F340744

General Info

Members Datasets Scaffolds Average Seq Length
228 137 456 236

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100082976|Ga0070707_1000829763
Length 282
Sequence MSSPNRKRDPNWQSADGGGLLRRGACSRAARSADPWAPRNDSMGGRQVIDFYYWPTPNGWKVAIMLEECGLEYRTVPVNIGKGDQFKPEFLKISPNNRMPAIVDHDPPSEFGPGPLPVFESGAILIHLAEKTGRFMPAGKRVRKEMLEWLFWQVGNLGPMAGQLSHFVNYAQGEHPYSHKRYADEYNRCLGVLERRLEGRDFILDEYSIADMASWPWVLIAKPLGQPLDDFPSVSRWRAAVRDRPAVQRGVDLGKEWRRRAPPSDEERKILFNQTARSSGAR

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
75 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
76 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
79 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
80 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
81 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
136 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.32
Rhizosphere 92.11
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100082976 3300005468 Bacteria 3096
2 Ga0070670_100297617 3300005331 Bacteria 1411
3 Ga0070680_100254234 3300005336 Bacteria 1486
4 Ga0070680_100363698 3300005336 Bacteria 1231
5 Ga0070669_100439794 3300005353 Bacteria 1073
6 Ga0070675_100100498 3300005354 Bacteria 2436
7 Ga0070671_100785414 3300005355 Bacteria 829
8 Ga0070667_100187535 3300005367 Bacteria 1831
9 Ga0070714_100018622 3300005435 Bacteria 5645
10 Ga0070714_100038695 3300005435 Bacteria 4011
11 Ga0070714_100103530 3300005435 Bacteria 2511
12 Ga0070714_100405132 3300005435 Bacteria 1290
13 Ga0070713_100232451 3300005436 Bacteria 1676
14 Ga0070713_100571012 3300005436 Bacteria 1072
15 Ga0070710_10102262 3300005437 Bacteria 1708
16 Ga0070710_10223233 3300005437 Bacteria 1200
17 Ga0070711_100067993 3300005439 Bacteria 2502
18 Ga0070711_100099471 3300005439 Bacteria 2113
19 Ga0070711_100251298 3300005439 Bacteria 1387
20 Ga0070694_100030799 3300005444 Bacteria 3513
21 Ga0070708_100172221 3300005445 Bacteria 2021
22 Ga0070681_10055318 3300005458 Bacteria 3951
23 Ga0070681_10229034 3300005458 Bacteria 1773
24 Ga0070706_100027100 3300005467 Bacteria 5273
25 Ga0070706_100071002 3300005467 Bacteria 3220
26 Ga0070698_100001824 3300005471 Bacteria 23701
27 Ga0070698_100053951 3300005471 Bacteria 4083
28 Ga0070698_100071155 3300005471 Bacteria 3488
29 Ga0070698_100405095 3300005471 Bacteria 1297
30 Ga0070699_100046281 3300005518 Bacteria 3765
31 Ga0070679_100294258 3300005530 Bacteria 1575
32 Ga0070697_100288617 3300005536 Bacteria 1409
33 Ga0070696_100288882 3300005546 Bacteria 1252
34 Ga0068856_100057385 3300005614 Bacteria 3843
35 Ga0068863_100184849 3300005841 Bacteria 2001
36 Ga0081455_10294516 3300005937 Bacteria 1167
37 Ga0070717_10023906 3300006028 Bacteria 4848
38 Ga0070717_10027661 3300006028 Bacteria 4533
39 Ga0070717_10128124 3300006028 Bacteria 2180
40 Ga0070717_10165543 3300006028 Bacteria 1920
41 Ga0070712_100122472 3300006175 Bacteria 1959
42 Ga0070712_100200052 3300006175 Bacteria 1569
43 Ga0070712_100371665 3300006175 Bacteria 1175
44 Ga0075428_100001050 3300006844 Bacteria 29326
45 Ga0075430_100234894 3300006846 Bacteria 1520
46 Ga0075431_100000573 3300006847 Bacteria 31102
47 Ga0075429_100004793 3300006880 Bacteria 11648
48 Ga0075436_100104809 3300006914 Bacteria 1971
49 Ga0105240_10838634 3300009093 Bacteria 993
50 Ga0111539_10000922 3300009094 Bacteria 38445
51 Ga0111539_10118481 3300009094 Bacteria 3103
52 Ga0111539_10149220 3300009094 Bacteria 2737
53 Ga0114129_10000529 3300009147 Bacteria 46728
54 Ga0105243_10496941 3300009148 Bacteria 1155
55 Ga0105248_10199449 3300009177 Bacteria 2254
56 Ga0105248_10669159 3300009177 Bacteria 1171
57 Ga0105249_10028070 3300009553 Bacteria 5080
58 Ga0099796_10163914 3300010159 Bacteria 883
59 Ga0157375_10301712 3300013308 Bacteria 1765
60 Ga0182008_10086186 3300014497 Bacteria 1546
61 Ga0182008_10162889 3300014497 Bacteria 1123
62 Ga0157379_10288489 3300014968 Bacteria 1494
63 Ga0157379_10321671 3300014968 Bacteria 1412
64 Ga0182007_10083860 3300015262 Bacteria 1046
65 Ga0213873_10011278 3300021358 Bacteria 1908
66 Ga0213872_10056476 3300021361 Bacteria 1779
67 Ga0213874_10021446 3300021377 Bacteria 1782
68 Ga0213875_10007709 3300021388 Bacteria 5543
69 Ga0213875_10009571 3300021388 Bacteria 4901
70 Ga0207682_10244636 3300025893 Bacteria 834
71 Ga0207699_10067592 3300025906 Bacteria 2173
72 Ga0207699_10175357 3300025906 Bacteria 1437
73 Ga0207699_10284950 3300025906 Bacteria 1149
74 Ga0207684_10036741 3300025910 Bacteria 4157
75 Ga0207707_10107413 3300025912 Bacteria 2440
76 Ga0207707_10190437 3300025912 Bacteria 1790
77 Ga0207693_10024296 3300025915 Bacteria 4811
78 Ga0207693_10482038 3300025915 Bacteria 968
79 Ga0207663_10102971 3300025916 Bacteria 1922
80 Ga0207663_10242661 3300025916 Bacteria 1322
81 Ga0207646_10005315 3300025922 Bacteria 13574
82 Ga0207650_10413318 3300025925 Bacteria 1118
83 Ga0207659_10199245 3300025926 Bacteria 1598
84 Ga0207700_10102677 3300025928 Bacteria 2284
85 Ga0207700_10120629 3300025928 Bacteria 2125
86 Ga0207700_10314192 3300025928 Bacteria 1356
87 Ga0207664_10281821 3300025929 Bacteria 1458
88 Ga0207664_10672234 3300025929 Bacteria 931
89 Ga0207665_10028030 3300025939 Bacteria 3720
90 Ga0207712_10097755 3300025961 Bacteria 2176
91 Ga0207658_10279815 3300025986 Bacteria 1430
92 Ga0207702_10254294 3300026078 Bacteria 1651
93 Ga0207702_10434022 3300026078 Bacteria 1272
94 Ga0207641_10107039 3300026088 Bacteria 2473
95 Ga0207641_10480793 3300026088 Bacteria 1204
96 Ga0207428_10001697 3300027907 Bacteria 22616
97 Ga0207428_10013840 3300027907 Bacteria 7028
98 Ga0268264_10256358 3300028381 Bacteria 1627
99 Ga0268264_10884802 3300028381 Bacteria 896
100 Ga0265338_10028954 3300028800 Bacteria 5508
101 Ga0316576_10018121 3300031727 Bacteria 4800
102 Ga0316578_10076716 3300031728 Bacteria 1984
103 Ga0307413_10024326 3300031824 Bacteria 3300
104 Ga0307410_10010570 3300031852 Bacteria 5235
105 Ga0307406_10580482 3300031901 Bacteria 921
106 Ga0307407_10058348 3300031903 Bacteria 2243
107 Ga0307409_100014290 3300031995 Bacteria 5156
108 Ga0307416_100036689 3300032002 Bacteria 3763
109 Ga0307411_10079626 3300032005 Bacteria 2250
110 Ga0373926_0016411 3300035083 Bacteria 2533
111 Ga0373934_0101769 3300035086 Bacteria 1161
112 Ga0373923_0103567 3300035111 Bacteria 1258
113 Ga0373936_0237103 3300035113 Bacteria 812
114 Ga0373953_0212938 3300035117 Bacteria 836
115 Ga0373954_0033791 3300035118 Bacteria 2366
116 Ga0373956_0017990 3300035119 Bacteria 2989
117 Ga0373956_0115437 3300035119 Bacteria 1252
118 Ga0373957_0150462 3300035120 Unclassified 955
119 Ga0373943_0245756 3300035170 Bacteria 1004
120 Ga0373955_0015357 3300035172 Bacteria 3748
121 Ga0373955_0071990 3300035172 Bacteria 1935
122 Ga0316574_0248698 3300035398 Bacteria 1136
123 Ga0373931_0334147 3300035691 Bacteria 944
124 Ga0373927_0172164 3300035695 Bacteria 1419
125 Ga0373933_0004434 3300035724 Bacteria 7702
126 Ga0373933_0008860 3300035724 Bacteria 5485
127 Ga0373933_0159787 3300035724 Bacteria 1430
128 Ga0373933_0168331 3300035724 Bacteria 1394
129 Ga0373933_0205063 3300035724 Bacteria 1262
130 Ga0373947_0040634 3300035725 Bacteria 2771
131 Ga0373947_0097065 3300035725 Bacteria 1846
132 Ga0373947_0103628 3300035725 Bacteria 1791
133 Ga0373937_0021933 3300036401 Bacteria 5734
134 Ga0373937_0061807 3300036401 Bacteria 3443
135 Ga0373937_0113942 3300036401 Bacteria 2516
136 Ga0316584_0259688 3300036712 Bacteria 1267
137 Ga0373925_0001756 3300037068 Bacteria 18130
138 Ga0373925_0036245 3300037068 Bacteria 3640
139 Ga0373925_0171804 3300037068 Bacteria 1711
140 Ga0373925_0301628 3300037068 Bacteria 1293
141 Ga0373925_0540464 3300037068 Bacteria 958
142 Ga0436364_0063853 3300037853 Bacteria 28863
143 Ga0436364_0176391 3300037853 Bacteria 1601
144 Ga0436364_0694743 3300037853 Bacteria 61820
145 Ga0436364_0741967 3300037853 Bacteria 2007
146 Ga0436364_1494985 3300037853 Bacteria 27295
147 Ga0436365_0522331 3300039437 Bacteria 2080
148 Ga0436365_1076838 3300039437 Bacteria 2458
149 Ga0436360_0280711 3300039438 Bacteria 5163
150 Ga0436360_0485786 3300039438 Bacteria 1211
151 Ga0436361_0148058 3300039447 Bacteria 1573
152 Ga0436361_0198926 3300039447 Bacteria 1302
153 Ga0436361_0858312 3300039447 Bacteria 4368
154 Ga0436363_0047133 3300039450 Bacteria 1441
155 Ga0436363_0128924 3300039450 Bacteria 4200
156 Ga0436363_0286035 3300039450 Bacteria 4522
157 Ga0436363_0618108 3300039450 Bacteria 1557
158 Ga0436362_0238520 3300039453 Unclassified 1407
159 Ga0436362_0785255 3300039453 Bacteria 2846
160 Ga0436362_1149133 3300039453 Bacteria 3305
161 Ga0466963_0277090 3300044694 Bacteria 1179
162 Ga0466958_0212899 3300045836 Bacteria 1232
163 Ga0495592_0069276 3300046454 Bacteria 2572
164 Ga0495629_0197360 3300046459 Bacteria 1392
165 Ga0495629_0297968 3300046459 Bacteria 1105
166 Ga0495629_0355499 3300046459 Bacteria 999
167 Ga0495651_0003945 3300046462 Bacteria 11347
168 Ga0495651_0062942 3300046462 Bacteria 2837
169 Ga0495653_0379051 3300046463 Bacteria 904
170 Ga0495662_0017423 3300046476 Bacteria 3477
171 Ga0495608_0226443 3300046511 Bacteria 1171
172 Ga0495618_0150259 3300046514 Bacteria 1488
173 Ga0495618_0216392 3300046514 Bacteria 1210
174 Ga0495640_0158094 3300046533 Bacteria 1454
175 Ga0495640_0193091 3300046533 Bacteria 1293
176 Ga0495586_0018557 3300046535 Bacteria 3704
177 Ga0495586_0108762 3300046535 Bacteria 1542
178 Ga0495587_0036169 3300046536 Bacteria 2971
179 Ga0495587_0039709 3300046536 Bacteria 2815
180 Ga0495645_0281461 3300046543 Bacteria 1093
181 Ga0495667_0028841 3300046559 Bacteria 3738
182 Ga0495667_0060222 3300046559 Bacteria 2490
183 Ga0495667_0286126 3300046559 Bacteria 1046
184 Ga0495667_0536779 3300046559 Bacteria 731
185 Ga0495634_0060110 3300046642 Bacteria 2530
186 Ga0495635_0009069 3300046663 Bacteria 6942
187 Ga0495635_0106861 3300046663 Bacteria 1912
188 Ga0495635_0372158 3300046663 Bacteria 951
189 Ga0495657_0408363 3300046675 Bacteria 798
190 Ga0495599_0041781 3300046678 Bacteria 2878
191 Ga0495599_0073209 3300046678 Bacteria 2139
192 Ga0495599_0104128 3300046678 Bacteria 1768
193 Ga0495646_0031698 3300046680 Bacteria 3293
194 Ga0495658_0047933 3300046683 Bacteria 2408
195 Ga0495600_0045747 3300046809 Bacteria 2856
196 Ga0495674_0151492 3300047319 Bacteria 1944
197 Ga0495680_0026822 3300047322 Bacteria 4744
198 Ga0495680_0034140 3300047322 Bacteria 4113
199 Ga0495680_0063214 3300047322 Bacteria 2843
200 Ga0495675_0027677 3300047444 Bacteria 3613
201 Ga0495675_0029969 3300047444 Bacteria 3471
202 Ga0495602_0004338 3300048088 Bacteria 14783
203 Ga0495602_0309003 3300048088 Bacteria 1154
204 Ga0496104_0496970 3300048907 Bacteria 1131
205 Ga0496112_0074541 3300048915 Bacteria 3355
206 Ga0496113_0243036 3300048916 Bacteria 1436
207 Ga0496119_0005266 3300048922 Bacteria 12472
208 Ga0501073_0213853 3300049589 Bacteria 1332
209 nmdc:mga05p37_515_c1 3300050507 Bacteria 42751
210 nmdc:mga09592_1001_c1 3300050508 Bacteria 22401
211 nmdc:mga0qj67_223511_c1 3300050509 Bacteria 1528
212 nmdc:mga06r32_28_c1 3300050510 Bacteria 87379
213 nmdc:mga06r32_536743_c1 3300050510 Bacteria 1145
214 nmdc:mga08y16_124_c2 3300050511 Bacteria 38531
215 nmdc:mga08y16_32121_c1 3300050511 Bacteria 5520
216 nmdc:mga08x19_28799_c1 3300050514 Bacteria 3482
217 Ga0495601_0009963 3300053077 Bacteria 5633
218 Ga0495601_0021472 3300053077 Bacteria 3954
219 Ga0495601_0204590 3300053077 Bacteria 1290
220 Ga0495612_0003416 3300053078 Bacteria 6581
221 Ga0495612_0252940 3300053078 Bacteria 784
222 Ga0495595_0040342 3300053084 Bacteria 2133
223 Ga0495595_0064056 3300053084 Bacteria 1727
224 Ga0495595_0236973 3300053084 Bacteria 912
225 Ga0495619_0019078 3300053085 Bacteria 4357
226 Ga0495619_0024776 3300053085 Bacteria 3849
227 Ga0495619_0063224 3300053085 Bacteria 2465
228 Ga0495619_0198364 3300053085 Bacteria 1389
229 Ga0070707_100082976
230 Ga0070670_100297617
231 Ga0070680_100254234
232 Ga0070680_100363698
233 Ga0070669_100439794
234 Ga0070675_100100498
235 Ga0070671_100785414
236 Ga0070667_100187535
237 Ga0070714_100018622
238 Ga0070714_100038695
239 Ga0070714_100103530
240 Ga0070714_100405132
241 Ga0070713_100232451
242 Ga0070713_100571012
243 Ga0070710_10102262
244 Ga0070710_10223233
245 Ga0070711_100067993
246 Ga0070711_100099471
247 Ga0070711_100251298
248 Ga0070694_100030799
249 Ga0070708_100172221
250 Ga0070681_10055318
251 Ga0070681_10229034
252 Ga0070706_100027100
253 Ga0070706_100071002
254 Ga0070698_100001824
255 Ga0070698_100053951
256 Ga0070698_100071155
257 Ga0070698_100405095
258 Ga0070699_100046281
259 Ga0070679_100294258
260 Ga0070697_100288617
261 Ga0070696_100288882
262 Ga0068856_100057385
263 Ga0068863_100184849
264 Ga0081455_10294516
265 Ga0070717_10023906
266 Ga0070717_10027661
267 Ga0070717_10128124
268 Ga0070717_10165543
269 Ga0070712_100122472
270 Ga0070712_100200052
271 Ga0070712_100371665
272 Ga0075428_100001050
273 Ga0075430_100234894
274 Ga0075431_100000573
275 Ga0075429_100004793
276 Ga0075436_100104809
277 Ga0105240_10838634
278 Ga0111539_10000922
279 Ga0111539_10118481
280 Ga0111539_10149220
281 Ga0114129_10000529
282 Ga0105243_10496941
283 Ga0105248_10199449
284 Ga0105248_10669159
285 Ga0105249_10028070
286 Ga0099796_10163914
287 Ga0157375_10301712
288 Ga0182008_10086186
289 Ga0182008_10162889
290 Ga0157379_10288489
291 Ga0157379_10321671
292 Ga0182007_10083860
293 Ga0213873_10011278
294 Ga0213872_10056476
295 Ga0213874_10021446
296 Ga0213875_10007709
297 Ga0213875_10009571
298 Ga0207682_10244636
299 Ga0207699_10067592
300 Ga0207699_10175357
301 Ga0207699_10284950
302 Ga0207684_10036741
303 Ga0207707_10107413
304 Ga0207707_10190437
305 Ga0207693_10024296
306 Ga0207693_10482038
307 Ga0207663_10102971
308 Ga0207663_10242661
309 Ga0207646_10005315
310 Ga0207650_10413318
311 Ga0207659_10199245
312 Ga0207700_10102677
313 Ga0207700_10120629
314 Ga0207700_10314192
315 Ga0207664_10281821
316 Ga0207664_10672234
317 Ga0207665_10028030
318 Ga0207712_10097755
319 Ga0207658_10279815
320 Ga0207702_10254294
321 Ga0207702_10434022
322 Ga0207641_10107039
323 Ga0207641_10480793
324 Ga0207428_10001697
325 Ga0207428_10013840
326 Ga0268264_10256358
327 Ga0268264_10884802
328 Ga0265338_10028954
329 Ga0316576_10018121
330 Ga0316578_10076716
331 Ga0307413_10024326
332 Ga0307410_10010570
333 Ga0307406_10580482
334 Ga0307407_10058348
335 Ga0307409_100014290
336 Ga0307416_100036689
337 Ga0307411_10079626
338 Ga0373926_0016411
339 Ga0373934_0101769
340 Ga0373923_0103567
341 Ga0373936_0237103
342 Ga0373953_0212938
343 Ga0373954_0033791
344 Ga0373956_0017990
345 Ga0373956_0115437
346 Ga0373957_0150462
347 Ga0373943_0245756
348 Ga0373955_0015357
349 Ga0373955_0071990
350 Ga0316574_0248698
351 Ga0373931_0334147
352 Ga0373927_0172164
353 Ga0373933_0004434
354 Ga0373933_0008860
355 Ga0373933_0159787
356 Ga0373933_0168331
357 Ga0373933_0205063
358 Ga0373947_0040634
359 Ga0373947_0097065
360 Ga0373947_0103628
361 Ga0373937_0021933
362 Ga0373937_0061807
363 Ga0373937_0113942
364 Ga0316584_0259688
365 Ga0373925_0001756
366 Ga0373925_0036245
367 Ga0373925_0171804
368 Ga0373925_0301628
369 Ga0373925_0540464
370 Ga0436364_0063853
371 Ga0436364_0176391
372 Ga0436364_0694743
373 Ga0436364_0741967
374 Ga0436364_1494985
375 Ga0436365_0522331
376 Ga0436365_1076838
377 Ga0436360_0280711
378 Ga0436360_0485786
379 Ga0436361_0148058
380 Ga0436361_0198926
381 Ga0436361_0858312
382 Ga0436363_0047133
383 Ga0436363_0128924
384 Ga0436363_0286035
385 Ga0436363_0618108
386 Ga0436362_0238520
387 Ga0436362_0785255
388 Ga0436362_1149133
389 Ga0466963_0277090
390 Ga0466958_0212899
391 Ga0495592_0069276
392 Ga0495629_0197360
393 Ga0495629_0297968
394 Ga0495629_0355499
395 Ga0495651_0003945
396 Ga0495651_0062942
397 Ga0495653_0379051
398 Ga0495662_0017423
399 Ga0495608_0226443
400 Ga0495618_0150259
401 Ga0495618_0216392
402 Ga0495640_0158094
403 Ga0495640_0193091
404 Ga0495586_0018557
405 Ga0495586_0108762
406 Ga0495587_0036169
407 Ga0495587_0039709
408 Ga0495645_0281461
409 Ga0495667_0028841
410 Ga0495667_0060222
411 Ga0495667_0286126
412 Ga0495667_0536779
413 Ga0495634_0060110
414 Ga0495635_0009069
415 Ga0495635_0106861
416 Ga0495635_0372158
417 Ga0495657_0408363
418 Ga0495599_0041781
419 Ga0495599_0073209
420 Ga0495599_0104128
421 Ga0495646_0031698
422 Ga0495658_0047933
423 Ga0495600_0045747
424 Ga0495674_0151492
425 Ga0495680_0026822
426 Ga0495680_0034140
427 Ga0495680_0063214
428 Ga0495675_0027677
429 Ga0495675_0029969
430 Ga0495602_0004338
431 Ga0495602_0309003
432 Ga0496104_0496970
433 Ga0496112_0074541
434 Ga0496113_0243036
435 Ga0496119_0005266
436 Ga0501073_0213853
437 nmdc:mga05p37_515_c1
438 nmdc:mga09592_1001_c1
439 nmdc:mga0qj67_223511_c1
440 nmdc:mga06r32_28_c1
441 nmdc:mga06r32_536743_c1
442 nmdc:mga08y16_124_c2
443 nmdc:mga08y16_32121_c1
444 nmdc:mga08x19_28799_c1
445 Ga0495601_0009963
446 Ga0495601_0021472
447 Ga0495601_0204590
448 Ga0495612_0003416
449 Ga0495612_0252940
450 Ga0495595_0040342
451 Ga0495595_0064056
452 Ga0495595_0236973
453 Ga0495619_0019078
454 Ga0495619_0024776
455 Ga0495619_0063224
456 Ga0495619_0198364

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

47

130

0.92

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

56

131

0.89

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

164

245

0.88

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

51

135

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ecj-assembly1.cif.gz_B crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione 0.9811 1 200
6tah-assembly1.cif.gz_CAA crystal structure of a nu-class glutathione-s-transferase from pseudomonas aeruginosa pacs2 bound to glutathione 0.9809 1 200
5hfk-assembly1.cif.gz_B crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione 0.9799 1 200
3gx0-assembly1.cif.gz_A-2 crystal structure of gsh-dependent disulfide bond oxidoreductase 0.9769 1 200
4l8e-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit 0.9741 3 199
ID Description Score Start End Superfamily
4f0bB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9887 93 193 1.20.1050.10
4l8eA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9853 3 84 3.40.30.10
af_P77526_87_192_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9735 85 188 1.20.1050.10
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9733 1 82 3.40.30.10
4ecjB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9707 86 193 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A2P6G886-F1-model_v4 Thiol:disulfide oxidoreductase 0.9914 2 204
AF-A0A7C3VR01-F1-model_v4 GST C-terminal domain-containing protein 0.9878 65 202
AF-A0A381XSF4-F1-model_v4 GST N-terminal domain-containing protein 0.9861 1 205
AF-A0A348G006-F1-model_v4 Thiol:disulfide oxidoreductase 0.9851 2 208
AF-A0A382YSQ9-F1-model_v4 GST N-terminal domain-containing protein 0.9841 1 192

Map