F341537

General Info

Members Datasets Scaffolds Average Seq Length
228 166 456 221

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3004334049|3004340063
Length 262
Sequence GWSFIFIIRPVNRSQPLGVKEPITANLAWAGALRNAASPRNIQPREADMTNTPSSETPRPGTIDMKLEAVIIAVADADRSKRFYGGLGWRLDADFVVGDAFRVVQFTPPGSPCSIHFGKGLTSAAPGSAKGLYLVVSDIEAAHAELVARGVEASEVFHRAGPGQPPISGRHPEGRSYSSYVTFSDPDGNSFILQEITQRLPGRVDASDTIFTSSGELAAALRRAAAAHGEHEKRTGGQHDVNWPDWYAEYMVAEQAGTPLPT

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
100 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
107 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
108 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
148 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
149 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
153 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
154 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
155 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
156 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
157 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
158 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
159 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
160 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
161 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
162 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
163 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
164 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
165 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
166 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.42
Metatranscriptomes 0
Isolates 6.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.33
Nodule 4.39
Rhizoplane 14.47
Rhizosphere 64.04
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1010949 3300003354 Bacteria 3249
2 Ga0055542_1000816 3300003762 Bacteria 22710
3 Ga0065712_10007654 3300005290 Bacteria 4131
4 Ga0070683_100397978 3300005329 Bacteria 1313
5 Ga0070670_100198884 3300005331 Bacteria 1741
6 Ga0070680_100486920 3300005336 Bacteria 1055
7 Ga0070660_100111271 3300005339 Bacteria 2179
8 Ga0070689_100093927 3300005340 Bacteria 2368
9 Ga0070668_100016582 3300005347 Bacteria 5507
10 Ga0070668_100685355 3300005347 Bacteria 903
11 Ga0070659_100367899 3300005366 Bacteria 1209
12 Ga0070659_100386009 3300005366 Bacteria 1180
13 Ga0070678_100021347 3300005456 Bacteria 4268
14 Ga0070662_100113052 3300005457 Bacteria 2071
15 Ga0070662_100403157 3300005457 Bacteria 1129
16 Ga0070681_10049525 3300005458 Bacteria 4195
17 Ga0070707_101097364 3300005468 Bacteria 762
18 Ga0068853_100588801 3300005539 Bacteria 1056
19 Ga0070686_100219545 3300005544 Bacteria 1373
20 Ga0070665_100578528 3300005548 Bacteria 1136
21 Ga0068855_100503910 3300005563 Unclassified 1315
22 Ga0068855_100592965 3300005563 Bacteria 1196
23 Ga0070664_100536988 3300005564 Bacteria 1080
24 Ga0068857_100074234 3300005577 Bacteria 3031
25 Ga0068857_100563673 3300005577 Bacteria 1074
26 Ga0068854_100856798 3300005578 Bacteria 796
27 Ga0068856_100239939 3300005614 Bacteria 1828
28 Ga0068856_100662951 3300005614 Bacteria 1064
29 Ga0068859_100000151 3300005617 Bacteria 66183
30 Ga0068863_100023650 3300005841 Bacteria 5865
31 Ga0068858_100125887 3300005842 Bacteria 2399
32 Ga0068858_100430028 3300005842 Bacteria 1270
33 Ga0068860_100339699 3300005843 Bacteria 1476
34 Ga0068862_100049583 3300005844 Bacteria 3587
35 Ga0075367_10038602 3300006178 Bacteria 2780
36 Ga0075367_10184874 3300006178 Bacteria 1300
37 Ga0075369_10050750 3300006186 Bacteria 1795
38 Ga0075366_10044366 3300006195 Bacteria 2635
39 Ga0075428_100153970 3300006844 Bacteria 2497
40 Ga0075430_100006593 3300006846 Bacteria 9785
41 Ga0075431_100004515 3300006847 Bacteria 13665
42 Ga0075434_100333527 3300006871 Bacteria 1537
43 Ga0075429_100002526 3300006880 Bacteria 15402
44 Ga0097620_100000151 3300006931 Bacteria 66183
45 Ga0105240_10015460 3300009093 Bacteria 10376
46 Ga0111539_10003032 3300009094 Bacteria 22269
47 Ga0111539_10350261 3300009094 Bacteria 1719
48 Ga0111539_10440275 3300009094 Bacteria 1518
49 Ga0111539_10478628 3300009094 Bacteria 1450
50 Ga0105247_10005040 3300009101 Bacteria 8380
51 Ga0105247_10023496 3300009101 Bacteria 3714
52 Ga0114129_10001297 3300009147 Bacteria 33328
53 Ga0105243_10704058 3300009148 Bacteria 985
54 Ga0105241_10141041 3300009174 Bacteria 1962
55 Ga0105242_10368503 3300009176 Bacteria 1331
56 Ga0105248_10000636 3300009177 Bacteria 39914
57 Ga0105248_10013665 3300009177 Bacteria 8938
58 Ga0105237_10067011 3300009545 Bacteria 3584
59 Ga0105238_10032764 3300009551 Bacteria 5289
60 Ga0105238_10199840 3300009551 Bacteria 1974
61 Ga0105249_10019581 3300009553 Bacteria 6039
62 Ga0105239_10028440 3300010375 Bacteria 6149
63 Ga0105239_10153820 3300010375 Bacteria 2568
64 Ga0105239_10243649 3300010375 Bacteria 2018
65 Ga0105239_10528691 3300010375 Bacteria 1342
66 Ga0157370_10034731 3300013104 Bacteria 4906
67 Ga0157369_10004057 3300013105 Bacteria 17343
68 Ga0157369_10594550 3300013105 Bacteria 1142
69 Ga0157374_10028385 3300013296 Bacteria 5055
70 Ga0157374_10491461 3300013296 Bacteria 1231
71 Ga0157378_10089249 3300013297 Bacteria 2799
72 Ga0157375_10059565 3300013308 Bacteria 3784
73 Ga0163163_10002823 3300014325 Bacteria 14683
74 Ga0163163_10061468 3300014325 Bacteria 3722
75 Ga0163163_10255498 3300014325 Bacteria 1803
76 Ga0157380_10692148 3300014326 Unclassified 1023
77 Ga0157379_10103029 3300014968 Bacteria 2561
78 Ga0157379_10139867 3300014968 Bacteria 2182
79 Ga0182007_10077181 3300015262 Bacteria 1092
80 Ga0209148_1000038 3300025254 Bacteria 493744
81 Ga0209455_1000068 3300025272 Bacteria 310024
82 Ga0209130_1000680 3300025284 Bacteria 30690
83 Ga0209130_1001258 3300025284 Bacteria 17672
84 Ga0207426_1000092 3300025302 Bacteria 278907
85 Ga0207426_1000356 3300025302 Bacteria 83393
86 Ga0207653_10021861 3300025885 Bacteria 2030
87 Ga0207710_10036831 3300025900 Bacteria 2158
88 Ga0207710_10101661 3300025900 Bacteria 1356
89 Ga0207647_10100648 3300025904 Bacteria 1715
90 Ga0207654_10092761 3300025911 Bacteria 1845
91 Ga0207707_10062465 3300025912 Bacteria 3241
92 Ga0207695_10035518 3300025913 Bacteria 5404
93 Ga0207671_10058266 3300025914 Bacteria 2863
94 Ga0207671_10243558 3300025914 Bacteria 1413
95 Ga0207660_10006019 3300025917 Bacteria 7873
96 Ga0207657_10119762 3300025919 Bacteria 2166
97 Ga0207694_10015335 3300025924 Bacteria 5782
98 Ga0207694_10081189 3300025924 Bacteria 2546
99 Ga0207694_10158008 3300025924 Bacteria 1830
100 Ga0207650_10262265 3300025925 Bacteria 1402
101 Ga0207690_10144032 3300025932 Bacteria 1759
102 Ga0207690_10788328 3300025932 Bacteria 785
103 Ga0207706_10473764 3300025933 Bacteria 1082
104 Ga0207709_10945589 3300025935 Bacteria 702
105 Ga0207670_10053977 3300025936 Bacteria 2710
106 Ga0207669_10468288 3300025937 Bacteria 1002
107 Ga0207689_10986646 3300025942 Bacteria 711
108 Ga0207679_10247555 3300025945 Bacteria 1513
109 Ga0207667_10175423 3300025949 Bacteria 2202
110 Ga0207667_10353213 3300025949 Unclassified 1499
111 Ga0207712_10041025 3300025961 Bacteria 3179
112 Ga0207668_10116952 3300025972 Bacteria 2011
113 Ga0207668_10315912 3300025972 Bacteria 1295
114 Ga0207658_10587714 3300025986 Bacteria 999
115 Ga0207703_10675550 3300026035 Bacteria 981
116 Ga0207639_10354602 3300026041 Bacteria 1311
117 Ga0207678_10656339 3300026067 Bacteria 922
118 Ga0207702_10274661 3300026078 Bacteria 1591
119 Ga0207641_10331059 3300026088 Bacteria 1447
120 Ga0207641_11070427 3300026088 Bacteria 804
121 Ga0207648_10030417 3300026089 Bacteria 4782
122 Ga0207674_10066224 3300026116 Bacteria 3639
123 Ga0207683_10039295 3300026121 Bacteria 4128
124 Ga0209179_1056796 3300027512 Bacteria 846
125 Ga0207428_10074509 3300027907 Bacteria 2662
126 Ga0268266_10992806 3300028379 Bacteria 812
127 Ga0268265_10000554 3300028380 Bacteria 38099
128 Ga0268265_10445413 3300028380 Bacteria 1208
129 Ga0268264_10208543 3300028381 Bacteria 1792
130 Ga0307513_10394305 3300031456 Bacteria 1120
131 Ga0307510_10018842 3300033180 Bacteria 8102
132 Ga0373949_0017820 3300035090 Bacteria 1604
133 Ga0373962_0127160 3300035242 Bacteria 817
134 Ga0373931_0000166 3300035691 Bacteria 28738
135 Ga0395900_0954339 3300037418 Bacteria 779
136 Ga0436364_0784622 3300037853 Bacteria 1122
137 Ga0436360_0724841 3300039438 Bacteria 758
138 Ga0436363_0096636 3300039450 Bacteria 913
139 Ga0436363_1009783 3300039450 Bacteria 2466
140 Ga0436363_1251040 3300039450 Bacteria 1602
141 Ga0450907_017401 3300042146 Bacteria 1199
142 Ga0439464_0012783 3300042439 Bacteria 2239
143 Ga0439440_0006932 3300042993 Bacteria 2293
144 Ga0453683_0166647 3300044673 Bacteria 1395
145 Ga0495638_0072835 3300046460 Bacteria 2098
146 Ga0495650_0143555 3300046471 Bacteria 862
147 Ga0495584_0055847 3300046491 Bacteria 1987
148 Ga0495585_0204759 3300046492 Bacteria 1003
149 Ga0495610_0013061 3300046512 Bacteria 4955
150 Ga0495649_0206661 3300046694 Bacteria 1018
151 Ga0496100_0449867 3300048903 Bacteria 987
152 Ga0496101_0033596 3300048904 Bacteria 3618
153 Ga0496104_0001721 3300048907 Bacteria 18894
154 Ga0496104_0027064 3300048907 Bacteria 5303
155 Ga0496104_0089388 3300048907 Bacteria 2942
156 Ga0496104_0126650 3300048907 Bacteria 2452
157 Ga0496105_0036122 3300048908 Bacteria 4069
158 Ga0496105_0055616 3300048908 Bacteria 3267
159 Ga0496105_0099401 3300048908 Bacteria 2403
160 Ga0496106_0577464 3300048909 Bacteria 901
161 Ga0496107_0222439 3300048910 Bacteria 1404
162 Ga0496107_0508625 3300048910 Bacteria 893
163 Ga0496108_0002969 3300048911 Bacteria 13629
164 Ga0496108_0008183 3300048911 Bacteria 8486
165 Ga0496108_0017068 3300048911 Bacteria 5935
166 Ga0496108_0024190 3300048911 Bacteria 5000
167 Ga0496109_0000700 3300048912 Bacteria 27897
168 Ga0496109_0011529 3300048912 Bacteria 7604
169 Ga0496109_0017024 3300048912 Bacteria 6362
170 Ga0496109_0043558 3300048912 Plasmid 4068
171 Ga0496110_0006802 3300048913 Bacteria 9093
172 Ga0496110_0036839 3300048913 Bacteria 4249
173 Ga0496110_0156693 3300048913 Bacteria 2063
174 Ga0496111_0025381 3300048914 Plasmid 4182
175 Ga0496111_0053816 3300048914 Bacteria 2908
176 Ga0496112_0001521 3300048915 Bacteria 17863
177 Ga0496112_0011435 3300048915 Bacteria 8105
178 Ga0496112_0040516 3300048915 Bacteria 4554
179 Ga0496112_0065731 3300048915 Bacteria 3579
180 Ga0496112_0128368 3300048915 Bacteria 2506
181 Ga0496113_0001279 3300048916 Bacteria 13876
182 Ga0496113_0007893 3300048916 Bacteria 6885
183 Ga0496115_0023615 3300048918 Plasmid 4773
184 Ga0496117_0000316 3300048920 Bacteria 84475
185 Ga0496118_0000003 3300048921 Bacteria 773148
186 Ga0496119_0000252 3300048922 Bacteria 75901
187 Ga0496119_0082362 3300048922 Bacteria 1851
188 Ga0496120_0152760 3300048923 Bacteria 1159
189 Ga0496121_0093241 3300048924 Bacteria 2345
190 Ga0496121_0129452 3300048924 Bacteria 1892
191 Ga0496122_0069214 3300048925 Bacteria 2529
192 Ga0496125_0088624 3300048928 Bacteria 2331
193 Ga0496126_0010603 3300048929 Bacteria 9637
194 Ga0496126_0175851 3300048929 Bacteria 1821
195 Ga0501083_0233951 3300049744 Bacteria 1196
196 nmdc:mga00v17_63877_c1 3300050491 Bacteria 2268
197 nmdc:mga0yw44_2802_c1 3300050492 Bacteria 7553
198 nmdc:mga06z11_439432_c1 3300050494 Bacteria 788
199 nmdc:mga05p37_901_c1 3300050507 Bacteria 33493
200 nmdc:mga09592_3589_c1 3300050508 Bacteria 12517
201 nmdc:mga0qj67_168_c1 3300050509 Bacteria 43793
202 nmdc:mga0qj67_3835_c2 3300050509 Bacteria 8250
203 nmdc:mga06r32_4437_c1 3300050510 Bacteria 12559
204 nmdc:mga08y16_1083_c1 3300050511 Bacteria 26813
205 nmdc:mga08y16_315013_c1 3300050511 Bacteria 1611
206 nmdc:mga0n895_305040_c1 3300050512 Bacteria 1614
207 nmdc:mga0n895_69022_c1 3300050512 Bacteria 3501
208 nmdc:mga0sz30_12606_c1 3300050516 Bacteria 3292
209 nmdc:mga0sz30_22127_c1 3300050516 Bacteria 2578
210 Ga0500610_0000636 3300053079 Bacteria 10807
211 Ga0500568_0000219 3300053139 Bacteria 49081
212 Ga0501084_0037595 3300054114 Bacteria 4046
213 Ga0501082_0153677 3300060353 Bacteria 1999
214 3004340063 3004334049 Bacteria 8449246
215 2588516079 2588253730 Bacteria 6881675
216 2844012079 2844009547 Bacteria 6728125
217 2874170722 2874168670 Bacteria 8062617
218 2876368193 2876363079 Bacteria 6544991
219 2882461092 2882456835 Bacteria 6863978
220 2903452211 2903448605 Bacteria 7357801
221 2903527189 2903521522 Bacteria 6525694
222 2903530253 2903528002 Bacteria 6586099
223 2917700889 2917699015 Bacteria 7043791
224 2935923678 2935916978 Bacteria 9113783
225 2963648766 2963644680 Bacteria 6530403
226 2968083991 2968083720 Bacteria 7351627
227 3004273308 3004268573 Bacteria 7043476
228 8016631333 8016630954 Bacteria 9217207
229 JGI25160J50197_1010949
230 Ga0055542_1000816
231 Ga0065712_10007654
232 Ga0070683_100397978
233 Ga0070670_100198884
234 Ga0070680_100486920
235 Ga0070660_100111271
236 Ga0070689_100093927
237 Ga0070668_100016582
238 Ga0070668_100685355
239 Ga0070659_100367899
240 Ga0070659_100386009
241 Ga0070678_100021347
242 Ga0070662_100113052
243 Ga0070662_100403157
244 Ga0070681_10049525
245 Ga0070707_101097364
246 Ga0068853_100588801
247 Ga0070686_100219545
248 Ga0070665_100578528
249 Ga0068855_100503910
250 Ga0068855_100592965
251 Ga0070664_100536988
252 Ga0068857_100074234
253 Ga0068857_100563673
254 Ga0068854_100856798
255 Ga0068856_100239939
256 Ga0068856_100662951
257 Ga0068859_100000151
258 Ga0068863_100023650
259 Ga0068858_100125887
260 Ga0068858_100430028
261 Ga0068860_100339699
262 Ga0068862_100049583
263 Ga0075367_10038602
264 Ga0075367_10184874
265 Ga0075369_10050750
266 Ga0075366_10044366
267 Ga0075428_100153970
268 Ga0075430_100006593
269 Ga0075431_100004515
270 Ga0075434_100333527
271 Ga0075429_100002526
272 Ga0097620_100000151
273 Ga0105240_10015460
274 Ga0111539_10003032
275 Ga0111539_10350261
276 Ga0111539_10440275
277 Ga0111539_10478628
278 Ga0105247_10005040
279 Ga0105247_10023496
280 Ga0114129_10001297
281 Ga0105243_10704058
282 Ga0105241_10141041
283 Ga0105242_10368503
284 Ga0105248_10000636
285 Ga0105248_10013665
286 Ga0105237_10067011
287 Ga0105238_10032764
288 Ga0105238_10199840
289 Ga0105249_10019581
290 Ga0105239_10028440
291 Ga0105239_10153820
292 Ga0105239_10243649
293 Ga0105239_10528691
294 Ga0157370_10034731
295 Ga0157369_10004057
296 Ga0157369_10594550
297 Ga0157374_10028385
298 Ga0157374_10491461
299 Ga0157378_10089249
300 Ga0157375_10059565
301 Ga0163163_10002823
302 Ga0163163_10061468
303 Ga0163163_10255498
304 Ga0157380_10692148
305 Ga0157379_10103029
306 Ga0157379_10139867
307 Ga0182007_10077181
308 Ga0209148_1000038
309 Ga0209455_1000068
310 Ga0209130_1000680
311 Ga0209130_1001258
312 Ga0207426_1000092
313 Ga0207426_1000356
314 Ga0207653_10021861
315 Ga0207710_10036831
316 Ga0207710_10101661
317 Ga0207647_10100648
318 Ga0207654_10092761
319 Ga0207707_10062465
320 Ga0207695_10035518
321 Ga0207671_10058266
322 Ga0207671_10243558
323 Ga0207660_10006019
324 Ga0207657_10119762
325 Ga0207694_10015335
326 Ga0207694_10081189
327 Ga0207694_10158008
328 Ga0207650_10262265
329 Ga0207690_10144032
330 Ga0207690_10788328
331 Ga0207706_10473764
332 Ga0207709_10945589
333 Ga0207670_10053977
334 Ga0207669_10468288
335 Ga0207689_10986646
336 Ga0207679_10247555
337 Ga0207667_10175423
338 Ga0207667_10353213
339 Ga0207712_10041025
340 Ga0207668_10116952
341 Ga0207668_10315912
342 Ga0207658_10587714
343 Ga0207703_10675550
344 Ga0207639_10354602
345 Ga0207678_10656339
346 Ga0207702_10274661
347 Ga0207641_10331059
348 Ga0207641_11070427
349 Ga0207648_10030417
350 Ga0207674_10066224
351 Ga0207683_10039295
352 Ga0209179_1056796
353 Ga0207428_10074509
354 Ga0268266_10992806
355 Ga0268265_10000554
356 Ga0268265_10445413
357 Ga0268264_10208543
358 Ga0307513_10394305
359 Ga0307510_10018842
360 Ga0373949_0017820
361 Ga0373962_0127160
362 Ga0373931_0000166
363 Ga0395900_0954339
364 Ga0436364_0784622
365 Ga0436360_0724841
366 Ga0436363_0096636
367 Ga0436363_1009783
368 Ga0436363_1251040
369 Ga0450907_017401
370 Ga0439464_0012783
371 Ga0439440_0006932
372 Ga0453683_0166647
373 Ga0495638_0072835
374 Ga0495650_0143555
375 Ga0495584_0055847
376 Ga0495585_0204759
377 Ga0495610_0013061
378 Ga0495649_0206661
379 Ga0496100_0449867
380 Ga0496101_0033596
381 Ga0496104_0001721
382 Ga0496104_0027064
383 Ga0496104_0089388
384 Ga0496104_0126650
385 Ga0496105_0036122
386 Ga0496105_0055616
387 Ga0496105_0099401
388 Ga0496106_0577464
389 Ga0496107_0222439
390 Ga0496107_0508625
391 Ga0496108_0002969
392 Ga0496108_0008183
393 Ga0496108_0017068
394 Ga0496108_0024190
395 Ga0496109_0000700
396 Ga0496109_0011529
397 Ga0496109_0017024
398 Ga0496109_0043558
399 Ga0496110_0006802
400 Ga0496110_0036839
401 Ga0496110_0156693
402 Ga0496111_0025381
403 Ga0496111_0053816
404 Ga0496112_0001521
405 Ga0496112_0011435
406 Ga0496112_0040516
407 Ga0496112_0065731
408 Ga0496112_0128368
409 Ga0496113_0001279
410 Ga0496113_0007893
411 Ga0496115_0023615
412 Ga0496117_0000316
413 Ga0496118_0000003
414 Ga0496119_0000252
415 Ga0496119_0082362
416 Ga0496120_0152760
417 Ga0496121_0093241
418 Ga0496121_0129452
419 Ga0496122_0069214
420 Ga0496125_0088624
421 Ga0496126_0010603
422 Ga0496126_0175851
423 Ga0501083_0233951
424 nmdc:mga00v17_63877_c1
425 nmdc:mga0yw44_2802_c1
426 nmdc:mga06z11_439432_c1
427 nmdc:mga05p37_901_c1
428 nmdc:mga09592_3589_c1
429 nmdc:mga0qj67_168_c1
430 nmdc:mga0qj67_3835_c2
431 nmdc:mga06r32_4437_c1
432 nmdc:mga08y16_1083_c1
433 nmdc:mga08y16_315013_c1
434 nmdc:mga0n895_305040_c1
435 nmdc:mga0n895_69022_c1
436 nmdc:mga0sz30_12606_c1
437 nmdc:mga0sz30_22127_c1
438 Ga0500610_0000636
439 Ga0500568_0000219
440 Ga0501084_0037595
441 Ga0501082_0153677
442 3004340063
443 2588516079
444 2844012079
445 2874170722
446 2876368193
447 2882461092
448 2903452211
449 2903527189
450 2903530253
451 2917700889
452 2935923678
453 2963648766
454 2968083991
455 3004273308
456 8016631333

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

66

193

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8383 14 149
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8352 22 148
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.826 14 149
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8091 22 148
5umq-assembly1.cif.gz_A crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 0.7707 15 151
ID Description Score Start End Superfamily
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8366 22 148 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.81 22 148 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7737 19 152 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7665 19 148 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.751 19 152 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7W9KCM1-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9388 16 149 GO:0016829
GO:0051213
AF-A0A536NDQ0-F1-model_v4 VOC family protein 0.9366 16 149
AF-A0A853CNE6-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9321 16 151 GO:0016829
GO:0051213
AF-A0A853CNE6-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9254 16 151 GO:0016829
GO:0051213
AF-A0A2A7N6Q9-F1-model_v4 Glyoxalase 0.9245 16 152

Map