F341403

General Info

Members Datasets Scaffolds Average Seq Length
228 139 456 484

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0002394|Ga0501034_0002394_6235_7797
Length 520
Sequence VLSTLLAAADGFARPTIDYHALAPELVLTGVLMVILVADLLTPKGARGIVPQLAGIGVLAALVPVLTLAVDGADRSMFGGAYVVDNFSLVLKALFLVAGYIVILLSTNYVAEGDYAEGEYYFLLLASLLGMTVISSSRDLISIFVAFELLSIPSYLLAGWRKRDLHGNEAGAKYYLMGVFASSVLLYGMSLLYGLSGSTLLTDIGAHLASGDTRPLVTLAIVLVVAGFAFKVSAVPFHAWAPDTYEGAPTPITAFLAVASKTAGFVALIQVVLVAFAGRADVVGPLMWVLAALTMTVGNLIALRQTNIVRMLAYSGVAQAGYMLAPLAVVDTNPDGALKTIVTYLLIYAAMNLGAFAVVLAVARKTRSAEIDTWNGLFEYAPGLTVVMSAFLFSLAGIPIFGGWLAKLQVFGSLVQPDPTVAGVILAVVVGINSVFALYYYAGVAKAMWMNPAPDGDKTPIKVPVSLTAALALSLLATVAFGVSNLATRFGDLATVASHPIPVVCDDTPAATPTADITPC

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
3 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
58 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
64 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
65 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
66 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
67 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
72 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
73 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
74 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
75 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
76 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
81 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
84 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
95 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
108 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
115 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
116 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
135 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
136 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.82
Nodule 0
Rhizoplane 5.7
Rhizosphere 86.84
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0002394 3300049571 Bacteria 22727
2 Ga0070671_100034402 3300005355 Bacteria 4195
3 Ga0070673_100126147 3300005364 Bacteria 2142
4 Ga0070673_100128759 3300005364 Bacteria 2121
5 Ga0070667_100040518 3300005367 Bacteria 3906
6 Ga0070703_10000342 3300005406 Bacteria 20506
7 Ga0070705_100008768 3300005440 Bacteria 5007
8 Ga0070708_100000214 3300005445 Bacteria 43022
9 Ga0070706_100005392 3300005467 Bacteria 12187
10 Ga0070707_100003752 3300005468 Bacteria 14332
11 Ga0070698_100143418 3300005471 Bacteria 2339
12 Ga0070679_100048506 3300005530 Bacteria 4231
13 Ga0070696_100040610 3300005546 Bacteria 3212
14 Ga0070702_100075249 3300005615 Bacteria 2006
15 Ga0068866_10000781 3300005718 Bacteria 14252
16 Ga0068863_100059777 3300005841 Bacteria 3606
17 Ga0068860_100006205 3300005843 Bacteria 12016
18 Ga0081455_10008770 3300005937 Bacteria 10468
19 Ga0081455_10011783 3300005937 Bacteria 8757
20 Ga0081455_10016938 3300005937 Bacteria 7005
21 Ga0081538_10001704 3300005981 Bacteria 22405
22 Ga0081538_10008951 3300005981 Bacteria 8413
23 Ga0081538_10013165 3300005981 Bacteria 6567
24 Ga0075365_10003873 3300006038 Bacteria 7824
25 Ga0075365_10037489 3300006038 Bacteria 3148
26 Ga0075365_10086988 3300006038 Bacteria 2124
27 Ga0075364_10000713 3300006051 Bacteria 17373
28 Ga0075364_10029572 3300006051 Bacteria 3514
29 Ga0075367_10045092 3300006178 Bacteria 2587
30 Ga0075428_100003598 3300006844 Bacteria 16983
31 Ga0075428_100023150 3300006844 Bacteria 6871
32 Ga0075428_100032263 3300006844 Bacteria 5785
33 Ga0075430_100005264 3300006846 Bacteria 10907
34 Ga0075430_100022840 3300006846 Bacteria 5320
35 Ga0075431_100004724 3300006847 Bacteria 13384
36 Ga0075431_100016200 3300006847 Bacteria 7561
37 Ga0075431_100029943 3300006847 Bacteria 5605
38 Ga0075433_10003118 3300006852 Bacteria 12765
39 Ga0075434_100002715 3300006871 Bacteria 15637
40 Ga0075429_100003279 3300006880 Bacteria 13790
41 Ga0075429_100028947 3300006880 Bacteria 4811
42 Ga0075429_100063622 3300006880 Bacteria 3214
43 Ga0075429_100170383 3300006880 Bacteria 1907
44 Ga0075429_100203743 3300006880 Bacteria 1734
45 Ga0068865_100012471 3300006881 Bacteria 5350
46 Ga0075435_100010697 3300007076 Bacteria 6717
47 Ga0111539_10028367 3300009094 Bacteria 6830
48 Ga0111539_10151800 3300009094 Bacteria 2711
49 Ga0105245_10100286 3300009098 Bacteria 2678
50 Ga0114129_10007056 3300009147 Bacteria 15994
51 Ga0114129_10025573 3300009147 Bacteria 8363
52 Ga0114129_10083813 3300009147 Bacteria 4426
53 Ga0105243_10003414 3300009148 Bacteria 12877
54 Ga0105243_10075426 3300009148 Bacteria 2737
55 Ga0105242_10005500 3300009176 Bacteria 9781
56 Ga0105242_10006093 3300009176 Bacteria 9295
57 Ga0157378_10010309 3300013297 Bacteria 8159
58 Ga0157378_10143235 3300013297 Bacteria 2221
59 Ga0163163_10047266 3300014325 Bacteria 4230
60 Ga0157379_10064080 3300014968 Bacteria 3285
61 Ga0163161_10049858 3300017792 Bacteria 3027
62 Ga0207653_10000233 3300025885 Bacteria 36792
63 Ga0207642_10001215 3300025899 Bacteria 7973
64 Ga0207684_10000233 3300025910 Bacteria 84435
65 Ga0207707_10013831 3300025912 Bacteria 7037
66 Ga0207660_10038633 3300025917 Bacteria 3333
67 Ga0207662_10026678 3300025918 Bacteria 3333
68 Ga0207646_10024042 3300025922 Bacteria 5586
69 Ga0207687_10015264 3300025927 Bacteria 5033
70 Ga0207687_10071989 3300025927 Bacteria 2471
71 Ga0207644_10011158 3300025931 Bacteria 5937
72 Ga0207709_10058102 3300025935 Bacteria 2402
73 Ga0207670_10062582 3300025936 Bacteria 2543
74 Ga0207668_10031161 3300025972 Bacteria 3510
75 Ga0207703_10019828 3300026035 Bacteria 5256
76 Ga0207641_10024685 3300026088 Bacteria 4955
77 Ga0207648_10001279 3300026089 Bacteria 28106
78 Ga0207675_100031405 3300026118 Bacteria 4949
79 Ga0207428_10112541 3300027907 Bacteria 2093
80 Ga0268264_10031554 3300028381 Bacteria 4343
81 Ga0316576_10001293 3300031727 Bacteria 13302
82 Ga0316576_10039127 3300031727 Bacteria 3403
83 Ga0316576_10086546 3300031727 Bacteria 2331
84 Ga0316578_10005408 3300031728 Bacteria 6190
85 Ga0316578_10009520 3300031728 Bacteria 4999
86 Ga0316578_10012071 3300031728 Bacteria 4544
87 Ga0307413_10082239 3300031824 Bacteria 2068
88 Ga0307409_100006958 3300031995 Bacteria 6716
89 Ga0307409_100019580 3300031995 Bacteria 4587
90 Ga0307416_100050481 3300032002 Bacteria 3316
91 Ga0307416_100309904 3300032002 Bacteria 1574
92 Ga0307415_100162379 3300032126 Bacteria 1733
93 Ga0316585_10020818 3300032137 Unclassified 2011
94 Ga0373930_0001102 3300034816 Bacteria 3919
95 Ga0373948_0000718 3300034817 Bacteria 4308
96 Ga0373929_0001771 3300035085 Bacteria 4049
97 Ga0373932_0000085 3300035112 Bacteria 24383
98 Ga0316574_0002541 3300035398 Bacteria 9176
99 Ga0316574_0009158 3300035398 Bacteria 5533
100 Ga0316574_0012499 3300035398 Bacteria 4858
101 Ga0316574_0057939 3300035398 Bacteria 2426
102 Ga0373931_0000003 3300035691 Bacteria 560286
103 Ga0373931_0000313 3300035691 Bacteria 20504
104 Ga0373937_0258614 3300036401 Bacteria 1642
105 Ga0316582_0007076 3300036647 Bacteria 5956
106 Ga0316582_0008041 3300036647 Bacteria 5643
107 Ga0316584_0000507 3300036712 Bacteria 20573
108 Ga0316584_0000786 3300036712 Bacteria 17822
109 Ga0400483_040354 3300039062 Bacteria 5259
110 Ga0400483_158028 3300039062 Bacteria 3473
111 Ga0400483_166862 3300039062 Bacteria 8011
112 Ga0400483_181839 3300039062 Bacteria 4901
113 Ga0400483_252738 3300039062 Bacteria 6068
114 Ga0451837_1617338 3300041494 Bacteria 1743
115 Ga0439463_001179 3300042016 Bacteria 6986
116 Ga0439434_0004769 3300042435 Bacteria 3971
117 Ga0451577_0001387 3300042876 Bacteria 32416
118 Ga0439440_0000662 3300042993 Bacteria 5873
119 Ga0453684_0003331 3300044712 Bacteria 36455
120 Ga0495603_0010574 3300046455 Bacteria 5590
121 Ga0495603_0038237 3300046455 Bacteria 2879
122 Ga0495594_0025760 3300046499 Bacteria 3162
123 Ga0495630_0125412 3300046517 Bacteria 1949
124 Ga0495613_0000685 3300046689 Bacteria 26812
125 Ga0495672_0011816 3300047320 Bacteria 6133
126 Ga0496100_0212309 3300048903 Bacteria 1416
127 Ga0496101_0056040 3300048904 Bacteria 2849
128 Ga0496102_0089204 3300048905 Bacteria 2852
129 Ga0496104_0120045 3300048907 Bacteria 2524
130 Ga0496105_0025069 3300048908 Bacteria 4850
131 Ga0496108_0016211 3300048911 Bacteria 6077
132 Ga0496109_0003773 3300048912 Bacteria 12661
133 Ga0496109_0202236 3300048912 Bacteria 1868
134 Ga0496110_0000180 3300048913 Bacteria 39294
135 Ga0496110_0080809 3300048913 Bacteria 2897
136 Ga0496111_0008726 3300048914 Bacteria 6726
137 Ga0496111_0032693 3300048914 Bacteria 3709
138 Ga0496114_0020399 3300048917 Bacteria 5379
139 Ga0501031_0010340 3300049568 Bacteria 6080
140 Ga0501033_0000587 3300049570 Bacteria 33655
141 Ga0501033_0016160 3300049570 Bacteria 5652
142 Ga0501034_0002831 3300049571 Bacteria 20225
143 Ga0501034_0004928 3300049571 Bacteria 14703
144 Ga0501034_0015317 3300049571 Bacteria 7881
145 Ga0501036_0010658 3300049572 Bacteria 7596
146 Ga0501036_0012502 3300049572 Bacteria 7038
147 Ga0501036_0108096 3300049572 Bacteria 2352
148 Ga0501036_0167275 3300049572 Bacteria 1853
149 Ga0501037_0016756 3300049573 Bacteria 5391
150 Ga0501039_0008613 3300049575 Bacteria 7775
151 Ga0501039_0024808 3300049575 Bacteria 4606
152 Ga0501039_0109210 3300049575 Bacteria 2162
153 Ga0501040_0004082 3300049576 Bacteria 9489
154 Ga0501040_0006015 3300049576 Bacteria 7851
155 Ga0501040_0034909 3300049576 Bacteria 3408
156 Ga0501040_0060630 3300049576 Bacteria 2600
157 Ga0501041_0003807 3300049577 Bacteria 8688
158 Ga0501041_0005235 3300049577 Bacteria 7576
159 Ga0501042_0066217 3300049578 Bacteria 2582
160 Ga0501042_0105493 3300049578 Bacteria 2028
161 Ga0501043_0101112 3300049579 Bacteria 2266
162 Ga0501046_0006368 3300049580 Bacteria 10466
163 Ga0501046_0027591 3300049580 Bacteria 4631
164 Ga0501047_0053709 3300049581 Bacteria 3897
165 Ga0501048_0006210 3300049582 Bacteria 9090
166 Ga0501048_0012505 3300049582 Bacteria 6317
167 Ga0501048_0143203 3300049582 Bacteria 1690
168 Ga0501068_0006303 3300049584 Bacteria 6535
169 Ga0501068_0008871 3300049584 Bacteria 5611
170 Ga0501068_0012639 3300049584 Bacteria 4792
171 Ga0501069_0001587 3300049585 Bacteria 11239
172 Ga0501070_0002519 3300049586 Bacteria 16061
173 Ga0501070_0014853 3300049586 Bacteria 6551
174 Ga0501070_0045713 3300049586 Bacteria 3641
175 Ga0501071_0033963 3300049587 Bacteria 3627
176 Ga0501072_0003029 3300049588 Bacteria 12676
177 Ga0501072_0159642 3300049588 Bacteria 1798
178 Ga0501073_0006483 3300049589 Bacteria 8706
179 Ga0501073_0033337 3300049589 Bacteria 3668
180 Ga0501073_0122182 3300049589 Bacteria 1805
181 Ga0501074_0145706 3300049590 Bacteria 1694
182 Ga0501075_0016728 3300049591 Bacteria 5290
183 Ga0501075_0117497 3300049591 Bacteria 2022
184 Ga0501076_0006606 3300049592 Bacteria 8411
185 Ga0501076_0017094 3300049592 Bacteria 5508
186 Ga0501076_0068111 3300049592 Bacteria 2843
187 Ga0501076_0140227 3300049592 Bacteria 1964
188 Ga0501077_0026913 3300049593 Bacteria 3651
189 Ga0501077_0051156 3300049593 Bacteria 2625
190 Ga0501079_0015011 3300049741 Bacteria 5904
191 Ga0501079_0016033 3300049741 Bacteria 5725
192 Ga0501079_0147987 3300049741 Bacteria 1831
193 Ga0501080_0037500 3300049742 Bacteria 4528
194 Ga0501080_0058343 3300049742 Bacteria 3593
195 Ga0501081_0023558 3300049743 Bacteria 4127
196 Ga0501081_0128084 3300049743 Bacteria 1812
197 Ga0501083_0000439 3300049744 Bacteria 26708
198 Ga0501035_0198057 3300049822 Bacteria 1724
199 Ga0501044_0003952 3300049823 Bacteria 16601
200 Ga0501044_0007185 3300049823 Bacteria 12247
201 Ga0501045_0001595 3300049824 Bacteria 15145
202 Ga0501045_0029144 3300049824 Bacteria 3987
203 Ga0501045_0036659 3300049824 Bacteria 3562
204 Ga0501045_0038113 3300049824 Bacteria 3496
205 Ga0501045_0039941 3300049824 Bacteria 3414
206 nmdc:mga00v17_1356_c1 3300050491 Bacteria 12814
207 nmdc:mga0yw44_18041_c1 3300050492 Bacteria 3857
208 nmdc:mga0yw44_237_c1 3300050492 Bacteria 18844
209 nmdc:mga05p37_223444_c1 3300050507 Bacteria 2272
210 nmdc:mga09592_16115_c1 3300050508 Bacteria 6108
211 nmdc:mga09592_28216_c1 3300050508 Bacteria 4662
212 nmdc:mga09592_39126_c1 3300050508 Bacteria 3983
213 nmdc:mga0qj67_4926_c1 3300050509 Bacteria 9711
214 nmdc:mga0qj67_72766_c1 3300050509 Bacteria 2745
215 nmdc:mga06r32_9733_c1 3300050510 Bacteria 8682
216 nmdc:mga08y16_32906_c1 3300050511 Bacteria 5449
217 nmdc:mga08y16_3803_c1 3300050511 Bacteria 15705
218 nmdc:mga0n895_250396_c1 3300050512 Bacteria 1798
219 nmdc:mga0n895_7892_c1 3300050512 Bacteria 9177
220 nmdc:mga0rr50_9667_c1 3300050513 Bacteria 6079
221 nmdc:mga0a205_5121_c1 3300050515 Bacteria 11788
222 Ga0495595_0024501 3300053084 Bacteria 2666
223 Ga0500566_0000081 3300053094 Bacteria 47157
224 Ga0500568_0000029 3300053139 Bacteria 159927
225 Ga0501084_0001347 3300054114 Bacteria 19406
226 Ga0501084_0055939 3300054114 Bacteria 3301
227 Ga0501082_0016499 3300060353 Bacteria 6356
228 Ga0530510_0014325 3300061734 Bacteria 5590
229 Ga0501034_0002394
230 Ga0070671_100034402
231 Ga0070673_100126147
232 Ga0070673_100128759
233 Ga0070667_100040518
234 Ga0070703_10000342
235 Ga0070705_100008768
236 Ga0070708_100000214
237 Ga0070706_100005392
238 Ga0070707_100003752
239 Ga0070698_100143418
240 Ga0070679_100048506
241 Ga0070696_100040610
242 Ga0070702_100075249
243 Ga0068866_10000781
244 Ga0068863_100059777
245 Ga0068860_100006205
246 Ga0081455_10008770
247 Ga0081455_10011783
248 Ga0081455_10016938
249 Ga0081538_10001704
250 Ga0081538_10008951
251 Ga0081538_10013165
252 Ga0075365_10003873
253 Ga0075365_10037489
254 Ga0075365_10086988
255 Ga0075364_10000713
256 Ga0075364_10029572
257 Ga0075367_10045092
258 Ga0075428_100003598
259 Ga0075428_100023150
260 Ga0075428_100032263
261 Ga0075430_100005264
262 Ga0075430_100022840
263 Ga0075431_100004724
264 Ga0075431_100016200
265 Ga0075431_100029943
266 Ga0075433_10003118
267 Ga0075434_100002715
268 Ga0075429_100003279
269 Ga0075429_100028947
270 Ga0075429_100063622
271 Ga0075429_100170383
272 Ga0075429_100203743
273 Ga0068865_100012471
274 Ga0075435_100010697
275 Ga0111539_10028367
276 Ga0111539_10151800
277 Ga0105245_10100286
278 Ga0114129_10007056
279 Ga0114129_10025573
280 Ga0114129_10083813
281 Ga0105243_10003414
282 Ga0105243_10075426
283 Ga0105242_10005500
284 Ga0105242_10006093
285 Ga0157378_10010309
286 Ga0157378_10143235
287 Ga0163163_10047266
288 Ga0157379_10064080
289 Ga0163161_10049858
290 Ga0207653_10000233
291 Ga0207642_10001215
292 Ga0207684_10000233
293 Ga0207707_10013831
294 Ga0207660_10038633
295 Ga0207662_10026678
296 Ga0207646_10024042
297 Ga0207687_10015264
298 Ga0207687_10071989
299 Ga0207644_10011158
300 Ga0207709_10058102
301 Ga0207670_10062582
302 Ga0207668_10031161
303 Ga0207703_10019828
304 Ga0207641_10024685
305 Ga0207648_10001279
306 Ga0207675_100031405
307 Ga0207428_10112541
308 Ga0268264_10031554
309 Ga0316576_10001293
310 Ga0316576_10039127
311 Ga0316576_10086546
312 Ga0316578_10005408
313 Ga0316578_10009520
314 Ga0316578_10012071
315 Ga0307413_10082239
316 Ga0307409_100006958
317 Ga0307409_100019580
318 Ga0307416_100050481
319 Ga0307416_100309904
320 Ga0307415_100162379
321 Ga0316585_10020818
322 Ga0373930_0001102
323 Ga0373948_0000718
324 Ga0373929_0001771
325 Ga0373932_0000085
326 Ga0316574_0002541
327 Ga0316574_0009158
328 Ga0316574_0012499
329 Ga0316574_0057939
330 Ga0373931_0000003
331 Ga0373931_0000313
332 Ga0373937_0258614
333 Ga0316582_0007076
334 Ga0316582_0008041
335 Ga0316584_0000507
336 Ga0316584_0000786
337 Ga0400483_040354
338 Ga0400483_158028
339 Ga0400483_166862
340 Ga0400483_181839
341 Ga0400483_252738
342 Ga0451837_1617338
343 Ga0439463_001179
344 Ga0439434_0004769
345 Ga0451577_0001387
346 Ga0439440_0000662
347 Ga0453684_0003331
348 Ga0495603_0010574
349 Ga0495603_0038237
350 Ga0495594_0025760
351 Ga0495630_0125412
352 Ga0495613_0000685
353 Ga0495672_0011816
354 Ga0496100_0212309
355 Ga0496101_0056040
356 Ga0496102_0089204
357 Ga0496104_0120045
358 Ga0496105_0025069
359 Ga0496108_0016211
360 Ga0496109_0003773
361 Ga0496109_0202236
362 Ga0496110_0000180
363 Ga0496110_0080809
364 Ga0496111_0008726
365 Ga0496111_0032693
366 Ga0496114_0020399
367 Ga0501031_0010340
368 Ga0501033_0000587
369 Ga0501033_0016160
370 Ga0501034_0002831
371 Ga0501034_0004928
372 Ga0501034_0015317
373 Ga0501036_0010658
374 Ga0501036_0012502
375 Ga0501036_0108096
376 Ga0501036_0167275
377 Ga0501037_0016756
378 Ga0501039_0008613
379 Ga0501039_0024808
380 Ga0501039_0109210
381 Ga0501040_0004082
382 Ga0501040_0006015
383 Ga0501040_0034909
384 Ga0501040_0060630
385 Ga0501041_0003807
386 Ga0501041_0005235
387 Ga0501042_0066217
388 Ga0501042_0105493
389 Ga0501043_0101112
390 Ga0501046_0006368
391 Ga0501046_0027591
392 Ga0501047_0053709
393 Ga0501048_0006210
394 Ga0501048_0012505
395 Ga0501048_0143203
396 Ga0501068_0006303
397 Ga0501068_0008871
398 Ga0501068_0012639
399 Ga0501069_0001587
400 Ga0501070_0002519
401 Ga0501070_0014853
402 Ga0501070_0045713
403 Ga0501071_0033963
404 Ga0501072_0003029
405 Ga0501072_0159642
406 Ga0501073_0006483
407 Ga0501073_0033337
408 Ga0501073_0122182
409 Ga0501074_0145706
410 Ga0501075_0016728
411 Ga0501075_0117497
412 Ga0501076_0006606
413 Ga0501076_0017094
414 Ga0501076_0068111
415 Ga0501076_0140227
416 Ga0501077_0026913
417 Ga0501077_0051156
418 Ga0501079_0015011
419 Ga0501079_0016033
420 Ga0501079_0147987
421 Ga0501080_0037500
422 Ga0501080_0058343
423 Ga0501081_0023558
424 Ga0501081_0128084
425 Ga0501083_0000439
426 Ga0501035_0198057
427 Ga0501044_0003952
428 Ga0501044_0007185
429 Ga0501045_0001595
430 Ga0501045_0029144
431 Ga0501045_0036659
432 Ga0501045_0038113
433 Ga0501045_0039941
434 nmdc:mga00v17_1356_c1
435 nmdc:mga0yw44_18041_c1
436 nmdc:mga0yw44_237_c1
437 nmdc:mga05p37_223444_c1
438 nmdc:mga09592_16115_c1
439 nmdc:mga09592_28216_c1
440 nmdc:mga09592_39126_c1
441 nmdc:mga0qj67_4926_c1
442 nmdc:mga0qj67_72766_c1
443 nmdc:mga06r32_9733_c1
444 nmdc:mga08y16_32906_c1
445 nmdc:mga08y16_3803_c1
446 nmdc:mga0n895_250396_c1
447 nmdc:mga0n895_7892_c1
448 nmdc:mga0rr50_9667_c1
449 nmdc:mga0a205_5121_c1
450 Ga0495595_0024501
451 Ga0500566_0000081
452 Ga0500568_0000029
453 Ga0501084_0001347
454 Ga0501084_0055939
455 Ga0501082_0016499
456 Ga0530510_0014325

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00361

Proton_antipo_M

Proton-conducting membrane transporter

137

435

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tjv-assembly1.cif.gz_B structure of the ndh-1ms complex from thermosynechococcus elongatus 0.9335 7 486
7z80-assembly1.cif.gz_N complex i from e. coli, ddm/lmng-purified, under turnover at ph 8, closed state 0.9242 10 486
6khj-assembly1.cif.gz_B supercomplex for electron transfer 0.9226 7 490
6tjv-assembly1.cif.gz_B structure of the ndh-1ms complex from thermosynechococcus elongatus 0.9202 7 486
7z7s-assembly1.cif.gz_N complex i from e. coli, lmng-purified, under turnover at ph 6, closed state 0.9177 10 486
ID Description Score Start End Superfamily
af_P0CC63_1_145_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9481 10 126 1.10.287.3510
af_P0AFF0_1_121_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9221 9 126 1.10.287.3510
af_A0A0P0WBC4_3_95_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8851 34 126 1.10.287.3510
af_A0A0P0WBC4_3_95_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8675 34 126 1.10.287.3510
af_P0AFF0_1_121_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8643 9 126 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A7Z9G531-F1-model_v4 NADH:quinone oxidoreductase/Mrp antiporter membrane subunit domain-containing protein 0.9663 71 200 GO:0003677
GO:0003918
GO:0005524
GO:0006265
GO:0012505
GO:0016020
AF-A0A3N5QKU7-F1-model_v4 NADH-quinone oxidoreductase subunit N 0.964 327 484 GO:0012505
GO:0016020
AF-A0A7W1IT04-F1-model_v4 NADH-quinone oxidoreductase subunit N 0.9612 3 179 GO:0012505
GO:0016020
AF-A0A7W1IT04-F1-model_v4 NADH-quinone oxidoreductase subunit N 0.9559 3 179 GO:0012505
GO:0016020
AF-A0A7C7W915-F1-model_v4 deleted 0.9555 4 486

Map