F341844

General Info

Members Datasets Scaffolds Average Seq Length
229 154 458 113

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100481014|Ga0068864_1004810142
Length 131
Sequence MLTTNRSDLLAINMSDARSELLQGTLDLLILKTLAVLGAQHGFGIARRIEQVSADVLALNQGTLYPALLRLEQQGLIESEWGTSTNNRRARFYSLTRKGRAQLAKEIADWQRVSGAINDIVADTGTASATA

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
99 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
100 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
125 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
126 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
142 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.86
Nodule 0
Rhizoplane 1.75
Rhizosphere 88.65
Stem 0
Stem Tuber 0
Unclassified 28.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100481014 3300005618 Bacteria 1192
2 rootL2_10334985 3300003322 Bacteria 1591
3 Ga0065712_10087947 3300005290 Bacteria 2546
4 Ga0065715_10468052 3300005293 Bacteria 791
5 Ga0070658_11336596 3300005327 Unclassified 622
6 Ga0070676_10105962 3300005328 Bacteria 1744
7 Ga0070676_11427774 3300005328 Unclassified 531
8 Ga0070683_100248982 3300005329 Unclassified 1690
9 Ga0070690_100501327 3300005330 Bacteria 908
10 Ga0070670_100006137 3300005331 Bacteria 10161
11 Ga0070677_10803769 3300005333 Unclassified 537
12 Ga0068869_100700645 3300005334 Unclassified 863
13 Ga0070666_10861683 3300005335 Unclassified 669
14 Ga0068868_100818993 3300005338 Bacteria 841
15 Ga0070660_100783525 3300005339 Unclassified 801
16 Ga0070689_100657457 3300005340 Bacteria 912
17 Ga0070687_100523856 3300005343 Archaea 802
18 Ga0070661_100623831 3300005344 Unclassified 873
19 Ga0070661_100960506 3300005344 Unclassified 707
20 Ga0070692_11126438 3300005345 Bacteria 555
21 Ga0070669_101317032 3300005353 Bacteria 626
22 Ga0070671_101372304 3300005355 Bacteria 624
23 Ga0070713_100695773 3300005436 Bacteria 970
24 Ga0070701_10605323 3300005438 Bacteria 726
25 Ga0070711_100055305 3300005439 Bacteria 2741
26 Ga0070678_101211857 3300005456 Bacteria 700
27 Ga0070678_101253244 3300005456 Unclassified 689
28 Ga0070678_101588903 3300005456 Unclassified 614
29 Ga0070684_100509346 3300005535 Unclassified 1115
30 Ga0070696_101159865 3300005546 Unclassified 651
31 Ga0070665_100111527 3300005548 Bacteria 2737
32 Ga0070665_100150320 3300005548 Unclassified 2331
33 Ga0070665_100245263 3300005548 Bacteria 1792
34 Ga0070664_100732722 3300005564 Unclassified 922
35 Ga0070664_100906237 3300005564 Bacteria 827
36 Ga0068857_100051123 3300005577 Bacteria 3665
37 Ga0068854_101711399 3300005578 Unclassified 575
38 Ga0068856_100001884 3300005614 Bacteria 21857
39 Ga0068859_100733596 3300005617 Bacteria 1077
40 Ga0068859_101871202 3300005617 Bacteria 663
41 Ga0068864_100825523 3300005618 Bacteria 912
42 Ga0068861_100512615 3300005719 Unclassified 1086
43 Ga0068851_10171616 3300005834 Bacteria 1197
44 Ga0068860_100480178 3300005843 Bacteria 1239
45 Ga0068862_100840072 3300005844 Bacteria 899
46 Ga0075365_10000817 3300006038 Bacteria 12836
47 Ga0075368_10005198 3300006042 Bacteria 4464
48 Ga0075363_100040185 3300006048 Bacteria 2465
49 Ga0075364_10013676 3300006051 Bacteria 4998
50 Ga0075364_10084431 3300006051 Bacteria 2103
51 Ga0070716_100231876 3300006173 Unclassified 1247
52 Ga0070712_100034447 3300006175 Unclassified 3431
53 Ga0075367_10019475 3300006178 Bacteria 3764
54 Ga0075366_10013273 3300006195 Bacteria 4686
55 Ga0075366_10437114 3300006195 Bacteria 807
56 Ga0075366_10538039 3300006195 Bacteria 723
57 Ga0068871_101792562 3300006358 Bacteria 583
58 Ga0075430_100187529 3300006846 Bacteria 1720
59 Ga0075431_100051076 3300006847 Bacteria 4265
60 Ga0097620_100733646 3300006931 Bacteria 1077
61 Ga0097620_101871138 3300006931 Bacteria 663
62 Ga0075435_101134694 3300007076 Bacteria 683
63 Ga0105240_10068176 3300009093 Bacteria 4407
64 Ga0105240_10078086 3300009093 Bacteria 4077
65 Ga0105240_10159383 3300009093 Bacteria 2682
66 Ga0111539_10001708 3300009094 Bacteria 29247
67 Ga0111539_10149347 3300009094 Unclassified 2736
68 Ga0111539_10215021 3300009094 Bacteria 2239
69 Ga0111539_12412442 3300009094 Unclassified 610
70 Ga0114129_12689313 3300009147 Bacteria 593
71 Ga0105242_13001098 3300009176 Bacteria 522
72 Ga0105248_10072796 3300009177 Bacteria 3862
73 Ga0105237_10148979 3300009545 Unclassified 2336
74 Ga0105237_10334947 3300009545 Bacteria 1518
75 Ga0105238_10347647 3300009551 Bacteria 1472
76 Ga0105238_10776534 3300009551 Bacteria 973
77 Ga0105249_11289265 3300009553 Bacteria 802
78 Ga0105239_10338650 3300010375 Bacteria 1697
79 Ga0105239_10960958 3300010375 Bacteria 982
80 Ga0105246_11057169 3300011119 Bacteria 738
81 Ga0157374_10650928 3300013296 Unclassified 1065
82 Ga0157378_11125350 3300013297 Bacteria 823
83 Ga0157378_11650258 3300013297 Bacteria 687
84 Ga0157375_11848815 3300013308 Bacteria 716
85 Ga0163163_11145292 3300014325 Bacteria 841
86 Ga0157380_10013598 3300014326 Bacteria 5939
87 Ga0157380_10149521 3300014326 Bacteria 2017
88 Ga0157380_13443939 3300014326 Unclassified 506
89 Ga0213876_10393388 3300021384 Bacteria 737
90 Ga0207682_10113164 3300025893 Bacteria 1196
91 Ga0207682_10634013 3300025893 Bacteria 503
92 Ga0207645_10293858 3300025907 Bacteria 1081
93 Ga0207705_10173242 3300025909 Viruses 1625
94 Ga0207695_10050159 3300025913 Bacteria 4393
95 Ga0207695_10085709 3300025913 Bacteria 3178
96 Ga0207695_10088521 3300025913 Bacteria 3116
97 Ga0207671_10783200 3300025914 Unclassified 757
98 Ga0207693_10013271 3300025915 Bacteria 6647
99 Ga0207693_11478294 3300025915 Unclassified 502
100 Ga0207663_10065842 3300025916 Bacteria 2317
101 Ga0207649_10591881 3300025920 Unclassified 852
102 Ga0207694_10144269 3300025924 Bacteria 1916
103 Ga0207694_10447339 3300025924 Unclassified 1078
104 Ga0207650_10204226 3300025925 Bacteria 1584
105 Ga0207650_10401009 3300025925 Unclassified 1135
106 Ga0207700_11253986 3300025928 Unclassified 661
107 Ga0207644_11471160 3300025931 Bacteria 572
108 Ga0207709_10718192 3300025935 Unclassified 801
109 Ga0207665_10070476 3300025939 Unclassified 2385
110 Ga0207665_10586782 3300025939 Bacteria 869
111 Ga0207691_10014673 3300025940 Bacteria 7470
112 Ga0207711_10263981 3300025941 Unclassified 1583
113 Ga0207689_10592138 3300025942 Unclassified 933
114 Ga0207661_10251145 3300025944 Unclassified 1572
115 Ga0207679_10451673 3300025945 Bacteria 1140
116 Ga0207679_10672655 3300025945 Bacteria 938
117 Ga0207679_12175265 3300025945 Bacteria 503
118 Ga0207640_12088948 3300025981 Bacteria 514
119 Ga0207658_10827495 3300025986 Bacteria 841
120 Ga0207677_12290129 3300026023 Unclassified 503
121 Ga0207708_10256563 3300026075 Bacteria 1410
122 Ga0207702_10010076 3300026078 Bacteria 7922
123 Ga0207676_10276123 3300026095 Bacteria 1524
124 Ga0207674_10080693 3300026116 Bacteria 3256
125 Ga0207675_100291071 3300026118 Bacteria 1589
126 Ga0207675_100314939 3300026118 Bacteria 1527
127 Ga0207683_10216245 3300026121 Unclassified 1746
128 Ga0207683_10237660 3300026121 Bacteria 1662
129 Ga0207683_10635429 3300026121 Bacteria 989
130 Ga0207683_11353959 3300026121 Bacteria 658
131 Ga0207428_10012576 3300027907 Bacteria 7422
132 Ga0207428_10072354 3300027907 Unclassified 2707
133 Ga0268266_10044893 3300028379 Bacteria 3779
134 Ga0268266_10271145 3300028379 Bacteria 1575
135 Ga0268265_10748778 3300028380 Bacteria 948
136 Ga0268264_10230619 3300028381 Bacteria 1710
137 Ga0265319_1005266 3300028563 Bacteria 6233
138 Ga0265318_10318005 3300028577 Bacteria 568
139 Ga0265323_10025821 3300028653 Unclassified 2219
140 Ga0265338_10070913 3300028800 Unclassified 2984
141 Ga0265320_10039801 3300031240 Bacteria 2348
142 Ga0265327_10002415 3300031251 Bacteria 19800
143 Ga0265327_10002566 3300031251 Bacteria 18819
144 Ga0307408_100341698 3300031548 Unclassified 1267
145 Ga0307408_100769095 3300031548 Unclassified 871
146 Ga0307408_101183750 3300031548 Unclassified 712
147 Ga0307408_101276852 3300031548 Bacteria 687
148 Ga0307408_101917718 3300031548 Bacteria 568
149 Ga0307408_101991579 3300031548 Unclassified 558
150 Ga0265313_10046193 3300031595 Bacteria 2115
151 Ga0265314_10033537 3300031711 Bacteria 3762
152 Ga0307405_10634225 3300031731 Unclassified 876
153 Ga0307405_11017089 3300031731 Unclassified 708
154 Ga0307413_10000362 3300031824 Bacteria 14524
155 Ga0307413_10019921 3300031824 Bacteria 3557
156 Ga0307413_10364443 3300031824 Unclassified 1120
157 Ga0307413_10873911 3300031824 Unclassified 761
158 Ga0307413_10980479 3300031824 Bacteria 723
159 Ga0307410_10215686 3300031852 Unclassified 1473
160 Ga0307410_10808292 3300031852 Unclassified 798
161 Ga0307410_10888933 3300031852 Bacteria 762
162 Ga0307406_10029714 3300031901 Bacteria 3311
163 Ga0307406_10085504 3300031901 Bacteria 2109
164 Ga0307407_10323879 3300031903 Bacteria 1082
165 Ga0307407_10437019 3300031903 Bacteria 947
166 Ga0307407_11376852 3300031903 Unclassified 555
167 Ga0307407_11547391 3300031903 Bacteria 525
168 Ga0307412_10148494 3300031911 Bacteria 1726
169 Ga0307409_100052534 3300031995 Bacteria 3125
170 Ga0307409_100090709 3300031995 Bacteria 2502
171 Ga0307409_100105152 3300031995 Bacteria 2353
172 Ga0307409_100462704 3300031995 Bacteria 1227
173 Ga0307416_100032753 3300032002 Bacteria 3932
174 Ga0307416_100235354 3300032002 Bacteria 1769
175 Ga0307416_100920961 3300032002 Bacteria 975
176 Ga0307416_101498443 3300032002 Bacteria 780
177 Ga0307414_10091602 3300032004 Bacteria 2260
178 Ga0307414_10120194 3300032004 Bacteria 2018
179 Ga0307411_10019318 3300032005 Bacteria 3933
180 Ga0307411_10069223 3300032005 Bacteria 2382
181 Ga0307411_10081899 3300032005 Bacteria 2224
182 Ga0307411_10727224 3300032005 Bacteria 867
183 Ga0307415_100542912 3300032126 Bacteria 1024
184 Ga0373927_0454930 3300035695 Unclassified 845
185 Ga0373947_0411193 3300035725 Unclassified 913
186 Ga0395905_0128433 3300037471 Bacteria 2384
187 Ga0436365_0133651 3300039437 Bacteria 1761
188 Ga0451804_0240189 3300041463 Unclassified 602
189 Ga0451807_0653502 3300041486 Unclassified 600
190 Ga0451847_0140090 3300041503 Unclassified 531
191 Ga0439443_056117 3300042003 Bacteria 698
192 Ga0439446_0336120 3300042156 Unclassified 536
193 Ga0453684_0000019 3300044712 Bacteria 908702
194 Ga0466968_0155308 3300044735 Bacteria 1053
195 Ga0466957_1387517 3300044842 Unclassified 511
196 Ga0495629_0002595 3300046459 Bacteria 13845
197 Ga0495621_0341626 3300046539 Bacteria 627
198 Ga0495621_0468612 3300046539 Bacteria 541
199 Ga0495645_0912555 3300046543 Unclassified 521
200 Ga0495635_1102480 3300046663 Unclassified 502
201 Ga0495613_0374317 3300046689 Unclassified 975
202 Ga0496110_1485125 3300048913 Bacteria 587
203 Ga0496113_0337806 3300048916 Unclassified 1208
204 Ga0501046_0182512 3300049580 Bacteria 1568
205 Ga0501047_0012457 3300049581 Bacteria 8053
206 Ga0501071_0184590 3300049587 Unclassified 1563
207 Ga0501083_0031637 3300049744 Bacteria 3631
208 Ga0501268_033189 3300049765 Bacteria 943
209 Ga0501273_080225 3300049770 Bacteria 542
210 Ga0501035_0044800 3300049822 Bacteria 3982
211 nmdc:mga00v17_12151_c1 3300050491 Bacteria 4745
212 nmdc:mga00v17_51240_c1 3300050491 Bacteria 2510
213 nmdc:mga0yw44_7914_c1 3300050492 Bacteria 5266
214 nmdc:mga0k408_26502_c1 3300050493 Bacteria 3286
215 nmdc:mga0k408_353873_c1 3300050493 Bacteria 875
216 nmdc:mga06z11_295162_c1 3300050494 Bacteria 963
217 nmdc:mga06z11_7571_c1 3300050494 Bacteria 4479
218 nmdc:mga07m45_67749_c1 3300050496 Bacteria 2028
219 nmdc:mga07m45_89018_c1 3300050496 Bacteria 1767
220 nmdc:mga05p37_1179394_c1 3300050507 Bacteria 793
221 nmdc:mga09592_721615_c1 3300050508 Bacteria 847
222 nmdc:mga06r32_120826_c1 3300050510 Bacteria 2584
223 nmdc:mga06r32_180329_c1 3300050510 Bacteria 2097
224 nmdc:mga08y16_297569_c1 3300050511 Bacteria 1664
225 nmdc:mga08y16_391777_c1 3300050511 Unclassified 1423
226 nmdc:mga08y16_605715_c1 3300050511 Bacteria 1104
227 nmdc:mga08y16_69345_c1 3300050511 Bacteria 3676
228 nmdc:mga0n895_50267_c1 3300050512 Bacteria 4086
229 Ga0495619_0810264 3300053085 Unclassified 633
230 Ga0068864_100481014
231 rootL2_10334985
232 Ga0065712_10087947
233 Ga0065715_10468052
234 Ga0070658_11336596
235 Ga0070676_10105962
236 Ga0070676_11427774
237 Ga0070683_100248982
238 Ga0070690_100501327
239 Ga0070670_100006137
240 Ga0070677_10803769
241 Ga0068869_100700645
242 Ga0070666_10861683
243 Ga0068868_100818993
244 Ga0070660_100783525
245 Ga0070689_100657457
246 Ga0070687_100523856
247 Ga0070661_100623831
248 Ga0070661_100960506
249 Ga0070692_11126438
250 Ga0070669_101317032
251 Ga0070671_101372304
252 Ga0070713_100695773
253 Ga0070701_10605323
254 Ga0070711_100055305
255 Ga0070678_101211857
256 Ga0070678_101253244
257 Ga0070678_101588903
258 Ga0070684_100509346
259 Ga0070696_101159865
260 Ga0070665_100111527
261 Ga0070665_100150320
262 Ga0070665_100245263
263 Ga0070664_100732722
264 Ga0070664_100906237
265 Ga0068857_100051123
266 Ga0068854_101711399
267 Ga0068856_100001884
268 Ga0068859_100733596
269 Ga0068859_101871202
270 Ga0068864_100825523
271 Ga0068861_100512615
272 Ga0068851_10171616
273 Ga0068860_100480178
274 Ga0068862_100840072
275 Ga0075365_10000817
276 Ga0075368_10005198
277 Ga0075363_100040185
278 Ga0075364_10013676
279 Ga0075364_10084431
280 Ga0070716_100231876
281 Ga0070712_100034447
282 Ga0075367_10019475
283 Ga0075366_10013273
284 Ga0075366_10437114
285 Ga0075366_10538039
286 Ga0068871_101792562
287 Ga0075430_100187529
288 Ga0075431_100051076
289 Ga0097620_100733646
290 Ga0097620_101871138
291 Ga0075435_101134694
292 Ga0105240_10068176
293 Ga0105240_10078086
294 Ga0105240_10159383
295 Ga0111539_10001708
296 Ga0111539_10149347
297 Ga0111539_10215021
298 Ga0111539_12412442
299 Ga0114129_12689313
300 Ga0105242_13001098
301 Ga0105248_10072796
302 Ga0105237_10148979
303 Ga0105237_10334947
304 Ga0105238_10347647
305 Ga0105238_10776534
306 Ga0105249_11289265
307 Ga0105239_10338650
308 Ga0105239_10960958
309 Ga0105246_11057169
310 Ga0157374_10650928
311 Ga0157378_11125350
312 Ga0157378_11650258
313 Ga0157375_11848815
314 Ga0163163_11145292
315 Ga0157380_10013598
316 Ga0157380_10149521
317 Ga0157380_13443939
318 Ga0213876_10393388
319 Ga0207682_10113164
320 Ga0207682_10634013
321 Ga0207645_10293858
322 Ga0207705_10173242
323 Ga0207695_10050159
324 Ga0207695_10085709
325 Ga0207695_10088521
326 Ga0207671_10783200
327 Ga0207693_10013271
328 Ga0207693_11478294
329 Ga0207663_10065842
330 Ga0207649_10591881
331 Ga0207694_10144269
332 Ga0207694_10447339
333 Ga0207650_10204226
334 Ga0207650_10401009
335 Ga0207700_11253986
336 Ga0207644_11471160
337 Ga0207709_10718192
338 Ga0207665_10070476
339 Ga0207665_10586782
340 Ga0207691_10014673
341 Ga0207711_10263981
342 Ga0207689_10592138
343 Ga0207661_10251145
344 Ga0207679_10451673
345 Ga0207679_10672655
346 Ga0207679_12175265
347 Ga0207640_12088948
348 Ga0207658_10827495
349 Ga0207677_12290129
350 Ga0207708_10256563
351 Ga0207702_10010076
352 Ga0207676_10276123
353 Ga0207674_10080693
354 Ga0207675_100291071
355 Ga0207675_100314939
356 Ga0207683_10216245
357 Ga0207683_10237660
358 Ga0207683_10635429
359 Ga0207683_11353959
360 Ga0207428_10012576
361 Ga0207428_10072354
362 Ga0268266_10044893
363 Ga0268266_10271145
364 Ga0268265_10748778
365 Ga0268264_10230619
366 Ga0265319_1005266
367 Ga0265318_10318005
368 Ga0265323_10025821
369 Ga0265338_10070913
370 Ga0265320_10039801
371 Ga0265327_10002415
372 Ga0265327_10002566
373 Ga0307408_100341698
374 Ga0307408_100769095
375 Ga0307408_101183750
376 Ga0307408_101276852
377 Ga0307408_101917718
378 Ga0307408_101991579
379 Ga0265313_10046193
380 Ga0265314_10033537
381 Ga0307405_10634225
382 Ga0307405_11017089
383 Ga0307413_10000362
384 Ga0307413_10019921
385 Ga0307413_10364443
386 Ga0307413_10873911
387 Ga0307413_10980479
388 Ga0307410_10215686
389 Ga0307410_10808292
390 Ga0307410_10888933
391 Ga0307406_10029714
392 Ga0307406_10085504
393 Ga0307407_10323879
394 Ga0307407_10437019
395 Ga0307407_11376852
396 Ga0307407_11547391
397 Ga0307412_10148494
398 Ga0307409_100052534
399 Ga0307409_100090709
400 Ga0307409_100105152
401 Ga0307409_100462704
402 Ga0307416_100032753
403 Ga0307416_100235354
404 Ga0307416_100920961
405 Ga0307416_101498443
406 Ga0307414_10091602
407 Ga0307414_10120194
408 Ga0307411_10019318
409 Ga0307411_10069223
410 Ga0307411_10081899
411 Ga0307411_10727224
412 Ga0307415_100542912
413 Ga0373927_0454930
414 Ga0373947_0411193
415 Ga0395905_0128433
416 Ga0436365_0133651
417 Ga0451804_0240189
418 Ga0451807_0653502
419 Ga0451847_0140090
420 Ga0439443_056117
421 Ga0439446_0336120
422 Ga0453684_0000019
423 Ga0466968_0155308
424 Ga0466957_1387517
425 Ga0495629_0002595
426 Ga0495621_0341626
427 Ga0495621_0468612
428 Ga0495645_0912555
429 Ga0495635_1102480
430 Ga0495613_0374317
431 Ga0496110_1485125
432 Ga0496113_0337806
433 Ga0501046_0182512
434 Ga0501047_0012457
435 Ga0501071_0184590
436 Ga0501083_0031637
437 Ga0501268_033189
438 Ga0501273_080225
439 Ga0501035_0044800
440 nmdc:mga00v17_12151_c1
441 nmdc:mga00v17_51240_c1
442 nmdc:mga0yw44_7914_c1
443 nmdc:mga0k408_26502_c1
444 nmdc:mga0k408_353873_c1
445 nmdc:mga06z11_295162_c1
446 nmdc:mga06z11_7571_c1
447 nmdc:mga07m45_67749_c1
448 nmdc:mga07m45_89018_c1
449 nmdc:mga05p37_1179394_c1
450 nmdc:mga09592_721615_c1
451 nmdc:mga06r32_120826_c1
452 nmdc:mga06r32_180329_c1
453 nmdc:mga08y16_297569_c1
454 nmdc:mga08y16_391777_c1
455 nmdc:mga08y16_605715_c1
456 nmdc:mga08y16_69345_c1
457 nmdc:mga0n895_50267_c1
458 Ga0495619_0810264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

30

105

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9336 14 111
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9297 14 110
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9111 14 114
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9097 10 110
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9072 10 114
ID Description Score Start End Superfamily
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9128 14 116 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9097 10 110 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9078 14 113 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8985 10 114 1.10.10.10
af_Q9C106_1_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8891 17 87 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.9993 14 93
AF-A0A7Y3ICY8-F1-model_v4 PadR family transcriptional regulator 0.9978 14 112
AF-A0A6B9YSR4-F1-model_v4 PadR family transcriptional regulator 0.9966 9 113
AF-A0A6J4LS10-F1-model_v4 Transcriptional regulator, PadR family 0.9966 14 113
AF-A0A3N5H0U7-F1-model_v4 PadR family transcriptional regulator 0.9963 9 112

Map