F341010

General Info

Members Datasets Scaffolds Average Seq Length
228 129 456 141

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10001428|Ga0213872_1000142810
Length 156
Sequence MFNPSRQDARRFFFDIWSKHKAQEALGDLERQTLGILFAHPEYQPIVDHPDRYMEQEWPPELGETNPFLHMSLHLAIEEQRTIDQPFGIRSLYAQLALRLGDEHAAQHAMMDCLAEMIWQAQRAQTPPDVNVYLSAVRARLGMGAEDAPRPTLDQR

Samples

Sample ID Description Type Environment
1 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
69 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
70 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
71 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
78 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
79 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
80 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
82 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
83 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
87 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
90 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
101 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
123 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
124 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 6.14
Rhizosphere 88.6
Stem 0
Stem Tuber 0
Unclassified 7.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213872_10001428 3300021361 Bacteria 15611
2 Ga0068869_100221093 3300005334 Bacteria 1501
3 Ga0068868_100260486 3300005338 Bacteria 1462
4 Ga0070660_100407948 3300005339 Bacteria 1124
5 Ga0070660_100500334 3300005339 Bacteria 1011
6 Ga0070689_100984522 3300005340 Unclassified 749
7 Ga0070687_100016002 3300005343 Bacteria 3407
8 Ga0070661_100018377 3300005344 Bacteria 4970
9 Ga0070661_101087193 3300005344 Bacteria 666
10 Ga0070668_102059282 3300005347 Unclassified 527
11 Ga0070669_100748112 3300005353 Bacteria 828
12 Ga0070675_100383190 3300005354 Bacteria 1252
13 Ga0070659_100462110 3300005366 Bacteria 1078
14 Ga0070659_100966024 3300005366 Bacteria 747
15 Ga0070714_100015496 3300005435 Bacteria 6131
16 Ga0070711_100496129 3300005439 Bacteria 1006
17 Ga0070711_100808692 3300005439 Unclassified 795
18 Ga0070694_100348327 3300005444 Bacteria 1147
19 Ga0070663_100730379 3300005455 Bacteria 844
20 Ga0070662_100351960 3300005457 Bacteria 1207
21 Ga0070681_10006878 3300005458 Bacteria 11070
22 Ga0070706_100327405 3300005467 Bacteria 1429
23 Ga0070707_100640137 3300005468 Unclassified 1026
24 Ga0070679_100091241 3300005530 Bacteria 3034
25 Ga0070684_101323614 3300005535 Bacteria 678
26 Ga0068853_100066748 3300005539 Bacteria 3125
27 Ga0068853_100749812 3300005539 Bacteria 933
28 Ga0070686_100183275 3300005544 Bacteria 1489
29 Ga0070704_100229321 3300005549 Bacteria 1514
30 Ga0070704_101122353 3300005549 Bacteria 715
31 Ga0070664_100405601 3300005564 Bacteria 1247
32 Ga0068856_100182694 3300005614 Bacteria 2111
33 Ga0068856_100882850 3300005614 Bacteria 913
34 Ga0068851_10405323 3300005834 Bacteria 803
35 Ga0068860_100699355 3300005843 Bacteria 1023
36 Ga0075366_10066296 3300006195 Bacteria 2148
37 Ga0075366_10154158 3300006195 Bacteria 1391
38 Ga0075366_10226160 3300006195 Unclassified 1140
39 Ga0097621_101258794 3300006237 Bacteria 698
40 Ga0068871_100978126 3300006358 Bacteria 787
41 Ga0068865_101428293 3300006881 Unclassified 618
42 Ga0068865_101768242 3300006881 Unclassified 558
43 Ga0111539_10002731 3300009094 Bacteria 23422
44 Ga0111539_10017430 3300009094 Bacteria 8892
45 Ga0105245_11221520 3300009098 Bacteria 800
46 Ga0105241_10113186 3300009174 Bacteria 2175
47 Ga0105237_10360800 3300009545 Bacteria 1457
48 Ga0157373_10095750 3300013100 Bacteria 2090
49 Ga0157370_10001598 3300013104 Bacteria 28004
50 Ga0157370_10072493 3300013104 Bacteria 3249
51 Ga0157370_10074822 3300013104 Bacteria 3194
52 Ga0157369_10741337 3300013105 Bacteria 1011
53 Ga0157374_10227673 3300013296 Bacteria 1831
54 Ga0163162_11073334 3300013306 Bacteria 912
55 Ga0157372_10067752 3300013307 Bacteria 4012
56 Ga0157372_10112700 3300013307 Bacteria 3116
57 Ga0157372_10330022 3300013307 Bacteria 1776
58 Ga0157372_11292867 3300013307 Bacteria 842
59 Ga0157375_10469328 3300013308 Bacteria 1424
60 Ga0157375_12037135 3300013308 Bacteria 682
61 Ga0163163_10977270 3300014325 Bacteria 910
62 Ga0182008_10239519 3300014497 Bacteria 933
63 Ga0157376_10370421 3300014969 Bacteria 1376
64 Ga0207707_10051280 3300025912 Bacteria 3593
65 Ga0207663_10871957 3300025916 Unclassified 719
66 Ga0207657_10210485 3300025919 Bacteria 1561
67 Ga0207652_10367695 3300025921 Bacteria 1298
68 Ga0207687_10642752 3300025927 Bacteria 897
69 Ga0207690_11051358 3300025932 Bacteria 678
70 Ga0207706_10156470 3300025933 Bacteria 2004
71 Ga0207670_11157657 3300025936 Bacteria 654
72 Ga0207704_11098016 3300025938 Unclassified 676
73 Ga0207679_10096597 3300025945 Bacteria 2299
74 Ga0207639_10106199 3300026041 Bacteria 2279
75 Ga0207678_10863105 3300026067 Bacteria 800
76 Ga0207702_10496588 3300026078 Bacteria 1189
77 Ga0207702_10856417 3300026078 Bacteria 900
78 Ga0207674_10485925 3300026116 Bacteria 1193
79 Ga0207675_100482309 3300026118 Bacteria 1232
80 Ga0209999_1039465 3300027543 Unclassified 884
81 Ga0209966_1002989 3300027695 Bacteria 2835
82 Ga0207428_10136981 3300027907 Bacteria 1871
83 Ga0207428_10143344 3300027907 Bacteria 1822
84 Ga0265331_10010661 3300031250 Bacteria 5068
85 Ga0265327_10000706 3300031251 Bacteria 52819
86 Ga0265327_10013619 3300031251 Bacteria 5391
87 Ga0265327_10016495 3300031251 Bacteria 4686
88 Ga0265316_10131505 3300031344 Bacteria 1885
89 Ga0265316_10522203 3300031344 Bacteria 847
90 Ga0265316_11097431 3300031344 Bacteria 552
91 Ga0316575_10014301 3300031665 Bacteria 2977
92 Ga0316575_10014904 3300031665 Bacteria 2925
93 Ga0316575_10097717 3300031665 Bacteria 1192
94 Ga0316579_10007172 3300031691 Bacteria 4589
95 Ga0316579_10016062 3300031691 Bacteria 3262
96 Ga0316579_10101185 3300031691 Bacteria 1380
97 Ga0316576_10072400 3300031727 Bacteria 2544
98 Ga0316576_10210619 3300031727 Bacteria 1463
99 Ga0316576_10528982 3300031727 Bacteria 865
100 Ga0316578_10087963 3300031728 Bacteria 1853
101 Ga0316578_10091624 3300031728 Bacteria 1816
102 Ga0316578_10163321 3300031728 Bacteria 1342
103 Ga0316578_10474846 3300031728 Unclassified 738
104 Ga0307405_10649088 3300031731 Bacteria 868
105 Ga0316577_10001698 3300031733 Bacteria 10565
106 Ga0316577_10085985 3300031733 Bacteria 1760
107 Ga0316577_10138546 3300031733 Bacteria 1370
108 Ga0316577_10158303 3300031733 Bacteria 1277
109 Ga0307412_10228875 3300031911 Bacteria 1430
110 Ga0307412_11783472 3300031911 Unclassified 566
111 Ga0307409_101820332 3300031995 Bacteria 638
112 Ga0307411_10077719 3300032005 Bacteria 2273
113 Ga0316583_10006746 3300032133 Bacteria 4137
114 Ga0316583_10015154 3300032133 Bacteria 2775
115 Ga0316585_10000405 3300032137 Bacteria 9993
116 Ga0316585_10058566 3300032137 Bacteria 1242
117 Ga0316574_0000885 3300035398 Bacteria 13231
118 Ga0316574_0019831 3300035398 Bacteria 3974
119 Ga0316574_0019988 3300035398 Bacteria 3959
120 Ga0316574_0053272 3300035398 Bacteria 2525
121 Ga0316574_0069905 3300035398 Bacteria 2217
122 Ga0373924_0004971 3300035410 Bacteria 4680
123 Ga0373933_0046946 3300035724 Bacteria 2567
124 Ga0316582_0000189 3300036647 Bacteria 19327
125 Ga0316582_0002497 3300036647 Bacteria 8664
126 Ga0316582_0077130 3300036647 Bacteria 2168
127 Ga0316582_0218820 3300036647 Bacteria 1302
128 Ga0316582_0256102 3300036647 Bacteria 1200
129 Ga0316582_0296006 3300036647 Bacteria 1111
130 Ga0316582_0304716 3300036647 Unclassified 1095
131 Ga0316584_0002131 3300036712 Bacteria 12389
132 Ga0316584_0028119 3300036712 Bacteria 4143
133 Ga0316584_0030007 3300036712 Bacteria 4016
134 Ga0316584_0035793 3300036712 Bacteria 3683
135 Ga0316584_0048843 3300036712 Bacteria 3162
136 Ga0316584_0110218 3300036712 Bacteria 2060
137 Ga0316584_0166102 3300036712 Bacteria 1639
138 Ga0395900_1903449 3300037418 Unclassified 505
139 Ga0395901_0176527 3300038443 Bacteria 2241
140 Ga0400484_04397 3300038725 Bacteria 1761
141 Ga0400484_12145 3300038725 Bacteria 4548
142 Ga0400483_094903 3300039062 Bacteria 1434
143 Ga0400483_117785 3300039062 Bacteria 10443
144 Ga0400483_137215 3300039062 Bacteria 1564
145 Ga0400483_214353 3300039062 Bacteria 2362
146 Ga0400483_263001 3300039062 Bacteria 5080
147 Ga0436361_0922237 3300039447 Bacteria 22454
148 Ga0451789_0058971 3300041443 Bacteria 891
149 Ga0451853_1939891 3300041512 Bacteria 1258
150 Ga0451853_4085694 3300041512 Bacteria 750
151 Ga0453684_0823108 3300044712 Unclassified 1000
152 Ga0496100_0432765 3300048903 Bacteria 1006
153 Ga0496101_0016601 3300048904 Bacteria 4980
154 Ga0496106_0387680 3300048909 Bacteria 1123
155 Ga0496108_0150509 3300048911 Bacteria 2008
156 Ga0496108_0766640 3300048911 Bacteria 834
157 Ga0496109_0201358 3300048912 Bacteria 1872
158 Ga0496109_0286791 3300048912 Bacteria 1552
159 Ga0496109_0421288 3300048912 Bacteria 1261
160 Ga0496109_0530243 3300048912 Bacteria 1111
161 Ga0496113_1230014 3300048916 Bacteria 584
162 Ga0496113_1338770 3300048916 Bacteria 556
163 Ga0496114_0408269 3300048917 Bacteria 1203
164 Ga0496115_0399015 3300048918 Bacteria 1116
165 Ga0501295_145858 3300049518 Unclassified 582
166 Ga0501300_004869 3300049523 Bacteria 1984
167 Ga0501031_0006004 3300049568 Bacteria 7924
168 Ga0501031_0015678 3300049568 Bacteria 4919
169 Ga0501031_0314841 3300049568 Bacteria 1014
170 Ga0501032_0000725 3300049569 Bacteria 26785
171 Ga0501032_0004667 3300049569 Bacteria 10292
172 Ga0501032_0069717 3300049569 Bacteria 2346
173 Ga0501032_0089203 3300049569 Bacteria 2047
174 Ga0501032_0101753 3300049569 Bacteria 1903
175 Ga0501032_0177428 3300049569 Bacteria 1395
176 Ga0501032_0352336 3300049569 Bacteria 948
177 Ga0501033_0000439 3300049570 Bacteria 39902
178 Ga0501033_0006332 3300049570 Bacteria 9276
179 Ga0501033_0008210 3300049570 Bacteria 8087
180 Ga0501034_0123529 3300049571 Bacteria 2574
181 Ga0501034_0321143 3300049571 Bacteria 1481
182 Ga0501034_0457429 3300049571 Bacteria 1193
183 Ga0501036_0000430 3300049572 Bacteria 29851
184 Ga0501036_0057077 3300049572 Bacteria 3307
185 Ga0501036_0071708 3300049572 Bacteria 2928
186 Ga0501036_1070294 3300049572 Bacteria 659
187 Ga0501037_0013077 3300049573 Bacteria 6118
188 Ga0501038_0002785 3300049574 Bacteria 16266
189 Ga0501038_0004504 3300049574 Bacteria 12959
190 Ga0501038_0011564 3300049574 Bacteria 8051
191 Ga0501038_0042855 3300049574 Bacteria 3939
192 Ga0501038_0055506 3300049574 Bacteria 3402
193 Ga0501038_0073073 3300049574 Bacteria 2905
194 Ga0501038_0441785 3300049574 Bacteria 1001
195 Ga0501039_0002391 3300049575 Bacteria 13961
196 Ga0501039_0018263 3300049575 Bacteria 5381
197 Ga0501039_0028903 3300049575 Bacteria 4268
198 Ga0501039_1022696 3300049575 Bacteria 642
199 Ga0501040_0003772 3300049576 Bacteria 9828
200 Ga0501042_0006018 3300049578 Bacteria 7854
201 Ga0501043_0001851 3300049579 Bacteria 18116
202 Ga0501043_0007496 3300049579 Bacteria 8664
203 Ga0501043_0714161 3300049579 Bacteria 731
204 Ga0501046_0010589 3300049580 Bacteria 7914
205 Ga0501047_0001515 3300049581 Bacteria 22685
206 Ga0501047_0961257 3300049581 Bacteria 667
207 Ga0501048_0009147 3300049582 Bacteria 7451
208 Ga0501068_0001320 3300049584 Bacteria 13157
209 Ga0501072_0072711 3300049588 Bacteria 2718
210 Ga0501075_0553444 3300049591 Bacteria 878
211 Ga0501077_0035817 3300049593 Bacteria 3160
212 Ga0501079_0147884 3300049741 Bacteria 1831
213 Ga0501080_0291598 3300049742 Bacteria 1481
214 Ga0501269_002683 3300049766 Bacteria 2172
215 Ga0501280_000572 3300049776 Bacteria 8558
216 Ga0501282_013700 3300049778 Bacteria 878
217 Ga0501035_0000532 3300049822 Bacteria 42519
218 Ga0501035_0041708 3300049822 Bacteria 4143
219 Ga0501035_0053953 3300049822 Bacteria 3592
220 Ga0501035_0368875 3300049822 Bacteria 1199
221 Ga0501035_0647224 3300049822 Bacteria 857
222 Ga0501044_0000545 3300049823 Bacteria 45907
223 Ga0501044_0001517 3300049823 Bacteria 27229
224 Ga0501044_0099048 3300049823 Bacteria 2934
225 Ga0501045_0000335 3300049824 Bacteria 27788
226 nmdc:mga08y16_122658_c1 3300050511 Bacteria 2704
227 nmdc:mga08y16_25603_c1 3300050511 Bacteria 6225
228 2998348199 2998344455 Bacteria 4222996
229 Ga0213872_10001428
230 Ga0068869_100221093
231 Ga0068868_100260486
232 Ga0070660_100407948
233 Ga0070660_100500334
234 Ga0070689_100984522
235 Ga0070687_100016002
236 Ga0070661_100018377
237 Ga0070661_101087193
238 Ga0070668_102059282
239 Ga0070669_100748112
240 Ga0070675_100383190
241 Ga0070659_100462110
242 Ga0070659_100966024
243 Ga0070714_100015496
244 Ga0070711_100496129
245 Ga0070711_100808692
246 Ga0070694_100348327
247 Ga0070663_100730379
248 Ga0070662_100351960
249 Ga0070681_10006878
250 Ga0070706_100327405
251 Ga0070707_100640137
252 Ga0070679_100091241
253 Ga0070684_101323614
254 Ga0068853_100066748
255 Ga0068853_100749812
256 Ga0070686_100183275
257 Ga0070704_100229321
258 Ga0070704_101122353
259 Ga0070664_100405601
260 Ga0068856_100182694
261 Ga0068856_100882850
262 Ga0068851_10405323
263 Ga0068860_100699355
264 Ga0075366_10066296
265 Ga0075366_10154158
266 Ga0075366_10226160
267 Ga0097621_101258794
268 Ga0068871_100978126
269 Ga0068865_101428293
270 Ga0068865_101768242
271 Ga0111539_10002731
272 Ga0111539_10017430
273 Ga0105245_11221520
274 Ga0105241_10113186
275 Ga0105237_10360800
276 Ga0157373_10095750
277 Ga0157370_10001598
278 Ga0157370_10072493
279 Ga0157370_10074822
280 Ga0157369_10741337
281 Ga0157374_10227673
282 Ga0163162_11073334
283 Ga0157372_10067752
284 Ga0157372_10112700
285 Ga0157372_10330022
286 Ga0157372_11292867
287 Ga0157375_10469328
288 Ga0157375_12037135
289 Ga0163163_10977270
290 Ga0182008_10239519
291 Ga0157376_10370421
292 Ga0207707_10051280
293 Ga0207663_10871957
294 Ga0207657_10210485
295 Ga0207652_10367695
296 Ga0207687_10642752
297 Ga0207690_11051358
298 Ga0207706_10156470
299 Ga0207670_11157657
300 Ga0207704_11098016
301 Ga0207679_10096597
302 Ga0207639_10106199
303 Ga0207678_10863105
304 Ga0207702_10496588
305 Ga0207702_10856417
306 Ga0207674_10485925
307 Ga0207675_100482309
308 Ga0209999_1039465
309 Ga0209966_1002989
310 Ga0207428_10136981
311 Ga0207428_10143344
312 Ga0265331_10010661
313 Ga0265327_10000706
314 Ga0265327_10013619
315 Ga0265327_10016495
316 Ga0265316_10131505
317 Ga0265316_10522203
318 Ga0265316_11097431
319 Ga0316575_10014301
320 Ga0316575_10014904
321 Ga0316575_10097717
322 Ga0316579_10007172
323 Ga0316579_10016062
324 Ga0316579_10101185
325 Ga0316576_10072400
326 Ga0316576_10210619
327 Ga0316576_10528982
328 Ga0316578_10087963
329 Ga0316578_10091624
330 Ga0316578_10163321
331 Ga0316578_10474846
332 Ga0307405_10649088
333 Ga0316577_10001698
334 Ga0316577_10085985
335 Ga0316577_10138546
336 Ga0316577_10158303
337 Ga0307412_10228875
338 Ga0307412_11783472
339 Ga0307409_101820332
340 Ga0307411_10077719
341 Ga0316583_10006746
342 Ga0316583_10015154
343 Ga0316585_10000405
344 Ga0316585_10058566
345 Ga0316574_0000885
346 Ga0316574_0019831
347 Ga0316574_0019988
348 Ga0316574_0053272
349 Ga0316574_0069905
350 Ga0373924_0004971
351 Ga0373933_0046946
352 Ga0316582_0000189
353 Ga0316582_0002497
354 Ga0316582_0077130
355 Ga0316582_0218820
356 Ga0316582_0256102
357 Ga0316582_0296006
358 Ga0316582_0304716
359 Ga0316584_0002131
360 Ga0316584_0028119
361 Ga0316584_0030007
362 Ga0316584_0035793
363 Ga0316584_0048843
364 Ga0316584_0110218
365 Ga0316584_0166102
366 Ga0395900_1903449
367 Ga0395901_0176527
368 Ga0400484_04397
369 Ga0400484_12145
370 Ga0400483_094903
371 Ga0400483_117785
372 Ga0400483_137215
373 Ga0400483_214353
374 Ga0400483_263001
375 Ga0436361_0922237
376 Ga0451789_0058971
377 Ga0451853_1939891
378 Ga0451853_4085694
379 Ga0453684_0823108
380 Ga0496100_0432765
381 Ga0496101_0016601
382 Ga0496106_0387680
383 Ga0496108_0150509
384 Ga0496108_0766640
385 Ga0496109_0201358
386 Ga0496109_0286791
387 Ga0496109_0421288
388 Ga0496109_0530243
389 Ga0496113_1230014
390 Ga0496113_1338770
391 Ga0496114_0408269
392 Ga0496115_0399015
393 Ga0501295_145858
394 Ga0501300_004869
395 Ga0501031_0006004
396 Ga0501031_0015678
397 Ga0501031_0314841
398 Ga0501032_0000725
399 Ga0501032_0004667
400 Ga0501032_0069717
401 Ga0501032_0089203
402 Ga0501032_0101753
403 Ga0501032_0177428
404 Ga0501032_0352336
405 Ga0501033_0000439
406 Ga0501033_0006332
407 Ga0501033_0008210
408 Ga0501034_0123529
409 Ga0501034_0321143
410 Ga0501034_0457429
411 Ga0501036_0000430
412 Ga0501036_0057077
413 Ga0501036_0071708
414 Ga0501036_1070294
415 Ga0501037_0013077
416 Ga0501038_0002785
417 Ga0501038_0004504
418 Ga0501038_0011564
419 Ga0501038_0042855
420 Ga0501038_0055506
421 Ga0501038_0073073
422 Ga0501038_0441785
423 Ga0501039_0002391
424 Ga0501039_0018263
425 Ga0501039_0028903
426 Ga0501039_1022696
427 Ga0501040_0003772
428 Ga0501042_0006018
429 Ga0501043_0001851
430 Ga0501043_0007496
431 Ga0501043_0714161
432 Ga0501046_0010589
433 Ga0501047_0001515
434 Ga0501047_0961257
435 Ga0501048_0009147
436 Ga0501068_0001320
437 Ga0501072_0072711
438 Ga0501075_0553444
439 Ga0501077_0035817
440 Ga0501079_0147884
441 Ga0501080_0291598
442 Ga0501269_002683
443 Ga0501280_000572
444 Ga0501282_013700
445 Ga0501035_0000532
446 Ga0501035_0041708
447 Ga0501035_0053953
448 Ga0501035_0368875
449 Ga0501035_0647224
450 Ga0501044_0000545
451 Ga0501044_0001517
452 Ga0501044_0099048
453 Ga0501045_0000335
454 nmdc:mga08y16_122658_c1
455 nmdc:mga08y16_25603_c1
456 2998348199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08897

DUF1841

Domain of unknown function (DUF1841)

5

139

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fmh-assembly1.cif.gz_B crystal structure of the membrane attack complex assembly inhibitor bga71 from lyme disease agent borreliella bavariensis (native data) 0.2782 14 126
8grx-assembly1.cif.gz_C apoe4 receptor in complex with apoe4 ntd 0.2779 3 126
6fmh-assembly3.cif.gz_F crystal structure of the membrane attack complex assembly inhibitor bga71 from lyme disease agent borreliella bavariensis (native data) 0.2703 14 126
1i5n-assembly2.cif.gz_B crystal structure of the p1 domain of chea from salmonella typhimurium 0.2595 24 126
6fmh-assembly1.cif.gz_B crystal structure of the membrane attack complex assembly inhibitor bga71 from lyme disease agent borreliella bavariensis (native data) 0.2514 14 126
ID Description Score Start End Superfamily
3h4cA01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.491 75 125 1.10.472.10
4nleB03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 0.4898 79 127 1.10.40.30
1d3uB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.432 79 125 1.10.472.10
af_Q9VPW9_151_264_1.10.472.80 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Ypt/Rab-GAP domain of gyp1p, domain 3 0.3548 21 125 1.10.472.80
4nleB03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 0.3547 79 127 1.10.40.30
ID Description Score Start End GO Terms
AF-A0A3S0DSN7-F1-model_v4 DUF1841 family protein 0.9851 2 126
AF-A0A5C7VJL0-F1-model_v4 DUF1841 family protein 0.982 2 127
AF-A0A7U1PWS8-F1-model_v4 deleted 0.9801 2 125
AF-E5AT72-F1-model_v4 AmpD protein 0.9793 2 125
AF-A2W8I3-F1-model_v4 deleted 0.9791 2 125

Map