F341691

General Info

Members Datasets Scaffolds Average Seq Length
229 171 458 148

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100062318|Ga0070680_1000623184
Length 157
Sequence MPSAKIRLAFVGFAMLATASGFDAPTSIARADLLVPYAITGDAIAAPLGGLSGDAARGRTIILARKSACLLCHAGPFPEQHFPGTIGPDLRGVGARLTPGQMRLRLVDATRLNPDTVMPPYYRVDGLTRVADAQRGKPILTAQEIEDVIAFLATLQK

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
104 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
105 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
117 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
120 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
123 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
133 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
170 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
171 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0.44
Rhizoplane 5.24
Rhizosphere 87.77
Stem 0
Stem Tuber 0
Unclassified 11.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100062318 3300005336 Bacteria 3054
2 Ga0070683_100007982 3300005329 Bacteria 8980
3 Ga0070690_100060437 3300005330 Bacteria 2439
4 Ga0068869_100215692 3300005334 Bacteria 1519
5 Ga0068869_101409426 3300005334 Bacteria 617
6 Ga0068868_100107587 3300005338 Bacteria 2263
7 Ga0070689_100060392 3300005340 Bacteria 2947
8 Ga0070669_100854161 3300005353 Bacteria 776
9 Ga0070671_100337500 3300005355 Bacteria 1285
10 Ga0070671_100851726 3300005355 Bacteria 795
11 Ga0070674_100771044 3300005356 Bacteria 828
12 Ga0070673_100023121 3300005364 Bacteria 4538
13 Ga0070667_100124433 3300005367 Bacteria 2246
14 Ga0070709_10207525 3300005434 Bacteria 1391
15 Ga0070714_100242795 3300005435 Bacteria 1663
16 Ga0070714_101259604 3300005435 Unclassified 722
17 Ga0070713_100031265 3300005436 Bacteria 4239
18 Ga0070713_102047583 3300005436 Bacteria 555
19 Ga0070710_10102231 3300005437 Bacteria 1709
20 Ga0070700_100361872 3300005441 Bacteria 1079
21 Ga0070681_10253739 3300005458 Bacteria 1671
22 Ga0070685_10717061 3300005466 Bacteria 730
23 Ga0070706_100200943 3300005467 Bacteria 1862
24 Ga0070707_101802528 3300005468 Unclassified 579
25 Ga0070698_100165891 3300005471 Bacteria 2152
26 Ga0070699_100012326 3300005518 Bacteria 7375
27 Ga0068853_100203750 3300005539 Bacteria 1801
28 Ga0070672_100242644 3300005543 Bacteria 1516
29 Ga0070686_100582649 3300005544 Unclassified 879
30 Ga0070664_100547581 3300005564 Bacteria 1070
31 Ga0068854_100171382 3300005578 Bacteria 1689
32 Ga0068856_101160531 3300005614 Unclassified 789
33 Ga0068852_101436795 3300005616 Unclassified 712
34 Ga0068859_100519144 3300005617 Bacteria 1286
35 Ga0068858_100043035 3300005842 Bacteria 4188
36 Ga0068860_100179239 3300005843 Bacteria 2048
37 Ga0081455_10109127 3300005937 Bacteria 2203
38 Ga0081455_10166328 3300005937 Bacteria 1684
39 Ga0081539_10000785 3300005985 Bacteria 61844
40 Ga0070717_10388050 3300006028 Bacteria 1253
41 Ga0070717_10668910 3300006028 Bacteria 943
42 Ga0075363_100629077 3300006048 Bacteria 645
43 Ga0075432_10036218 3300006058 Bacteria 1715
44 Ga0070715_10024843 3300006163 Bacteria 2366
45 Ga0070712_100471767 3300006175 Unclassified 1048
46 Ga0075367_10400373 3300006178 Bacteria 868
47 Ga0075366_10529699 3300006195 Unclassified 729
48 Ga0068871_100061432 3300006358 Bacteria 3068
49 Ga0075428_100026538 3300006844 Bacteria 6412
50 Ga0075428_100128177 3300006844 Bacteria 2761
51 Ga0075428_100455379 3300006844 Bacteria 1370
52 Ga0075428_100687637 3300006844 Bacteria 1090
53 Ga0075430_100004195 3300006846 Bacteria 12162
54 Ga0075430_100011150 3300006846 Bacteria 7618
55 Ga0075431_100058380 3300006847 Bacteria 3982
56 Ga0075431_100113774 3300006847 Bacteria 2793
57 Ga0075431_101046465 3300006847 Bacteria 782
58 Ga0075433_10002337 3300006852 Bacteria 14428
59 Ga0075433_10312555 3300006852 Bacteria 1390
60 Ga0075434_100007426 3300006871 Bacteria 10147
61 Ga0075429_100023647 3300006880 Bacteria 5332
62 Ga0075429_100378418 3300006880 Bacteria 1239
63 Ga0097620_100519225 3300006931 Bacteria 1286
64 Ga0075435_100003581 3300007076 Bacteria 10553
65 Ga0075435_100179058 3300007076 Bacteria 1791
66 Ga0105240_10381129 3300009093 Bacteria 1593
67 Ga0105240_11878030 3300009093 Bacteria 623
68 Ga0111539_10206141 3300009094 Bacteria 2292
69 Ga0111539_10708999 3300009094 Bacteria 1171
70 Ga0111539_10743882 3300009094 Bacteria 1141
71 Ga0105245_10000925 3300009098 Bacteria 26651
72 Ga0114129_10062210 3300009147 Bacteria 5215
73 Ga0114129_10739577 3300009147 Bacteria 1260
74 Ga0105243_11011806 3300009148 Bacteria 834
75 Ga0105242_10107132 3300009176 Bacteria 2377
76 Ga0105242_11994841 3300009176 Unclassified 622
77 Ga0105248_10128792 3300009177 Bacteria 2855
78 Ga0105237_10152631 3300009545 Bacteria 2306
79 Ga0105238_10025009 3300009551 Bacteria 6087
80 Ga0105238_10066869 3300009551 Bacteria 3595
81 Ga0105249_12118100 3300009553 Bacteria 635
82 Ga0105239_10342915 3300010375 Bacteria 1686
83 Ga0105246_10252213 3300011119 Bacteria 1401
84 Ga0157370_10170217 3300013104 Bacteria 2025
85 Ga0157374_12434770 3300013296 Unclassified 551
86 Ga0157378_10337408 3300013297 Bacteria 1469
87 Ga0157378_10554087 3300013297 Bacteria 1155
88 Ga0163163_11154602 3300014325 Unclassified 837
89 Ga0157380_10842878 3300014326 Bacteria 938
90 Ga0163161_11000482 3300017792 Bacteria 714
91 Ga0213873_10202552 3300021358 Bacteria 616
92 Ga0213876_10160818 3300021384 Bacteria 1194
93 Ga0213875_10000033 3300021388 Bacteria 170944
94 Ga0207692_10108271 3300025898 Bacteria 1537
95 Ga0207685_10532167 3300025905 Bacteria 623
96 Ga0207699_10413089 3300025906 Bacteria 963
97 Ga0207671_10156311 3300025914 Bacteria 1764
98 Ga0207693_10186606 3300025915 Unclassified 1632
99 Ga0207662_10429215 3300025918 Bacteria 900
100 Ga0207694_10055541 3300025924 Bacteria 3074
101 Ga0207659_10059287 3300025926 Bacteria 2751
102 Ga0207687_10006169 3300025927 Bacteria 7932
103 Ga0207700_10258044 3300025928 Bacteria 1491
104 Ga0207700_10926855 3300025928 Bacteria 780
105 Ga0207664_10002586 3300025929 Bacteria 11979
106 Ga0207664_11625458 3300025929 Unclassified 568
107 Ga0207644_10288469 3300025931 Bacteria 1319
108 Ga0207644_10562300 3300025931 Bacteria 945
109 Ga0207706_10546062 3300025933 Bacteria 998
110 Ga0207706_10945724 3300025933 Bacteria 726
111 Ga0207686_10062823 3300025934 Bacteria 2360
112 Ga0207709_10368495 3300025935 Bacteria 1089
113 Ga0207709_11097771 3300025935 Bacteria 653
114 Ga0207691_10124179 3300025940 Bacteria 2285
115 Ga0207691_10288844 3300025940 Bacteria 1410
116 Ga0207711_10091140 3300025941 Bacteria 2681
117 Ga0207689_10176308 3300025942 Bacteria 1763
118 Ga0207661_10036435 3300025944 Bacteria 3840
119 Ga0207651_10031473 3300025960 Bacteria 3392
120 Ga0207651_10393730 3300025960 Bacteria 1177
121 Ga0207640_10159799 3300025981 Bacteria 1666
122 Ga0207658_10078045 3300025986 Bacteria 2529
123 Ga0207639_10290836 3300026041 Bacteria 1441
124 Ga0207702_11662369 3300026078 Unclassified 631
125 Ga0207676_10762091 3300026095 Bacteria 942
126 Ga0207683_10161777 3300026121 Bacteria 2024
127 Ga0207428_10000417 3300027907 Bacteria 52860
128 Ga0207428_10001576 3300027907 Bacteria 23751
129 Ga0207428_10153151 3300027907 Bacteria 1754
130 Ga0268264_10159618 3300028381 Bacteria 2030
131 Ga0265337_1002058 3300028556 Bacteria 9514
132 Ga0307513_10326583 3300031456 Bacteria 1290
133 Ga0307416_100469832 3300032002 Bacteria 1315
134 Ga0373928_0185535 3300035084 Bacteria 593
135 Ga0373951_0154452 3300035091 Bacteria 645
136 Ga0373952_0069469 3300035092 Bacteria 878
137 Ga0373936_0305225 3300035113 Unclassified 719
138 Ga0373943_0107979 3300035170 Bacteria 1464
139 Ga0373935_0587179 3300035692 Bacteria 814
140 Ga0373937_0417219 3300036401 Bacteria 1274
141 Ga0436364_0232752 3300037853 Bacteria 5954
142 Ga0436364_1004726 3300037853 Bacteria 948
143 Ga0436365_0024447 3300039437 Bacteria 579
144 Ga0436365_0451906 3300039437 Bacteria 1688
145 Ga0436365_1212948 3300039437 Bacteria 1396
146 Ga0436365_1918854 3300039437 Bacteria 6240
147 Ga0436360_0485249 3300039438 Unclassified 1069
148 Ga0436360_1316019 3300039438 Bacteria 1904
149 Ga0436361_0115436 3300039447 Bacteria 1082
150 Ga0436361_0705343 3300039447 Bacteria 785
151 Ga0436363_0531881 3300039450 Bacteria 957
152 Ga0436362_0771354 3300039453 Bacteria 2388
153 Ga0439435_0141072 3300042436 Bacteria 768
154 Ga0439464_0156020 3300042439 Bacteria 716
155 Ga0495638_0019694 3300046460 Bacteria 4462
156 Ga0495584_0010454 3300046491 Bacteria 4768
157 Ga0495584_0054488 3300046491 Bacteria 2013
158 Ga0495585_0007171 3300046492 Bacteria 6844
159 Ga0495585_0344416 3300046492 Unclassified 725
160 Ga0495607_0011806 3300046501 Bacteria 5793
161 Ga0495637_0048728 3300046520 Bacteria 1783
162 Ga0495663_0078181 3300046525 Bacteria 1062
163 Ga0495642_0275985 3300046528 Bacteria 736
164 Ga0495609_0124751 3300046538 Bacteria 1106
165 Ga0495633_0041177 3300046558 Bacteria 2197
166 Ga0495656_0013951 3300046615 Bacteria 3001
167 Ga0495659_0030920 3300046664 Bacteria 1865
168 Ga0495661_0153464 3300046665 Bacteria 1242
169 Ga0495670_0004308 3300046691 Bacteria 6972
170 Ga0495672_0038562 3300047320 Bacteria 2914
171 Ga0495672_0131870 3300047320 Bacteria 1313
172 Ga0495677_0142347 3300047445 Bacteria 921
173 Ga0495615_0130533 3300048090 Bacteria 734
174 Ga0496104_0001647 3300048907 Bacteria 19277
175 Ga0496104_0004065 3300048907 Bacteria 12684
176 Ga0496105_0022918 3300048908 Bacteria 5062
177 Ga0496105_0334118 3300048908 Bacteria 1213
178 Ga0496107_0660805 3300048910 Unclassified 770
179 Ga0496107_1345913 3300048910 Unclassified 510
180 Ga0496108_0354276 3300048911 Bacteria 1281
181 Ga0496109_0119454 3300048912 Bacteria 2454
182 Ga0496112_0597758 3300048915 Bacteria 1035
183 Ga0496114_0082601 3300048917 Bacteria 2716
184 Ga0496115_0022771 3300048918 Bacteria 4857
185 Ga0496115_1471010 3300048918 Unclassified 500
186 Ga0501036_0614298 3300049572 Unclassified 901
187 Ga0501037_0343548 3300049573 Bacteria 1031
188 Ga0501041_0618496 3300049577 Unclassified 692
189 Ga0501048_0282266 3300049582 Unclassified 1181
190 Ga0501072_0266659 3300049588 Unclassified 1363
191 Ga0501073_0465869 3300049589 Bacteria 874
192 Ga0501074_0228028 3300049590 Unclassified 1326
193 Ga0501075_0224935 3300049591 Bacteria 1431
194 Ga0501076_0200786 3300049592 Bacteria 1628
195 Ga0501076_0245097 3300049592 Bacteria 1466
196 Ga0501077_0113909 3300049593 Bacteria 1715
197 Ga0501079_0347499 3300049741 Bacteria 1162
198 Ga0501079_0369313 3300049741 Bacteria 1125
199 Ga0501081_0056018 3300049743 Bacteria 2724
200 Ga0501081_0337470 3300049743 Bacteria 1109
201 Ga0501081_1013298 3300049743 Bacteria 628
202 Ga0501035_0414573 3300049822 Bacteria 1119
203 Ga0501045_0923544 3300049824 Bacteria 641
204 nmdc:mga0k408_536082_c1 3300050493 Unclassified 692
205 nmdc:mga05p37_367784_c1 3300050507 Bacteria 1688
206 nmdc:mga05p37_46111_c1 3300050507 Bacteria 5360
207 nmdc:mga09592_362186_c1 3300050508 Bacteria 1255
208 nmdc:mga09592_5534_c1 3300050508 Bacteria 10283
209 nmdc:mga0qj67_16667_c1 3300050509 Bacteria 5577
210 nmdc:mga0qj67_96001_c1 3300050509 Bacteria 2387
211 nmdc:mga06r32_288884_c1 3300050510 Bacteria 1627
212 nmdc:mga06r32_3148_c1 3300050510 Bacteria 14786
213 nmdc:mga06r32_316783_c1 3300050510 Bacteria 1545
214 nmdc:mga08y16_1526737_c1 3300050511 Unclassified 628
215 nmdc:mga08y16_166161_c1 3300050511 Bacteria 2292
216 nmdc:mga08y16_217643_c1 3300050511 Bacteria 1977
217 nmdc:mga08y16_4218_c1 3300050511 Bacteria 14993
218 nmdc:mga08y16_493082_c1 3300050511 Bacteria 1245
219 nmdc:mga0n895_10158_c1 3300050512 Bacteria 8290
220 nmdc:mga0rr50_16531_c1 3300050513 Bacteria 4905
221 nmdc:mga0a205_2906_c2 3300050515 Bacteria 6369
222 Ga0495595_0072121 3300053084 Bacteria 1634
223 Ga0495619_0217890 3300053085 Bacteria 1322
224 Ga0495619_0299659 3300053085 Bacteria 1113
225 Ga0501084_0310238 3300054114 Bacteria 1332
226 Ga0501082_0573183 3300060353 Bacteria 987
227 Ga0530510_0079249 3300061734 Bacteria 2389
228 2876813625 2876808645 Bacteria 8824342
229 2879117446 2879110137 Bacteria 8907982
230 Ga0070680_100062318
231 Ga0070683_100007982
232 Ga0070690_100060437
233 Ga0068869_100215692
234 Ga0068869_101409426
235 Ga0068868_100107587
236 Ga0070689_100060392
237 Ga0070669_100854161
238 Ga0070671_100337500
239 Ga0070671_100851726
240 Ga0070674_100771044
241 Ga0070673_100023121
242 Ga0070667_100124433
243 Ga0070709_10207525
244 Ga0070714_100242795
245 Ga0070714_101259604
246 Ga0070713_100031265
247 Ga0070713_102047583
248 Ga0070710_10102231
249 Ga0070700_100361872
250 Ga0070681_10253739
251 Ga0070685_10717061
252 Ga0070706_100200943
253 Ga0070707_101802528
254 Ga0070698_100165891
255 Ga0070699_100012326
256 Ga0068853_100203750
257 Ga0070672_100242644
258 Ga0070686_100582649
259 Ga0070664_100547581
260 Ga0068854_100171382
261 Ga0068856_101160531
262 Ga0068852_101436795
263 Ga0068859_100519144
264 Ga0068858_100043035
265 Ga0068860_100179239
266 Ga0081455_10109127
267 Ga0081455_10166328
268 Ga0081539_10000785
269 Ga0070717_10388050
270 Ga0070717_10668910
271 Ga0075363_100629077
272 Ga0075432_10036218
273 Ga0070715_10024843
274 Ga0070712_100471767
275 Ga0075367_10400373
276 Ga0075366_10529699
277 Ga0068871_100061432
278 Ga0075428_100026538
279 Ga0075428_100128177
280 Ga0075428_100455379
281 Ga0075428_100687637
282 Ga0075430_100004195
283 Ga0075430_100011150
284 Ga0075431_100058380
285 Ga0075431_100113774
286 Ga0075431_101046465
287 Ga0075433_10002337
288 Ga0075433_10312555
289 Ga0075434_100007426
290 Ga0075429_100023647
291 Ga0075429_100378418
292 Ga0097620_100519225
293 Ga0075435_100003581
294 Ga0075435_100179058
295 Ga0105240_10381129
296 Ga0105240_11878030
297 Ga0111539_10206141
298 Ga0111539_10708999
299 Ga0111539_10743882
300 Ga0105245_10000925
301 Ga0114129_10062210
302 Ga0114129_10739577
303 Ga0105243_11011806
304 Ga0105242_10107132
305 Ga0105242_11994841
306 Ga0105248_10128792
307 Ga0105237_10152631
308 Ga0105238_10025009
309 Ga0105238_10066869
310 Ga0105249_12118100
311 Ga0105239_10342915
312 Ga0105246_10252213
313 Ga0157370_10170217
314 Ga0157374_12434770
315 Ga0157378_10337408
316 Ga0157378_10554087
317 Ga0163163_11154602
318 Ga0157380_10842878
319 Ga0163161_11000482
320 Ga0213873_10202552
321 Ga0213876_10160818
322 Ga0213875_10000033
323 Ga0207692_10108271
324 Ga0207685_10532167
325 Ga0207699_10413089
326 Ga0207671_10156311
327 Ga0207693_10186606
328 Ga0207662_10429215
329 Ga0207694_10055541
330 Ga0207659_10059287
331 Ga0207687_10006169
332 Ga0207700_10258044
333 Ga0207700_10926855
334 Ga0207664_10002586
335 Ga0207664_11625458
336 Ga0207644_10288469
337 Ga0207644_10562300
338 Ga0207706_10546062
339 Ga0207706_10945724
340 Ga0207686_10062823
341 Ga0207709_10368495
342 Ga0207709_11097771
343 Ga0207691_10124179
344 Ga0207691_10288844
345 Ga0207711_10091140
346 Ga0207689_10176308
347 Ga0207661_10036435
348 Ga0207651_10031473
349 Ga0207651_10393730
350 Ga0207640_10159799
351 Ga0207658_10078045
352 Ga0207639_10290836
353 Ga0207702_11662369
354 Ga0207676_10762091
355 Ga0207683_10161777
356 Ga0207428_10000417
357 Ga0207428_10001576
358 Ga0207428_10153151
359 Ga0268264_10159618
360 Ga0265337_1002058
361 Ga0307513_10326583
362 Ga0307416_100469832
363 Ga0373928_0185535
364 Ga0373951_0154452
365 Ga0373952_0069469
366 Ga0373936_0305225
367 Ga0373943_0107979
368 Ga0373935_0587179
369 Ga0373937_0417219
370 Ga0436364_0232752
371 Ga0436364_1004726
372 Ga0436365_0024447
373 Ga0436365_0451906
374 Ga0436365_1212948
375 Ga0436365_1918854
376 Ga0436360_0485249
377 Ga0436360_1316019
378 Ga0436361_0115436
379 Ga0436361_0705343
380 Ga0436363_0531881
381 Ga0436362_0771354
382 Ga0439435_0141072
383 Ga0439464_0156020
384 Ga0495638_0019694
385 Ga0495584_0010454
386 Ga0495584_0054488
387 Ga0495585_0007171
388 Ga0495585_0344416
389 Ga0495607_0011806
390 Ga0495637_0048728
391 Ga0495663_0078181
392 Ga0495642_0275985
393 Ga0495609_0124751
394 Ga0495633_0041177
395 Ga0495656_0013951
396 Ga0495659_0030920
397 Ga0495661_0153464
398 Ga0495670_0004308
399 Ga0495672_0038562
400 Ga0495672_0131870
401 Ga0495677_0142347
402 Ga0495615_0130533
403 Ga0496104_0001647
404 Ga0496104_0004065
405 Ga0496105_0022918
406 Ga0496105_0334118
407 Ga0496107_0660805
408 Ga0496107_1345913
409 Ga0496108_0354276
410 Ga0496109_0119454
411 Ga0496112_0597758
412 Ga0496114_0082601
413 Ga0496115_0022771
414 Ga0496115_1471010
415 Ga0501036_0614298
416 Ga0501037_0343548
417 Ga0501041_0618496
418 Ga0501048_0282266
419 Ga0501072_0266659
420 Ga0501073_0465869
421 Ga0501074_0228028
422 Ga0501075_0224935
423 Ga0501076_0200786
424 Ga0501076_0245097
425 Ga0501077_0113909
426 Ga0501079_0347499
427 Ga0501079_0369313
428 Ga0501081_0056018
429 Ga0501081_0337470
430 Ga0501081_1013298
431 Ga0501035_0414573
432 Ga0501045_0923544
433 nmdc:mga0k408_536082_c1
434 nmdc:mga05p37_367784_c1
435 nmdc:mga05p37_46111_c1
436 nmdc:mga09592_362186_c1
437 nmdc:mga09592_5534_c1
438 nmdc:mga0qj67_16667_c1
439 nmdc:mga0qj67_96001_c1
440 nmdc:mga06r32_288884_c1
441 nmdc:mga06r32_3148_c1
442 nmdc:mga06r32_316783_c1
443 nmdc:mga08y16_1526737_c1
444 nmdc:mga08y16_166161_c1
445 nmdc:mga08y16_217643_c1
446 nmdc:mga08y16_4218_c1
447 nmdc:mga08y16_493082_c1
448 nmdc:mga0n895_10158_c1
449 nmdc:mga0rr50_16531_c1
450 nmdc:mga0a205_2906_c2
451 Ga0495595_0072121
452 Ga0495619_0217890
453 Ga0495619_0299659
454 Ga0501084_0310238
455 Ga0501082_0573183
456 Ga0530510_0079249
457 2876813625
458 2879117446

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h31-assembly1.cif.gz_B oxidised soxax complex from rhodovulum sulfidophilum 0.8657 27 148
2c1d-assembly4.cif.gz_H crystal structure of soxxa from p. pantotrophus 0.8619 27 148
1h33-assembly1.cif.gz_B oxidised soxax complex from rhodovulum sulfidophilum 0.8434 27 146
2oz1-assembly1.cif.gz_B the soxax complex of rhodovulum sulfidophilum 0.8327 27 146
1k3g-assembly1.cif.gz_A nmr solution structure of oxidized cytochrome c-553 from bacillus pasteurii 0.7767 75 147
ID Description Score Start End Superfamily
2c1dD00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8609 27 148 1.10.760.10
2oz1D00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8601 27 146 1.10.760.10
1k3gA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7767 75 147 1.10.760.10
2c1dD00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7685 27 148 1.10.760.10
2oz1D00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7578 27 146 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A7W1AM11-F1-model_v4 Sulfur oxidation c-type cytochrome SoxX 0.9056 24 148 GO:0009055
GO:0020037
GO:0046872
AF-A0A1Q3LGE5-F1-model_v4 Sulfur oxidation c-type cytochrome SoxX 0.9038 30 148 GO:0009055
GO:0020037
GO:0046872
AF-A0A849TJJ3-F1-model_v4 Sulfur oxidation c-type cytochrome SoxX 0.9011 25 148 GO:0009055
GO:0020037
GO:0046872
AF-A0A150UL95-F1-model_v4 Cytochrome C 0.9005 22 148 GO:0009055
GO:0020037
GO:0046872
AF-A0A1Q4DM83-F1-model_v4 Sulfur oxidation c-type cytochrome SoxX 0.9002 21 148 GO:0009055
GO:0020037
GO:0046872

Map