F341191

General Info

Members Datasets Scaffolds Average Seq Length
228 81 456 286

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0146766|Ga0395901_0146766_105_962
Length 273
Sequence MVWTAEPTYEKPDISVRATTLYYQIVAPIALPFLSGRLLNLFRCREGKCFFQRSREHPPTGKEFDDKVRFEPVVQKNGRTEKYLYIETAEEIVACAKVQTVEFHGWGSRAGAVETPDRLVIDLDPDPNLSFEAVKAAAFQLRRLSGGKGIHIVVPLEPAAEWPAVREFAKSFCTALAEAAPERFTVALPKWQRRGRIFLDFLRNQRTASAIQPYSVRARAGMPVATPVDWKELRDIDRSDFFSIADAEELLRRARSRPLKFWGAIAQSLPRLQ

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
68 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 13.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0146766 3300038443 Bacteria 2479
2 JGI24740J21852_10039553 3300001979 Bacteria 1437
3 Ga0070658_10010551 3300005327 Bacteria 7404
4 Ga0070658_10056930 3300005327 Bacteria 3179
5 Ga0070658_10123958 3300005327 Bacteria 2149
6 Ga0070658_10426138 3300005327 Unclassified 1141
7 Ga0070683_100006843 3300005329 Bacteria 9580
8 Ga0070683_100117480 3300005329 Plasmid 2511
9 Ga0070683_100228869 3300005329 Unclassified 1767
10 Ga0070666_10030676 3300005335 Bacteria 3543
11 Ga0070680_100034441 3300005336 Bacteria 4082
12 Ga0070680_100072877 3300005336 Bacteria 2823
13 Ga0070680_100302419 3300005336 Bacteria 1357
14 Ga0070682_100052442 3300005337 Bacteria 2552
15 Ga0070660_100039514 3300005339 Bacteria 3587
16 Ga0070660_100071147 3300005339 Bacteria 2715
17 Ga0070661_100102920 3300005344 Bacteria 2126
18 Ga0070661_100280353 3300005344 Bacteria 1293
19 Ga0070692_10017123 3300005345 Bacteria 3460
20 Ga0070692_10091714 3300005345 Bacteria 1653
21 Ga0070671_100276812 3300005355 Bacteria 1427
22 Ga0070659_100030564 3300005366 Bacteria 4168
23 Ga0070659_100304137 3300005366 Bacteria 1330
24 Ga0070667_100331676 3300005367 Unclassified 1374
25 Ga0070714_100050685 3300005435 Bacteria 3537
26 Ga0070714_100182370 3300005435 Bacteria 1911
27 Ga0070663_100091720 3300005455 Unclassified 2252
28 Ga0070662_100100544 3300005457 Bacteria 2188
29 Ga0070662_100295830 3300005457 Bacteria 1314
30 Ga0070679_100216684 3300005530 Unclassified 1877
31 Ga0070684_100007065 3300005535 Bacteria 8728
32 Ga0070684_100157896 3300005535 Bacteria 2057
33 Ga0068853_100153655 3300005539 Bacteria 2073
34 Ga0068855_100094992 3300005563 Bacteria 3437
35 Ga0068855_100436979 3300005563 Bacteria 1430
36 Ga0070664_100102027 3300005564 Bacteria 2496
37 Ga0068857_100076888 3300005577 Bacteria 2977
38 Ga0068857_100385876 3300005577 Bacteria 1301
39 Ga0068854_100017688 3300005578 Bacteria 4774
40 Ga0068856_100062207 3300005614 Bacteria 3687
41 Ga0068856_100126845 3300005614 Unclassified 2555
42 Ga0068856_100162095 3300005614 Bacteria 2247
43 Ga0068852_100000403 3300005616 Bacteria 28998
44 Ga0068852_100090029 3300005616 Bacteria 2743
45 Ga0068852_100151098 3300005616 Bacteria 2159
46 Ga0068852_100230144 3300005616 Bacteria 1766
47 Ga0081539_10009289 3300005985 Bacteria 8261
48 Ga0105240_10338808 3300009093 Unclassified 1709
49 Ga0105245_10052783 3300009098 Bacteria 3647
50 Ga0105241_10257291 3300009174 Bacteria 1482
51 Ga0157371_10043272 3300013102 Bacteria 3208
52 Ga0157371_10152958 3300013102 Bacteria 1646
53 Ga0157370_10076965 3300013104 Bacteria 3143
54 Ga0157370_10101383 3300013104 Bacteria 2696
55 Ga0157370_10217771 3300013104 Bacteria 1769
56 Ga0157369_10029243 3300013105 Bacteria 6091
57 Ga0157369_10055247 3300013105 Bacteria 4286
58 Ga0157369_10231747 3300013105 Bacteria 1931
59 Ga0157369_10365985 3300013105 Bacteria 1497
60 Ga0157372_10190026 3300013307 Bacteria 2378
61 Ga0157372_10758201 3300013307 Bacteria 1128
62 Ga0207647_10047805 3300025904 Bacteria 2659
63 Ga0207647_10063275 3300025904 Bacteria 2250
64 Ga0207647_10072928 3300025904 Bacteria 2070
65 Ga0207647_10194735 3300025904 Bacteria 1174
66 Ga0207645_10025363 3300025907 Bacteria 3836
67 Ga0207705_10004205 3300025909 Bacteria 10921
68 Ga0207705_10009184 3300025909 Bacteria 7201
69 Ga0207660_10000052 3300025917 Bacteria 59348
70 Ga0207660_10245405 3300025917 Bacteria 1412
71 Ga0207657_10093395 3300025919 Bacteria 2506
72 Ga0207657_10140690 3300025919 Bacteria 1972
73 Ga0207657_10325378 3300025919 Bacteria 1215
74 Ga0207649_10142050 3300025920 Bacteria 1644
75 Ga0207649_10158980 3300025920 Bacteria 1564
76 Ga0207652_10004096 3300025921 Bacteria 11893
77 Ga0207652_10535567 3300025921 Bacteria 1053
78 Ga0207664_10243141 3300025929 Unclassified 1568
79 Ga0207690_10179170 3300025932 Bacteria 1594
80 Ga0207706_10095399 3300025933 Bacteria 2616
81 Ga0207661_10014290 3300025944 Bacteria 5814
82 Ga0207661_10106673 3300025944 Bacteria 2361
83 Ga0207661_10214772 3300025944 Viruses 1697
84 Ga0207667_10093093 3300025949 Bacteria 3112
85 Ga0207667_10190187 3300025949 Bacteria 2106
86 Ga0207667_10224945 3300025949 Unclassified 1922
87 Ga0207640_10098069 3300025981 Bacteria 2048
88 Ga0207677_10008883 3300026023 Bacteria 5634
89 Ga0207639_10077300 3300026041 Bacteria 2623
90 Ga0207678_10028791 3300026067 Bacteria 4850
91 Ga0207678_10036327 3300026067 Bacteria 4289
92 Ga0207678_10079479 3300026067 Unclassified 2808
93 Ga0207678_10179927 3300026067 Bacteria 1806
94 Ga0207702_10070734 3300026078 Bacteria 3002
95 Ga0207702_10273821 3300026078 Bacteria 1593
96 Ga0207702_10429073 3300026078 Bacteria 1279
97 Ga0207674_10015463 3300026116 Bacteria 8383
98 Ga0207674_10082011 3300026116 Bacteria 3227
99 Ga0207698_10000687 3300026142 Bacteria 19669
100 Ga0207698_10019718 3300026142 Bacteria 4623
101 Ga0207698_10326669 3300026142 Bacteria 1439
102 Ga0207698_10371342 3300026142 Bacteria 1358
103 Ga0207698_10505923 3300026142 Bacteria 1176
104 Ga0307408_100146257 3300031548 Bacteria 1860
105 Ga0307413_10128085 3300031824 Bacteria 1732
106 Ga0307410_10002069 3300031852 Bacteria 9495
107 Ga0307410_10074677 3300031852 Bacteria 2362
108 Ga0307410_10093335 3300031852 Bacteria 2141
109 Ga0307410_10292495 3300031852 Bacteria 1282
110 Ga0307406_10099801 3300031901 Bacteria 1974
111 Ga0307407_10016116 3300031903 Unclassified 3712
112 Ga0307412_10222580 3300031911 Bacteria 1447
113 Ga0307409_100005908 3300031995 Bacteria 7114
114 Ga0307409_100015826 3300031995 Bacteria 4967
115 Ga0307409_100027290 3300031995 Bacteria 4044
116 Ga0307409_100228538 3300031995 Bacteria 1685
117 Ga0307409_100520699 3300031995 Bacteria 1162
118 Ga0307409_100586799 3300031995 Bacteria 1099
119 Ga0307416_100177256 3300032002 Bacteria 1993
120 Ga0307414_10120367 3300032004 Bacteria 2017
121 Ga0307411_10069011 3300032005 Bacteria 2385
122 Ga0307411_10225312 3300032005 Bacteria 1457
123 Ga0395899_0001220 3300037312 Bacteria 22496
124 Ga0395899_0005539 3300037312 Bacteria 9779
125 Ga0395899_0061639 3300037312 Bacteria 2762
126 Ga0395899_0092318 3300037312 Bacteria 2192
127 Ga0395899_0107513 3300037312 Unclassified 2008
128 Ga0395899_0180344 3300037312 Unclassified 1483
129 Ga0395900_0000605 3300037418 Bacteria 49062
130 Ga0395900_0001734 3300037418 Bacteria 25160
131 Ga0395900_0004693 3300037418 Bacteria 14408
132 Ga0395900_0009436 3300037418 Bacteria 10002
133 Ga0395900_0022008 3300037418 Bacteria 6519
134 Ga0395900_0029387 3300037418 Bacteria 5638
135 Ga0395900_0072336 3300037418 Bacteria 3545
136 Ga0395900_0115926 3300037418 Bacteria 2749
137 Ga0395900_0166155 3300037418 Bacteria 2249
138 Ga0395900_0171149 3300037418 Bacteria 2211
139 Ga0395900_0430417 3300037418 Bacteria 1279
140 Ga0395900_0495565 3300037418 Bacteria 1172
141 Ga0395900_0506747 3300037418 Bacteria 1156
142 Ga0395900_0546397 3300037418 Unclassified 1103
143 Ga0395900_0573099 3300037418 Unclassified 1071
144 Ga0395898_0001129 3300037466 Bacteria 40961
145 Ga0395898_0062486 3300037466 Bacteria 3616
146 Ga0395898_0147162 3300037466 Bacteria 2254
147 Ga0395898_0235063 3300037466 Bacteria 1748
148 Ga0395898_0271247 3300037466 Bacteria 1618
149 Ga0395898_0282107 3300037466 Bacteria 1584
150 Ga0395898_0319360 3300037466 Bacteria 1481
151 Ga0395898_0502807 3300037466 Unclassified 1153
152 Ga0395905_0000109 3300037471 Bacteria 137754
153 Ga0395905_0002257 3300037471 Bacteria 21639
154 Ga0395905_0003610 3300037471 Bacteria 16445
155 Ga0395905_0008505 3300037471 Bacteria 10121
156 Ga0395905_0023292 3300037471 Bacteria 5854
157 Ga0395905_0024420 3300037471 Bacteria 5705
158 Ga0395905_0057011 3300037471 Bacteria 3653
159 Ga0395905_0062852 3300037471 Bacteria 3473
160 Ga0395905_0087064 3300037471 Bacteria 2928
161 Ga0395905_0119708 3300037471 Bacteria 2474
162 Ga0395905_0129906 3300037471 Bacteria 2369
163 Ga0395905_0148754 3300037471 Bacteria 2203
164 Ga0395905_0190399 3300037471 Bacteria 1924
165 Ga0395905_0222125 3300037471 Bacteria 1768
166 Ga0395905_0239205 3300037471 Bacteria 1697
167 Ga0395905_0386085 3300037471 Bacteria 1294
168 Ga0395905_0468424 3300037471 Bacteria 1158
169 Ga0395901_0000041 3300038443 Bacteria 202314
170 Ga0395901_0015663 3300038443 Bacteria 7723
171 Ga0395901_0016525 3300038443 Bacteria 7520
172 Ga0395901_0020894 3300038443 Bacteria 6705
173 Ga0395901_0031137 3300038443 Bacteria 5500
174 Ga0395901_0044535 3300038443 Bacteria 4602
175 Ga0395901_0070496 3300038443 Bacteria 3641
176 Ga0395901_0078125 3300038443 Bacteria 3455
177 Ga0395901_0081947 3300038443 Bacteria 3370
178 Ga0395901_0107799 3300038443 Bacteria 2924
179 Ga0395901_0121629 3300038443 Bacteria 2743
180 Ga0395901_0230443 3300038443 Bacteria 1934
181 Ga0395901_0433539 3300038443 Bacteria 1346
182 Ga0395901_0461113 3300038443 Bacteria 1298
183 Ga0395901_0563981 3300038443 Bacteria 1152
184 Ga0395901_0594491 3300038443 Bacteria 1116
185 Ga0395901_0609309 3300038443 Bacteria 1100
186 Ga0439455_0002962 3300042012 Bacteria 3180
187 Ga0439458_0000563 3300042157 Bacteria 9535
188 Ga0466969_0071794 3300044656 Unclassified 1664
189 Ga0466972_0096911 3300044658 Bacteria 1397
190 Ga0466972_0139332 3300044658 Bacteria 1142
191 Ga0466966_0052443 3300044684 Plasmid 2591
192 Ga0466966_0065447 3300044684 Bacteria 2286
193 Ga0466966_0220371 3300044684 Unclassified 1145
194 Ga0466966_0245598 3300044684 Bacteria 1079
195 Ga0466961_0041190 3300044693 Bacteria 2961
196 Ga0466961_0097955 3300044693 Unclassified 1849
197 Ga0466961_0136170 3300044693 Bacteria 1539
198 Ga0466963_0001644 3300044694 Bacteria 12176
199 Ga0466963_0015668 3300044694 Unclassified 4702
200 Ga0466963_0084263 3300044694 Bacteria 2156
201 Ga0466963_0087580 3300044694 Bacteria 2117
202 Ga0466963_0374390 3300044694 Unclassified 1003
203 Ga0466971_0009314 3300044719 Bacteria 4291
204 Ga0466968_0062820 3300044735 Unclassified 1604
205 Ga0466970_0084204 3300044765 Unclassified 1721
206 Ga0466970_0148711 3300044765 Unclassified 1293
207 Ga0466957_0000731 3300044842 Bacteria 16854
208 Ga0466957_0060836 3300044842 Bacteria 2316
209 Ga0466957_0084486 3300044842 Unclassified 1981
210 Ga0466957_0143523 3300044842 Bacteria 1540
211 Ga0466959_0117991 3300045049 Unclassified 1889
212 Ga0466959_0193996 3300045049 Bacteria 1416
213 Ga0466959_0332377 3300045049 Bacteria 1037
214 Ga0466958_0040368 3300045836 Bacteria 2805
215 Ga0466958_0182853 3300045836 Bacteria 1330
216 Ga0466958_0230442 3300045836 Unclassified 1183
217 Ga0466967_0001738 3300045976 Bacteria 12993
218 Ga0466967_0005623 3300045976 Bacteria 8720
219 Ga0466967_0007399 3300045976 Bacteria 7916
220 Ga0466967_0032771 3300045976 Bacteria 4391
221 Ga0466967_0065634 3300045976 Bacteria 3231
222 Ga0466967_0093389 3300045976 Unclassified 2738
223 Ga0466967_0107989 3300045976 Bacteria 2553
224 Ga0466967_0580021 3300045976 Bacteria 1105
225 Ga0466967_0635943 3300045976 Bacteria 1054
226 Ga0466962_0021921 3300061719 Bacteria 3067
227 Ga0466962_0095558 3300061719 Unclassified 1425
228 Ga0466962_0162394 3300061719 Unclassified 1086
229 Ga0395901_0146766
230 JGI24740J21852_10039553
231 Ga0070658_10010551
232 Ga0070658_10056930
233 Ga0070658_10123958
234 Ga0070658_10426138
235 Ga0070683_100006843
236 Ga0070683_100117480
237 Ga0070683_100228869
238 Ga0070666_10030676
239 Ga0070680_100034441
240 Ga0070680_100072877
241 Ga0070680_100302419
242 Ga0070682_100052442
243 Ga0070660_100039514
244 Ga0070660_100071147
245 Ga0070661_100102920
246 Ga0070661_100280353
247 Ga0070692_10017123
248 Ga0070692_10091714
249 Ga0070671_100276812
250 Ga0070659_100030564
251 Ga0070659_100304137
252 Ga0070667_100331676
253 Ga0070714_100050685
254 Ga0070714_100182370
255 Ga0070663_100091720
256 Ga0070662_100100544
257 Ga0070662_100295830
258 Ga0070679_100216684
259 Ga0070684_100007065
260 Ga0070684_100157896
261 Ga0068853_100153655
262 Ga0068855_100094992
263 Ga0068855_100436979
264 Ga0070664_100102027
265 Ga0068857_100076888
266 Ga0068857_100385876
267 Ga0068854_100017688
268 Ga0068856_100062207
269 Ga0068856_100126845
270 Ga0068856_100162095
271 Ga0068852_100000403
272 Ga0068852_100090029
273 Ga0068852_100151098
274 Ga0068852_100230144
275 Ga0081539_10009289
276 Ga0105240_10338808
277 Ga0105245_10052783
278 Ga0105241_10257291
279 Ga0157371_10043272
280 Ga0157371_10152958
281 Ga0157370_10076965
282 Ga0157370_10101383
283 Ga0157370_10217771
284 Ga0157369_10029243
285 Ga0157369_10055247
286 Ga0157369_10231747
287 Ga0157369_10365985
288 Ga0157372_10190026
289 Ga0157372_10758201
290 Ga0207647_10047805
291 Ga0207647_10063275
292 Ga0207647_10072928
293 Ga0207647_10194735
294 Ga0207645_10025363
295 Ga0207705_10004205
296 Ga0207705_10009184
297 Ga0207660_10000052
298 Ga0207660_10245405
299 Ga0207657_10093395
300 Ga0207657_10140690
301 Ga0207657_10325378
302 Ga0207649_10142050
303 Ga0207649_10158980
304 Ga0207652_10004096
305 Ga0207652_10535567
306 Ga0207664_10243141
307 Ga0207690_10179170
308 Ga0207706_10095399
309 Ga0207661_10014290
310 Ga0207661_10106673
311 Ga0207661_10214772
312 Ga0207667_10093093
313 Ga0207667_10190187
314 Ga0207667_10224945
315 Ga0207640_10098069
316 Ga0207677_10008883
317 Ga0207639_10077300
318 Ga0207678_10028791
319 Ga0207678_10036327
320 Ga0207678_10079479
321 Ga0207678_10179927
322 Ga0207702_10070734
323 Ga0207702_10273821
324 Ga0207702_10429073
325 Ga0207674_10015463
326 Ga0207674_10082011
327 Ga0207698_10000687
328 Ga0207698_10019718
329 Ga0207698_10326669
330 Ga0207698_10371342
331 Ga0207698_10505923
332 Ga0307408_100146257
333 Ga0307413_10128085
334 Ga0307410_10002069
335 Ga0307410_10074677
336 Ga0307410_10093335
337 Ga0307410_10292495
338 Ga0307406_10099801
339 Ga0307407_10016116
340 Ga0307412_10222580
341 Ga0307409_100005908
342 Ga0307409_100015826
343 Ga0307409_100027290
344 Ga0307409_100228538
345 Ga0307409_100520699
346 Ga0307409_100586799
347 Ga0307416_100177256
348 Ga0307414_10120367
349 Ga0307411_10069011
350 Ga0307411_10225312
351 Ga0395899_0001220
352 Ga0395899_0005539
353 Ga0395899_0061639
354 Ga0395899_0092318
355 Ga0395899_0107513
356 Ga0395899_0180344
357 Ga0395900_0000605
358 Ga0395900_0001734
359 Ga0395900_0004693
360 Ga0395900_0009436
361 Ga0395900_0022008
362 Ga0395900_0029387
363 Ga0395900_0072336
364 Ga0395900_0115926
365 Ga0395900_0166155
366 Ga0395900_0171149
367 Ga0395900_0430417
368 Ga0395900_0495565
369 Ga0395900_0506747
370 Ga0395900_0546397
371 Ga0395900_0573099
372 Ga0395898_0001129
373 Ga0395898_0062486
374 Ga0395898_0147162
375 Ga0395898_0235063
376 Ga0395898_0271247
377 Ga0395898_0282107
378 Ga0395898_0319360
379 Ga0395898_0502807
380 Ga0395905_0000109
381 Ga0395905_0002257
382 Ga0395905_0003610
383 Ga0395905_0008505
384 Ga0395905_0023292
385 Ga0395905_0024420
386 Ga0395905_0057011
387 Ga0395905_0062852
388 Ga0395905_0087064
389 Ga0395905_0119708
390 Ga0395905_0129906
391 Ga0395905_0148754
392 Ga0395905_0190399
393 Ga0395905_0222125
394 Ga0395905_0239205
395 Ga0395905_0386085
396 Ga0395905_0468424
397 Ga0395901_0000041
398 Ga0395901_0015663
399 Ga0395901_0016525
400 Ga0395901_0020894
401 Ga0395901_0031137
402 Ga0395901_0044535
403 Ga0395901_0070496
404 Ga0395901_0078125
405 Ga0395901_0081947
406 Ga0395901_0107799
407 Ga0395901_0121629
408 Ga0395901_0230443
409 Ga0395901_0433539
410 Ga0395901_0461113
411 Ga0395901_0563981
412 Ga0395901_0594491
413 Ga0395901_0609309
414 Ga0439455_0002962
415 Ga0439458_0000563
416 Ga0466969_0071794
417 Ga0466972_0096911
418 Ga0466972_0139332
419 Ga0466966_0052443
420 Ga0466966_0065447
421 Ga0466966_0220371
422 Ga0466966_0245598
423 Ga0466961_0041190
424 Ga0466961_0097955
425 Ga0466961_0136170
426 Ga0466963_0001644
427 Ga0466963_0015668
428 Ga0466963_0084263
429 Ga0466963_0087580
430 Ga0466963_0374390
431 Ga0466971_0009314
432 Ga0466968_0062820
433 Ga0466970_0084204
434 Ga0466970_0148711
435 Ga0466957_0000731
436 Ga0466957_0060836
437 Ga0466957_0084486
438 Ga0466957_0143523
439 Ga0466959_0117991
440 Ga0466959_0193996
441 Ga0466959_0332377
442 Ga0466958_0040368
443 Ga0466958_0182853
444 Ga0466958_0230442
445 Ga0466967_0001738
446 Ga0466967_0005623
447 Ga0466967_0007399
448 Ga0466967_0032771
449 Ga0466967_0065634
450 Ga0466967_0093389
451 Ga0466967_0107989
452 Ga0466967_0580021
453 Ga0466967_0635943
454 Ga0466962_0021921
455 Ga0466962_0095558
456 Ga0466962_0162394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21686

LigD_Prim-Pol

LigD, primase-polymerase domain

17

258

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.8861 14 284
6sa1-assembly1.cif.gz_A post catalytic complex of prim-polc from mycobacterium smegmatis with gapped dna and 3'-dutp 0.8453 15 280
2far-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa ligd polymerase domain with datp and manganese 0.8424 1 280
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.8305 14 284
2far-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa ligd polymerase domain with datp and manganese 0.8234 1 280
ID Description Score Start End Superfamily
2iruB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9086 117 247 3.30.70.3300
af_P95226_24_305_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.8905 15 265 3.90.920.10
2faqB01 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.8798 15 280 3.90.920.10
af_O69697_22_304_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.8614 15 280 3.90.920.10
2iruB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8595 117 247 3.30.70.3300
ID Description Score Start End GO Terms
AF-A0A2W6S6H7-F1-model_v4 ATP-dependent DNA ligase 0.958 74 284 GO:0005524
GO:0016874
GO:0046872
AF-A0A530K5K0-F1-model_v4 DNA ligase D 0.9553 90 284 GO:0005524
GO:0016874
GO:0046872
AF-A0A3S1MCP3-F1-model_v4 DNA ligase D 0.952 100 284 GO:0005524
GO:0016874
GO:0046872
AF-A0A2W6S6H7-F1-model_v4 ATP-dependent DNA ligase 0.9492 74 284 GO:0005524
GO:0016874
GO:0046872
AF-A0A530K5K0-F1-model_v4 DNA ligase D 0.9458 90 284 GO:0005524
GO:0016874
GO:0046872

Map