F341069

General Info

Members Datasets Scaffolds Average Seq Length
228 186 141 191

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10000065|Ga0207678_1000006528
Length 213
Sequence VEWLEPQYYVWSGVNVMVRRNPERRAALLDAAIEVLANEGARGLTFRAVDQQAGVPVGTASNYFSSRDEILKHAGERVYERLVDEGVIADGLEGPRDRARVTELMHALVDRVAAFPTGFLALLELRLEATRRPELQDVLTRRIRADVDFNVSYHEKSGLPGDGTMVVLLWLGLNWLIMERLTLPDLFTDEQRHDLVTALVERLLAGQPALPPA

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
3 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
4 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
5 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
6 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221578 Streptomyces sp. Root63 Isolate Unclassified
9 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
10 2643221647 Streptomyces sp. Root369 Isolate Unclassified
11 2643221670 Streptomyces sp. Root431 Isolate Unclassified
12 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
13 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
14 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
15 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
16 2643221692 Nocardia sp. Root136 Isolate Unclassified
17 2643221714 Streptomyces sp. Root264 Isolate Unclassified
18 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
19 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
20 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
21 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
22 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
23 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
24 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
25 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
26 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
27 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
28 2808606448 Streptomyces sp. 193411 Isolate Unclassified
29 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
30 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
31 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
32 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
33 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
34 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
35 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
36 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
37 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
38 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
39 2867369537 Streptomyces sp. Z26 Isolate Unclassified
40 2867428634 Streptomyces sp. RP5T Isolate Unclassified
41 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
42 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
43 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
44 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
45 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
46 2891562705 Microbispora tritici MT50 Isolate Unclassified
47 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
48 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
49 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
50 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
51 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
52 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
53 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
54 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
55 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
56 2922554459 Rhodococcus sp. 66b Isolate Unclassified
57 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
58 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
59 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
60 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
61 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
62 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
63 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
64 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
65 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
66 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
67 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
68 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
69 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
70 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
71 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
72 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
73 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
74 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
75 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
76 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
77 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
78 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
103 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
104 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
105 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
106 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
107 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
121 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
122 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
123 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
126 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
127 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
128 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
129 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
130 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
131 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
132 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
133 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
134 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
135 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
136 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
159 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
175 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
176 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
177 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
178 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
179 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
180 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
181 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
182 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
183 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
184 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
185 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
186 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 60.96
Metatranscriptomes 0.88
Isolates 38.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0.88
Rhizoplane 1.32
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 29.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10003189 3300003316 Bacteria 7602
2 rootH2_10004696 3300003320 Bacteria 7475
3 rootH2_10080325 3300003320 Bacteria 1013
4 rootH1_10019242 3300003323 Bacteria 3328
5 rootH1_10019252 3300003323 Bacteria 4046
6 rootH1_10074544 3300003323 Bacteria 2483
7 Ga0006562J51391_1182584 3300003578 Bacteria 2855
8 Ga0006562J51391_1182585 3300003578 Bacteria 1580
9 Ga0070710_10000775 3300005437 Bacteria 15263
10 Ga0070711_100458854 3300005439 Bacteria 1044
11 Ga0070663_100000249 3300005455 Bacteria 27248
12 Ga0070681_11018218 3300005458 Bacteria 748
13 Ga0068853_100112949 3300005539 Bacteria 2415
14 Ga0068856_100439439 3300005614 Bacteria 1325
15 Ga0081538_10236003 3300005981 Bacteria 710
16 Ga0075363_100003786 3300006048 Bacteria 6520
17 Ga0075363_100106672 3300006048 Bacteria 1554
18 Ga0075428_100005123 3300006844 Bacteria 14564
19 Ga0075430_100001516 3300006846 Bacteria 18950
20 Ga0075431_100002814 3300006847 Bacteria 16835
21 Ga0075429_100003015 3300006880 Bacteria 14277
22 Ga0114129_10005409 3300009147 Bacteria 18033
23 Ga0105243_10000571 3300009148 Bacteria 37133
24 Ga0157378_10770920 3300013297 Bacteria 986
25 Ga0183367_1002 3300015688 Bacteria 1101531
26 Ga0163161_10348460 3300017792 Bacteria 1177
27 Ga0207426_1035577 3300025302 Bacteria 1588
28 Ga0207692_10008431 3300025898 Bacteria 4262
29 Ga0207687_10456492 3300025927 Bacteria 1060
30 Ga0207668_10050764 3300025972 Bacteria 2860
31 Ga0207678_10000065 3300026067 Bacteria 83028
32 Ga0207675_100893364 3300026118 Bacteria 904
33 Ga0209371_1040525 3300027312 Bacteria 947
34 Ga0307515_10404061 3300028794 Bacteria 990
35 Ga0268256_1046014 3300030500 Bacteria 947
36 Ga0307512_10070429 3300030522 Bacteria 2604
37 Ga0316177_1033049 3300030731 Bacteria 898
38 Ga0316177_1077249 3300030731 Bacteria 2003
39 Ga0316176_1067418 3300030732 Bacteria 3530
40 Ga0314311_1174787 3300030733 Bacteria 3637
41 Ga0316180_1045854 3300030736 Bacteria 2005
42 Ga0316180_1182629 3300030736 Bacteria 1484
43 Ga0307513_10000005 3300031456 Bacteria 553227
44 Ga0307513_10031524 3300031456 Bacteria 6001
45 Ga0307513_10281434 3300031456 Bacteria 1440
46 Ga0307513_10360768 3300031456 Bacteria 1198
47 Ga0307513_10509826 3300031456 Bacteria 919
48 Ga0307508_10008187 3300031616 Bacteria 9692
49 Ga0307514_10030004 3300031649 Bacteria 4366
50 Ga0307516_10253808 3300031730 Bacteria 1452
51 Ga0307518_10279997 3300031838 Bacteria 1033
52 Ga0307410_10332496 3300031852 Bacteria 1209
53 Ga0307416_101117998 3300032002 Bacteria 893
54 Ga0307411_10145513 3300032005 Bacteria 1754
55 Ga0307507_10142283 3300033179 Bacteria 1835
56 Ga0395900_0239187 3300037418 Bacteria 1822
57 Ga0395900_1197075 3300037418 Bacteria 675
58 Ga0395898_0003329 3300037466 Bacteria 18046
59 Ga0395898_0612678 3300037466 Bacteria 1031
60 Ga0395901_0218260 3300038443 Bacteria 1994
61 Ga0439436_0002582 3300041404 Bacteria 5448
62 Ga0439436_0006346 3300041404 Bacteria 3629
63 Ga0439438_071085 3300041405 Bacteria 861
64 Ga0439439_0004051 3300041406 Bacteria 3274
65 Ga0439439_0014422 3300041406 Bacteria 1924
66 Ga0439439_0081760 3300041406 Bacteria 874
67 Ga0439466_0060996 3300041411 Bacteria 1215
68 Ga0439466_0075303 3300041411 Bacteria 1070
69 Ga0451853_0079623 3300041512 Bacteria 2373
70 Ga0451853_1373222 3300041512 Bacteria 2469
71 Ga0451853_2076158 3300041512 Bacteria 1855
72 Ga0439433_0001673 3300041999 Bacteria 4623
73 Ga0439433_0067351 3300041999 Bacteria 859
74 Ga0439442_062190 3300042002 Bacteria 792
75 Ga0439449_0001232 3300042007 Bacteria 10025
76 Ga0439449_0004363 3300042007 Bacteria 5459
77 Ga0439449_0013060 3300042007 Bacteria 3124
78 Ga0439449_0025111 3300042007 Bacteria 2227
79 Ga0439449_0093461 3300042007 Bacteria 1110
80 Ga0439455_0017353 3300042012 Bacteria 1676
81 Ga0439457_000408 3300042014 Bacteria 12281
82 Ga0439457_001534 3300042014 Bacteria 6930
83 Ga0439457_001862 3300042014 Bacteria 6233
84 Ga0450894_001383 3300042131 Bacteria 3507
85 Ga0450896_015547 3300042133 Bacteria 1090
86 Ga0450900_000794 3300042136 Bacteria 2755
87 Ga0450903_000629 3300042138 Bacteria 7135
88 Ga0450906_007805 3300042145 Bacteria 2098
89 Ga0450906_020337 3300042145 Bacteria 1188
90 Ga0450907_050400 3300042146 Bacteria 716
91 Ga0439458_0019962 3300042157 Bacteria 1545
92 Ga0466972_0003926 3300044658 Bacteria 7416
93 Ga0466972_0009303 3300044658 Bacteria 4938
94 Ga0466972_0096170 3300044658 Bacteria 1403
95 Ga0466965_0002990 3300044683 Bacteria 7334
96 Ga0466965_0016744 3300044683 Bacteria 3495
97 Ga0466965_0053067 3300044683 Bacteria 2014
98 Ga0466961_0351662 3300044693 Bacteria 897
99 Ga0466968_0009017 3300044735 Bacteria 3835
100 Ga0466970_0009715 3300044765 Bacteria 4867
101 Ga0466970_0032069 3300044765 Bacteria 2776
102 Ga0466970_0113455 3300044765 Bacteria 1481
103 Ga0466960_0072066 3300044901 Bacteria 1721
104 Ga0466960_0110139 3300044901 Bacteria 1429
105 Ga0466960_0114220 3300044901 Bacteria 1407
106 Ga0466967_1475328 3300045976 Bacteria 677
107 Ga0495603_0143889 3300046455 Bacteria 1386
108 Ga0495603_0651576 3300046455 Bacteria 603
109 Ga0495629_0005303 3300046459 Bacteria 9637
110 Ga0495638_0256242 3300046460 Bacteria 962
111 Ga0495594_0000431 3300046499 Bacteria 21108
112 Ga0495631_0009932 3300046518 Bacteria 4733
113 Ga0495622_0003921 3300046557 Bacteria 6950
114 Ga0495668_0000573 3300046616 Bacteria 45058
115 Ga0495625_0039496 3300046660 Bacteria 3446
116 Ga0495649_0132360 3300046694 Bacteria 1315
117 Ga0495589_0219921 3300046794 Bacteria 892
118 Ga0495636_0000350 3300047318 Bacteria 17602
119 Ga0495636_0003680 3300047318 Bacteria 5960
120 Ga0495672_0009166 3300047320 Bacteria 7208
121 Ga0495676_0002124 3300047321 Bacteria 17506
122 Ga0495687_003433 3300047443 Bacteria 11495
123 Ga0495677_0080135 3300047445 Bacteria 1223
124 Ga0495685_004600 3300047447 Bacteria 4471
125 Ga0495685_027224 3300047447 Bacteria 1966
126 Ga0495685_031410 3300047447 Bacteria 1825
127 Ga0495686_0021794 3300047472 Bacteria 4249
128 Ga0496105_0851299 3300048908 Bacteria 690
129 Ga0496113_0921675 3300048916 Bacteria 690
130 Ga0496125_0029988 3300048928 Bacteria 4874
131 Ga0501034_0121190 3300049571 Bacteria 2602
132 Ga0501037_0093125 3300049573 Bacteria 2179
133 Ga0501047_0023874 3300049581 Bacteria 5872
134 Ga0501048_0079806 3300049582 Bacteria 2309
135 Ga0501035_0596731 3300049822 Bacteria 900
136 Ga0501044_0058155 3300049823 Bacteria 3966
137 nmdc:mga03n38_260931_c1 3300050490 Bacteria 918
138 nmdc:mga05p37_5508_c1 3300050507 Bacteria 14870
139 nmdc:mga09592_20965_c1 3300050508 Bacteria 5381
140 nmdc:mga06r32_2991_c1 3300050510 Bacteria 15132
141 nmdc:mga06r32_384404_c1 3300050510 Bacteria 885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2870721527 2870727442 152
2 3300046455 Ga0495603_0651576 Ga0495603_0651576_60_560 163
3 3300003323 rootH1_10074544 rootH1_100745442 172
4 3300005458 Ga0070681_11018218 Ga0070681_110182181 172
5 3300015688 Ga0183367_1002 Ga0183367_1002162 172
6 3300027312 Ga0209371_1040525 Ga0209371_10405252 172
7 3300030500 Ga0268256_1046014 Ga0268256_10460141 172
8 3300042157 Ga0439458_0019962 Ga0439458_0019962_11_604 172
9 3300047472 Ga0495686_0021794 Ga0495686_0021794_1749_2345 172
10 3300031456 Ga0307513_10031524 Ga0307513_100315244 173
11 3300037418 Ga0395900_1197075 Ga0395900_1197075_54_644 173
12 3300037466 Ga0395898_0612678 Ga0395898_0612678_119_709 173
13 3300038443 Ga0395901_0218260 Ga0395901_0218260_1191_1781 173
14 3300003578 Ga0006562J51391_1182584 Ga0006562J51391_11825844 174
15 3300003578 Ga0006562J51391_1182585 Ga0006562J51391_11825852 174
16 3300041512 Ga0451853_0079623 Ga0451853_0079623_1444_2049 174
17 3300044683 Ga0466965_0053067 Ga0466965_0053067_312_848 178
18 3300037418 Ga0395900_0239187 Ga0395900_0239187_1117_1749 179
19 3300037466 Ga0395898_0003329 Ga0395898_0003329_2102_2734 179
20 iso_pu_bacteria 2816332119 2816427846 179
21 3300009148 Ga0105243_10000571 Ga0105243_100005717 180
22 iso_pu_bacteria 2751185734 2753070063 183
23 3300005614 Ga0068856_100439439 Ga0068856_1004394392 184
24 iso_pu_bacteria 2565956761 2566993082 185
25 iso_pu_bacteria 2738541308 2738889955 185
26 iso_pu_bacteria 2904535858 2904538924 185
27 iso_pu_bacteria 2917736166 2917743692 185
28 iso_pu_bacteria 2922554459 2922556778 185
29 iso_pu_bacteria 2582581312 2585298480 186
30 iso_pu_bacteria 2643221578 2643900150 186
31 iso_pu_bacteria 2643221587 2643943777 186
32 iso_pu_bacteria 2643221670 2644386783 186
33 iso_pu_bacteria 2643221673 2644405626 186
34 iso_pu_bacteria 2643221677 2644434515 186
35 iso_pu_bacteria 2643221714 2644632758 186
36 iso_pu_bacteria 2675903060 2676492839 186
37 iso_pu_bacteria 2738543011 2739237096 186
38 iso_pu_bacteria 2784746768 2785371366 186
39 iso_pu_bacteria 2862281513 2862284873 186
40 iso_pu_bacteria 2866612099 2866612577 186
41 iso_pu_bacteria 2867369537 2867372309 186
42 iso_pu_bacteria 2867428634 2867431465 186
43 iso_pu_bacteria 2875391855 2875395178 186
44 iso_pu_bacteria 2884693830 2884699482 186
45 iso_pu_bacteria 2889300758 2889301321 186
46 iso_pu_bacteria 2895427314 2895438445 186
47 iso_pu_bacteria 2895442618 2895443307 186
48 iso_pu_bacteria 2899359706 2899364433 186
49 iso_pu_bacteria 2912715099 2912717833 186
50 iso_pu_bacteria 2912757875 2912760748 186
51 iso_pu_bacteria 2918501144 2918506383 186
52 iso_pu_bacteria 2939743619 2939744789 186
53 iso_pu_bacteria 2946072368 2946077628 186
54 iso_pu_bacteria 2954711539 2954714435 186
55 iso_pu_bacteria 2954721474 2954724381 186
56 iso_pu_bacteria 2954731030 2954737437 186
57 iso_pu_bacteria 2954740390 2954743303 186
58 iso_pu_bacteria 2954749733 2954756291 186
59 iso_pu_bacteria 2954759201 2954762260 186
60 iso_pu_bacteria 2997600082 2997606809 186
61 iso_pu_bacteria 3006493962 3006498144 186
62 iso_pu_bacteria 8025530807 8025534630 186
63 iso_pu_bacteria 8056054917 8056058275 186
64 3300042007 Ga0439449_0025111 Ga0439449_0025111_1598_2191 187
65 iso_pu_bacteria 2547132424 2548692572 187
66 iso_pu_bacteria 2616644941 2616902096 187
67 iso_pu_bacteria 2861520306 2861522634 187
68 iso_pu_bacteria 2862705112 2862709172 187
69 iso_pu_bacteria 2873151551 2873157460 187
70 iso_pu_bacteria 8008485437 8008488388 187
71 iso_pu_bacteria 8025524527 8025527265 187
72 3300041512 Ga0451853_1373222 Ga0451853_1373222_834_1517 188
73 iso_pu_bacteria 2554235005 2554257832 188
74 iso_pu_bacteria 2643221548 2643763138 188
75 iso_pu_bacteria 2643221647 2644269594 188
76 iso_pu_bacteria 2643221678 2644439911 188
77 iso_pu_bacteria 2643221682 2644463992 188
78 iso_pu_bacteria 2784746763 2785343074 188
79 iso_pu_bacteria 2791354901 2791916201 188
80 iso_pu_bacteria 2791355406 2793977795 188
81 iso_pu_bacteria 2808606359 2808843918 188
82 iso_pu_bacteria 2811994879 2812357026 188
83 iso_pu_bacteria 2811994917 2812477225 188
84 iso_pu_bacteria 2852635781 2852640894 188
85 iso_pu_bacteria 2895427314 2895437746 188
86 iso_pu_bacteria 2919468124 2919471601 188
87 iso_pu_bacteria 2946045630 2946049483 188
88 iso_pu_bacteria 2946064051 2946068854 188
89 iso_pu_bacteria 2947224130 2947227051 188
90 iso_pu_bacteria 2954380949 2954384120 188
91 iso_pu_bacteria 2954691527 2954694939 188
92 iso_pu_bacteria 2954701450 2954710116 188
93 iso_pu_bacteria 8003314358 8003322293 188
94 iso_pu_bacteria 8047893842 8047899045 188
95 iso_pu_bacteria 8048356638 8048359875 188
96 iso_pu_bacteria 8048369669 8048376009 188
97 iso_pu_bacteria 8048379754 8048382111 188
98 iso_pu_bacteria 8056060235 8056060933 188
99 iso_pu_bacteria 8056447290 8056449337 188
100 3300006048 Ga0075363_100003786 Ga0075363_1000037863 189
101 3300028794 Ga0307515_10404061 Ga0307515_104040612 189
102 3300030522 Ga0307512_10070429 Ga0307512_100704292 189
103 3300030731 Ga0316177_1077249 Ga0316177_10772493 189
104 3300030732 Ga0316176_1067418 Ga0316176_10674184 189
105 3300030733 Ga0314311_1174787 Ga0314311_11747873 189
106 3300030736 Ga0316180_1045854 Ga0316180_10458542 189
107 3300030736 Ga0316180_1182629 Ga0316180_11826292 189
108 3300031456 Ga0307513_10281434 Ga0307513_102814342 189
109 3300044683 Ga0466965_0002990 Ga0466965_0002990_951_1520 189
110 3300044683 Ga0466965_0016744 Ga0466965_0016744_67_636 189
111 3300044735 Ga0466968_0009017 Ga0466968_0009017_83_652 189
112 3300044901 Ga0466960_0110139 Ga0466960_0110139_630_1199 189
113 3300046616 Ga0495668_0000573 Ga0495668_0000573_3414_3992 189
114 3300046660 Ga0495625_0039496 Ga0495625_0039496_1014_1610 189
115 3300048928 Ga0496125_0029988 Ga0496125_0029988_2436_3014 189
116 iso_pu_bacteria 2808606448 2809232245 189
117 iso_pu_bacteria 2856741275 2856742291 189
118 iso_pu_bacteria 2862382967 2862384107 189
119 iso_pu_bacteria 2891562705 2891565433 189
120 iso_pu_bacteria 2947224130 2947227776 189
121 iso_pu_bacteria 8008558824 8008565277 189
122 iso_pu_bacteria 8023623736 8023629800 189
123 3300003320 rootH2_10080325 rootH2_100803252 190
124 3300005437 Ga0070710_10000775 Ga0070710_1000077517 190
125 3300005439 Ga0070711_100458854 Ga0070711_1004588541 190
126 3300005981 Ga0081538_10236003 Ga0081538_102360031 190
127 3300006844 Ga0075428_100005123 Ga0075428_1000051239 190
128 3300006846 Ga0075430_100001516 Ga0075430_10000151610 190
129 3300006847 Ga0075431_100002814 Ga0075431_10000281412 190
130 3300006880 Ga0075429_100003015 Ga0075429_1000030159 190
131 3300009147 Ga0114129_10005409 Ga0114129_1000540911 190
132 3300017792 Ga0163161_10348460 Ga0163161_103484602 190
133 3300025898 Ga0207692_10008431 Ga0207692_100084312 190
134 3300025927 Ga0207687_10456492 Ga0207687_104564921 190
135 3300026118 Ga0207675_100893364 Ga0207675_1008933641 190
136 3300030731 Ga0316177_1033049 Ga0316177_10330492 190
137 3300031456 Ga0307513_10000005 Ga0307513_10000005346 190
138 3300031456 Ga0307513_10509826 Ga0307513_105098261 190
139 3300031649 Ga0307514_10030004 Ga0307514_100300042 190
140 3300031852 Ga0307410_10332496 Ga0307410_103324962 190
141 3300032002 Ga0307416_101117998 Ga0307416_1011179982 190
142 3300033179 Ga0307507_10142283 Ga0307507_101422831 190
143 3300041405 Ga0439438_071085 Ga0439438_071085_184_759 190
144 3300041406 Ga0439439_0014422 Ga0439439_0014422_209_784 190
145 3300041411 Ga0439466_0075303 Ga0439466_0075303_467_1042 190
146 3300042002 Ga0439442_062190 Ga0439442_062190_164_739 190
147 3300042007 Ga0439449_0004363 Ga0439449_0004363_1459_2034 190
148 3300042007 Ga0439449_0013060 Ga0439449_0013060_2211_2786 190
149 3300042014 Ga0439457_001862 Ga0439457_001862_3659_4234 190
150 3300044765 Ga0466970_0009715 Ga0466970_0009715_2687_3277 190
151 3300046460 Ga0495638_0256242 Ga0495638_0256242_286_867 190
152 3300046518 Ga0495631_0009932 Ga0495631_0009932_25_606 190
153 3300046694 Ga0495649_0132360 Ga0495649_0132360_83_673 190
154 3300046794 Ga0495589_0219921 Ga0495589_0219921_204_794 190
155 3300047318 Ga0495636_0000350 Ga0495636_0000350_5108_5689 190
156 3300047318 Ga0495636_0003680 Ga0495636_0003680_832_1422 190
157 3300047443 Ga0495687_003433 Ga0495687_003433_8370_8960 190
158 3300047445 Ga0495677_0080135 Ga0495677_0080135_233_814 190
159 3300047447 Ga0495685_004600 Ga0495685_004600_3190_3780 190
160 3300047447 Ga0495685_031410 Ga0495685_031410_495_1076 190
161 3300048908 Ga0496105_0851299 Ga0496105_0851299_86_667 190
162 3300048916 Ga0496113_0921675 Ga0496113_0921675_52_627 190
163 3300049823 Ga0501044_0058155 Ga0501044_0058155_859_1434 190
164 3300050507 nmdc:mga05p37_5508_c1 nmdc:mga05p37_5508_c1_9832_10407 190
165 3300050508 nmdc:mga09592_20965_c1 nmdc:mga09592_20965_c1_930_1505 190
166 3300050510 nmdc:mga06r32_2991_c1 nmdc:mga06r32_2991_c1_5906_6481 190
167 3300006048 Ga0075363_100106672 Ga0075363_1001066723 191
168 3300025302 Ga0207426_1035577 Ga0207426_10355773 191
169 3300031616 Ga0307508_10008187 Ga0307508_100081877 191
170 3300031730 Ga0307516_10253808 Ga0307516_102538082 191
171 3300031838 Ga0307518_10279997 Ga0307518_102799972 191
172 3300042136 Ga0450900_000794 Ga0450900_000794_1005_1592 191
173 3300042145 Ga0450906_020337 Ga0450906_020337_558_1163 191
174 3300046455 Ga0495603_0143889 Ga0495603_0143889_710_1318 191
175 3300046459 Ga0495629_0005303 Ga0495629_0005303_4510_5118 191
176 3300046499 Ga0495594_0000431 Ga0495594_0000431_6037_6645 191
177 3300046557 Ga0495622_0003921 Ga0495622_0003921_3356_3964 191
178 3300047320 Ga0495672_0009166 Ga0495672_0009166_6379_6960 191
179 3300047321 Ga0495676_0002124 Ga0495676_0002124_2863_3471 191
180 3300050490 nmdc:mga03n38_260931_c1 nmdc:mga03n38_260931_c1_308_898 191
181 iso_pu_bacteria 2551306166 2552105126 191
182 iso_pu_bacteria 2643221692 2644517192 191
183 3300005455 Ga0070663_100000249 Ga0070663_1000002495 192
184 3300013297 Ga0157378_10770920 Ga0157378_107709201 192
185 3300025972 Ga0207668_10050764 Ga0207668_100507642 192
186 3300026067 Ga0207678_10000065 Ga0207678_1000006528 192
187 3300031456 Ga0307513_10360768 Ga0307513_103607682 192
188 3300032005 Ga0307411_10145513 Ga0307411_101455132 192
189 3300041404 Ga0439436_0002582 Ga0439436_0002582_1370_1948 192
190 3300041404 Ga0439436_0006346 Ga0439436_0006346_1447_2025 192
191 3300041406 Ga0439439_0004051 Ga0439439_0004051_137_715 192
192 3300041406 Ga0439439_0081760 Ga0439439_0081760_64_642 192
193 3300041411 Ga0439466_0060996 Ga0439466_0060996_171_749 192
194 3300041512 Ga0451853_2076158 Ga0451853_2076158_1202_1801 192
195 3300041999 Ga0439433_0001673 Ga0439433_0001673_126_704 192
196 3300041999 Ga0439433_0067351 Ga0439433_0067351_85_663 192
197 3300042007 Ga0439449_0001232 Ga0439449_0001232_3555_4133 192
198 3300042007 Ga0439449_0093461 Ga0439449_0093461_379_957 192
199 3300042012 Ga0439455_0017353 Ga0439455_0017353_129_707 192
200 3300042014 Ga0439457_000408 Ga0439457_000408_8178_8756 192
201 3300042014 Ga0439457_001534 Ga0439457_001534_403_981 192
202 3300042131 Ga0450894_001383 Ga0450894_001383_455_1033 192
203 3300042133 Ga0450896_015547 Ga0450896_015547_71_649 192
204 3300042138 Ga0450903_000629 Ga0450903_000629_1383_1961 192
205 3300042145 Ga0450906_007805 Ga0450906_007805_44_622 192
206 3300042146 Ga0450907_050400 Ga0450907_050400_77_655 192
207 3300044658 Ga0466972_0003926 Ga0466972_0003926_210_815 192
208 3300044658 Ga0466972_0009303 Ga0466972_0009303_941_1519 192
209 3300044658 Ga0466972_0096170 Ga0466972_0096170_690_1283 192
210 3300044693 Ga0466961_0351662 Ga0466961_0351662_130_708 192
211 3300044765 Ga0466970_0032069 Ga0466970_0032069_2113_2718 192
212 3300044765 Ga0466970_0113455 Ga0466970_0113455_35_613 192
213 3300044901 Ga0466960_0072066 Ga0466960_0072066_647_1225 192
214 3300044901 Ga0466960_0114220 Ga0466960_0114220_292_870 192
215 3300045976 Ga0466967_1475328 Ga0466967_1475328_36_617 192
216 3300047447 Ga0495685_027224 Ga0495685_027224_645_1223 192
217 3300049571 Ga0501034_0121190 Ga0501034_0121190_1140_1718 192
218 3300049573 Ga0501037_0093125 Ga0501037_0093125_1558_2136 192
219 3300049581 Ga0501047_0023874 Ga0501047_0023874_1293_1871 192
220 3300049582 Ga0501048_0079806 Ga0501048_0079806_1257_1835 192
221 3300049822 Ga0501035_0596731 Ga0501035_0596731_28_618 192
222 3300050510 nmdc:mga06r32_384404_c1 nmdc:mga06r32_384404_c1_247_837 192
223 3300003316 rootH1_10003189 rootH1_100031897 193
224 3300003320 rootH2_10004696 rootH2_100046963 193
225 3300003323 rootH1_10019242 rootH1_100192422 193
226 3300003323 rootH1_10019252 rootH1_100192524 193
227 3300005539 Ga0068853_100112949 Ga0068853_1001129493 193
228 iso_pu_bacteria 2784132148 2784588632 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

28

74

0.97

PF17940

TetR_C_31

Tetracyclin repressor-like, C-terminal domain

96

206

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qko-assembly1.cif.gz_A crystal structure of transcriptional regulator rha06399 from rhodococcus sp. rha1 0.9384 7 193
2qko-assembly1.cif.gz_A crystal structure of transcriptional regulator rha06399 from rhodococcus sp. rha1 0.9228 7 193
3t6n-assembly1.cif.gz_A crystal structure of transcriptional regulator 0.825 6 191
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.8227 9 66
3t6n-assembly1.cif.gz_A crystal structure of transcriptional regulator 0.8165 6 191
ID Description Score Start End Superfamily
2y31A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9199 9 61 1.10.10.60
2qkoD00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9194 5 193 1.10.357.10
2y30B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9162 9 58 1.10.10.60
2y2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9086 9 61 1.10.10.60
2qkoD00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9042 5 193 1.10.357.10
ID Description Score Start End GO Terms
AF-A0A7U9DX65-F1-model_v4 Transcriptional regulator, TetR family 0.9949 2 193 GO:0003677
GO:0006355
AF-A0A7U9DX65-F1-model_v4 Transcriptional regulator, TetR family 0.9847 2 193 GO:0003677
GO:0006355
AF-H0BHI6-F1-model_v4 TetR family transcriptional regulator 0.9724 12 190 GO:0000976
GO:0003700
AF-A0A387H9I4-F1-model_v4 HTH-type transcriptional regulator BetI 0.9695 7 191 GO:0000976
GO:0003700
AF-A0A7V8NCK1-F1-model_v4 TetR family transcriptional regulator 0.9695 7 190 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
91.89 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map