_100588498
246 Ga0070663_100636690
247 Ga0068853_100000870
248 Ga0068853_100006249
249 Ga0068853_100040047
250 Ga0068853_100122934
251 Ga0070665_100368583
252 Ga0070665_100435163
253 Ga0068855_100011833
254 Ga0068855_100154315
255 Ga0068855_100235753
256 Ga0068855_100588576
257 Ga0068857_100043022
258 Ga0068857_100353470
259 Ga0068857_100378453
260 Ga0068854_100019792
261 Ga0068854_100345955
262 Ga0068856_100349339
263 Ga0068852_100005181
264 Ga0068852_100167247
265 Ga0068851_10002682
266 Ga0068851_10342350
267 Ga0068851_10386612
268 Ga0068863_100000054
269 Ga0068860_100016315
270 Ga0068860_100263690
271 Ga0081455_10430230
272 Ga0081540_1000158
273 Ga0075367_10434167
274 Ga0075367_10437157
275 Ga0075369_10191263
276 Ga0075370_10167779
277 Ga0105240_10001847
278 Ga0105245_11373297
279 Ga0105241_10001554
280 Ga0105241_10001769
281 Ga0105241_10384951
282 Ga0105237_10073532
283 Ga0105237_10161694
284 Ga0105238_10429939
285 Ga0105238_10729083
286 Ga0105238_11394839
287 Ga0105239_10005711
288 Ga0105239_10094232
289 Ga0105239_10305731
290 Ga0157373_10082218
291 Ga0157369_12120283
292 Ga0157374_10933636
293 Ga0163162_10307662
294 Ga0157372_10146779
295 Ga0157372_12175678
296 Ga0157380_10461346
297 Ga0182008_10071327
298 Ga0182007_10040194
299 Ga0182005_1023569
300 Ga0163161_10838731
301 Ga0209563_104872
302 Ga0207427_100227
303 Ga0209677_119982
304 Ga0209233_1014830
305 Ga0209676_1000759
306 Ga0209676_1008564
307 Ga0209025_1000321
308 Ga0209564_1001440
309 Ga0209758_1013218
310 Ga0209050_1050925
311 Ga0209050_1052204
312 Ga0209257_1001016
313 Ga0207647_10058915
314 Ga0207647_10241554
315 Ga0207705_10304447
316 Ga0207705_10508551
317 Ga0207654_10000033
318 Ga0207654_10002456
319 Ga0207695_10002612
320 Ga0207695_10005710
321 Ga0207671_10025373
322 Ga0207671_10349348
323 Ga0207649_10112356
324 Ga0207681_10018907
325 Ga0207694_10457429
326 Ga0207667_10123188
327 Ga0207667_11335974
328 Ga0207668_10030774
329 Ga0207640_10015123
330 Ga0207658_10000039
331 Ga0207639_10000943
332 Ga0207639_10241069
333 Ga0207639_10552209
334 Ga0207639_11024147
335 Ga0207678_10014962
336 Ga0207678_10362095
337 Ga0207641_10000095
338 Ga0207674_10028381
339 Ga0207674_10057476
340 Ga0207674_11700799
341 Ga0207698_10000893
342 Ga0207698_10002893
343 Ga0207698_10271216
344 Ga0268266_10405298
345 Ga0268264_10003566
346 Ga0265763_1022462
347 Ga0265332_10009385
348 Ga0265325_10020300
349 Ga0265340_10008330
350 Ga0265339_10011632
351 Ga0265339_10014633
352 Ga0265331_10003950
353 Ga0307408_101990893
354 Ga0265314_10041429
355 Ga0265342_10000360
356 Ga0307413_10335156
357 Ga0307410_10055203
358 Ga0307409_100067905
359 Ga0307414_10061083
360 Ga0307414_10299414
361 Ga0307411_10015854
362 Ga0316582_0120021
363 Ga0395899_0339658
364 Ga0395905_0001159
365 Ga0395905_0056445
366 Ga0395905_0430117
367 Ga0395901_0049250
368 Ga0436365_1328176
369 Ga0436365_1804837
370 Ga0451849_1111385
371 Ga0466965_0076941
372 Ga0466970_0917047
373 Ga0466967_0482539
374 Ga0466967_0495105
375 Ga0466967_0903298
376 Ga0495607_0025731
377 Ga0495610_0012318
378 Ga0495620_0000252
379 Ga0495632_0000843
380 Ga0495643_0090099
381 Ga0495588_0000124
382 Ga0495589_0000298
383 Ga0495672_0182877
384 Ga0495672_0213542
385 Ga0495679_002597
386 Ga0495686_0000127
387 Ga0496101_0759274
388 Ga0496101_0954277
389 Ga0496102_0667244
390 Ga0496117_0002173
391 Ga0496118_0036875
392 Ga0496121_0000245
393 Ga0496121_0007513
394 Ga0496123_0084367
395 Ga0496125_0027003
396 Ga0496125_0254912
397 Ga0496126_0029792
398 Ga0496126_0034228
399 Ga0501032_0043154
400 Ga0501033_0004804
401 Ga0501034_0047885
402 Ga0501034_0215307
403 Ga0501034_0539823
404 Ga0501038_0026886
405 Ga0501043_0707904
406 Ga0501047_0239268
407 Ga0501047_0765051
408 Ga0501069_0070970
409 Ga0501070_0030830
410 Ga0501249_000243
411 Ga0501080_1361222
412 Ga0501080_1563423
413 Ga0501083_0926884
414 Ga0501035_0043544
415 Ga0501035_0086008
416 Ga0501035_0352291
417 Ga0501035_0478536
418 Ga0501044_0057592
419 Ga0501044_0153216
420 Ga0501044_1221973
421 nmdc:mga0yw44_116730_c1
422 nmdc:mga0yw44_582302_c1
423 nmdc:mga06z11_398517_c1
424 nmdc:mga04h51_532342_c1
425 nmdc:mga07m45_5192_c1
426 nmdc:mga08x19_303315_c1
427 nmdc:mga0sz30_278572_c1
428 Ga0500572_000025
429 Ga0500608_211309
430 Ga0500614_000001
431 Ga0500617_116301
432 Ga0500559_0140064
433 Ga0500616_0000012
434 Ga0500616_0012581
435 Ga0500616_0083901
436 Ga0500639_145739
437 Ga0500636_0000466
438 Ga0500649_000022
439 Ga0500601_000562
440 Ga0501082_0833684
441 2523469556
442 2585999580
443 2644098795
444 2644114676
445 2644525844
446 2753301452
447 2812333065
448 2852653601
449 2854918287
450 2891378110
451 2919045074
452 2928108345
453 2939670833
454 2945971507
455 2946082034
456 2984553641
457 3004169793
458 8005688463

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12120

Arr-ms

Rifampin ADP-ribosyl transferase

19

117

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hw2-assembly1.cif.gz_A crystal structure of rifampin adp-ribosyl transferase in complex with rifampin 0.9489 8 135
2hw2-assembly1.cif.gz_A crystal structure of rifampin adp-ribosyl transferase in complex with rifampin 0.8824 8 135
2a5g-assembly1.cif.gz_B cholera toxin a1 subunit bound to arf6(q67l) 0.5907 10 113
1s5e-assembly1.cif.gz_A cholera holotoxin, crystal form 1 0.5783 10 97
1s5e-assembly2.cif.gz_B cholera holotoxin, crystal form 1 0.5701 10 97
ID Description Score Start End Superfamily
2hw2A00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Rifampin ADP-ribosyltransferase domain 0.9489 8 135 3.20.170.40
2hw2A00 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Rifampin ADP-ribosyltransferase domain 0.8824 8 135 3.20.170.40
2a5gB00 Alpha Beta;Alpha-Beta Complex;Heat-Labile Enterotoxin; Chain A;Heat-Labile Enterotoxin, subunit A 0.5907 10 113 3.90.210.10
af_O07206_8_119_3.20.170.20 Alpha Beta;Alpha-Beta Barrel;ADP-ribosylation fold;Protein of unknown function DUF952 0.5644 11 107 3.20.170.20
1s5bA00 Alpha Beta;Alpha-Beta Complex;Heat-Labile Enterotoxin; Chain A;Heat-Labile Enterotoxin, subunit A 0.522 10 105 3.90.210.10
ID Description Score Start End GO Terms
AF-A0A1G3KRT2-F1-model_v4 Rifampin ADP-ribosyl transferase 0.9744 9 135 GO:0016740
AF-A0A6N1ADM1-F1-model_v4 NAD(+)--rifampin ADP-ribosyltransferase 0.9733 8 134 GO:0016740
AF-A0A7C6JB03-F1-model_v4 NAD(+)--rifampin ADP-ribosyltransferase 0.973 12 127 GO:0016740
AF-A0A0U4HK97-F1-model_v4 deleted 0.9721 40 130
AF-A0A7Y9UAR3-F1-model_v4 deleted 0.9713 12 134

Map