F340695

General Info

Members Datasets Scaffolds Average Seq Length
228 149 456 900

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10015292|Ga0070709_100152923
Length 996
Sequence MLTGSEIRRKFLDFFVHKGHKEVHSSSLVPANDPTLLFTNAGMNQFKDVFLGLEKRDYSRATTSQKCVRAGGKHNDLENVGFTNRHHTFFEMLGNFSFGDYFKKDAIAYAWELITSPEWFGIAKDKLYVTVFNGEGGLQRDAEAYDLWAAQGVPKDRIFEMGLKDNFWQMGDTGPCXXXSEIYYDMGVASSDQGHADCAFPCDCGRYVEIWNLVFMQFDRDASGKLNPLPKPSIDTGMGLERTAAALQGVVSNYDTDLFTPLIKRAAELTGTSLTKELSKEAHTKSAASLRVIADHSRAATFLISDGVTPANDGRGYVLRKIIRRAIRHGRILGQKAPFLGHMVFAVRDVMVDAYPELNETASHVAGVVEAEERRFLHTLELGLDKLDGLLDESKLTSGKAAFQQLILEAQKDYDKSFSYVDEVTKAVPGITDQMWRDFATGKPDPLIAFVRQKIGPQLAAQIEPRLREMPVKRVEVNGEKAFKLYDTYGLPLDFMLDAARDAWMGFDQPGFDHAMEEQKSRARASWKGAAKQTANPAYQQLPKSEFEGYRQTRSDGCEVLAIIHNGQGVRELKAGESGEVILDHTPFYAEAGGQVGDRGWLYSDDHNTVVADVTGCYYPIQGVRAHQVVMKSTLRVGDRVDAVVNTDVRQATMRNHTATHLLHAGLREVLGKHVKQAGSLVAPGHLRFDFSHFAAVEDEELQDIEDIINKELLRNQKVATIVDVPIDVAVNEYHAMALFGEKYGDKVRVVRIGDFSTELCGGTHTGATGEIGLIKILKEGSVSSGVRRMEAITGEGSLRHFRMDHQLENVVSSFVASHPSKTAKGDGPPTSDSTADNETSFSPADALRAELEKKDAEIKRLTRELDQVRMKSASSSTANVGEKIKEVKGVKVLAHRVDNLERGQLRTLVDQLRDKIGSGVVILGSASNGNVALIVGVTKDLTSRVQAGKVIGPVAQKVGGKGGGRPDLAEAGGKDASALDSALDGAYGVVEEILG

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
64 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
65 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 0.44
Rhizosphere 93.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10015292 3300005434 Bacteria 4363
2 LJNas_1000591 3300000546 Bacteria 6248
3 Ga0065715_10003851 3300005293 Bacteria 4907
4 Ga0070658_10015311 3300005327 Bacteria 6138
5 Ga0070658_10017353 3300005327 Bacteria 5760
6 Ga0068869_100022361 3300005334 Bacteria 4356
7 Ga0070680_100020112 3300005336 Bacteria 5295
8 Ga0068868_100013988 3300005338 Bacteria 5902
9 Ga0070689_100026284 3300005340 Bacteria 4382
10 Ga0070709_10000563 3300005434 Bacteria 21656
11 Ga0070714_100000099 3300005435 Bacteria 73629
12 Ga0070714_100054654 3300005435 Bacteria 3411
13 Ga0070713_100000021 3300005436 Bacteria 107806
14 Ga0070713_100000203 3300005436 Bacteria 39626
15 Ga0070713_100016763 3300005436 Bacteria 5516
16 Ga0070713_100035879 3300005436 Bacteria 3996
17 Ga0070710_10007150 3300005437 Bacteria 5393
18 Ga0070711_100000077 3300005439 Bacteria 54563
19 Ga0070711_100002146 3300005439 Bacteria 11178
20 Ga0070711_100027355 3300005439 Bacteria 3744
21 Ga0070705_100000132 3300005440 Bacteria 43669
22 Ga0070694_100000521 3300005444 Bacteria 21231
23 Ga0070708_100009372 3300005445 Bacteria 7891
24 Ga0070708_100029952 3300005445 Bacteria 4699
25 Ga0070681_10000007 3300005458 Bacteria 159821
26 Ga0070681_10031900 3300005458 Bacteria 5289
27 Ga0070698_100002674 3300005471 Bacteria 19668
28 Ga0070698_100053596 3300005471 Bacteria 4098
29 Ga0070699_100002887 3300005518 Bacteria 15304
30 Ga0070699_100066253 3300005518 Bacteria 3135
31 Ga0070679_100031171 3300005530 Bacteria 5267
32 Ga0070697_100005458 3300005536 Bacteria 9799
33 Ga0070696_100024775 3300005546 Bacteria 4078
34 Ga0070704_100000982 3300005549 Bacteria 14516
35 Ga0068855_100013847 3300005563 Bacteria 9724
36 Ga0070664_100020200 3300005564 Bacteria 5484
37 Ga0068854_100002107 3300005578 Bacteria 12193
38 Ga0068856_100000693 3300005614 Bacteria 36529
39 Ga0068856_100007720 3300005614 Bacteria 10503
40 Ga0068859_100009725 3300005617 Bacteria 9711
41 Ga0068864_100042056 3300005618 Bacteria 3910
42 Ga0068860_100008376 3300005843 Bacteria 10297
43 Ga0068862_100027532 3300005844 Bacteria 4785
44 Ga0070717_10004377 3300006028 Bacteria 10194
45 Ga0070717_10013699 3300006028 Bacteria 6221
46 Ga0070716_100000126 3300006173 Bacteria 30270
47 Ga0070716_100000838 3300006173 Bacteria 13275
48 Ga0070712_100000425 3300006175 Bacteria 24222
49 Ga0070712_100000947 3300006175 Bacteria 17441
50 Ga0070712_100004373 3300006175 Bacteria 8717
51 Ga0070712_100020347 3300006175 Bacteria 4342
52 Ga0075367_10003566 3300006178 Bacteria 7447
53 Ga0097621_100047984 3300006237 Bacteria 3462
54 Ga0068871_100001080 3300006358 Bacteria 18294
55 Ga0075428_100000398 3300006844 Bacteria 43056
56 Ga0075428_100001188 3300006844 Bacteria 27845
57 Ga0075428_100043527 3300006844 Bacteria 4936
58 Ga0075428_100125383 3300006844 Bacteria 2794
59 Ga0075431_100008584 3300006847 Bacteria 10229
60 Ga0075431_100028002 3300006847 Bacteria 5784
61 Ga0075431_100047550 3300006847 Bacteria 4423
62 Ga0075433_10019618 3300006852 Bacteria 5636
63 Ga0075434_100046954 3300006871 Bacteria 4285
64 Ga0075429_100062342 3300006880 Bacteria 3249
65 Ga0075436_100001723 3300006914 Bacteria 14978
66 Ga0075436_100001844 3300006914 Bacteria 14535
67 Ga0097620_100009725 3300006931 Bacteria 9711
68 Ga0075435_100011460 3300007076 Bacteria 6525
69 Ga0105240_10054221 3300009093 Bacteria 5025
70 Ga0111539_10000775 3300009094 Bacteria 41523
71 Ga0111539_10015098 3300009094 Bacteria 9625
72 Ga0111539_10028264 3300009094 Bacteria 6844
73 Ga0114129_10000006 3300009147 Bacteria 157531
74 Ga0114129_10009213 3300009147 Bacteria 14077
75 Ga0114129_10017249 3300009147 Bacteria 10284
76 Ga0105237_10000257 3300009545 Bacteria 75116
77 Ga0105238_10043289 3300009551 Bacteria 4556
78 Ga0105239_10006663 3300010375 Bacteria 13351
79 Ga0105239_10021474 3300010375 Bacteria 7117
80 Ga0157373_10002496 3300013100 Bacteria 14015
81 Ga0157369_10000736 3300013105 Bacteria 42226
82 Ga0157369_10015765 3300013105 Bacteria 8516
83 Ga0157369_10033284 3300013105 Bacteria 5665
84 Ga0157374_10000722 3300013296 Bacteria 28854
85 Ga0157374_10023142 3300013296 Bacteria 5552
86 Ga0157374_10028181 3300013296 Bacteria 5071
87 Ga0157374_10051593 3300013296 Bacteria 3828
88 Ga0157378_10000201 3300013297 Bacteria 58196
89 Ga0157378_10000203 3300013297 Bacteria 57992
90 Ga0163162_10000147 3300013306 Bacteria 64948
91 Ga0157372_10009769 3300013307 Bacteria 10204
92 Ga0157372_10030424 3300013307 Bacteria 5908
93 Ga0157372_10101230 3300013307 Bacteria 3289
94 Ga0157375_10010122 3300013308 Bacteria 8291
95 Ga0163163_10000022 3300014325 Bacteria 187289
96 Ga0157379_10068364 3300014968 Bacteria 3176
97 Ga0157376_10010531 3300014969 Bacteria 6770
98 Ga0213872_10000886 3300021361 Bacteria 21586
99 Ga0213875_10007430 3300021388 Bacteria 5660
100 Ga0213871_10001766 3300021441 Bacteria 3760
101 Ga0224570_100447 3300022730 Bacteria 3239
102 Ga0228598_1000330 3300024227 Bacteria 9274
103 Ga0228598_1001741 3300024227 Bacteria 4759
104 Ga0207692_10004464 3300025898 Bacteria 5542
105 Ga0207647_10004327 3300025904 Bacteria 10527
106 Ga0207699_10012117 3300025906 Bacteria 4379
107 Ga0207707_10000058 3300025912 Bacteria 111904
108 Ga0207695_10040245 3300025913 Bacteria 5015
109 Ga0207671_10002728 3300025914 Bacteria 18465
110 Ga0207693_10000047 3300025915 Bacteria 100876
111 Ga0207693_10000050 3300025915 Bacteria 100076
112 Ga0207693_10002996 3300025915 Bacteria 14613
113 Ga0207693_10005279 3300025915 Bacteria 10802
114 Ga0207693_10029097 3300025915 Bacteria 4366
115 Ga0207649_10039899 3300025920 Bacteria 2850
116 Ga0207694_10012602 3300025924 Bacteria 6372
117 Ga0207687_10004969 3300025927 Bacteria 8814
118 Ga0207700_10000136 3300025928 Bacteria 43796
119 Ga0207700_10024490 3300025928 Bacteria 4178
120 Ga0207700_10031931 3300025928 Bacteria 3748
121 Ga0207664_10000282 3300025929 Bacteria 38631
122 Ga0207664_10011110 3300025929 Bacteria 6379
123 Ga0207706_10000938 3300025933 Bacteria 29806
124 Ga0207686_10034903 3300025934 Bacteria 3014
125 Ga0207704_10009097 3300025938 Bacteria 4776
126 Ga0207665_10000088 3300025939 Bacteria 60223
127 Ga0207665_10012607 3300025939 Bacteria 5556
128 Ga0207689_10000769 3300025942 Bacteria 30802
129 Ga0207661_10013454 3300025944 Bacteria 5977
130 Ga0207667_10028382 3300025949 Bacteria 6079
131 Ga0207668_10011807 3300025972 Bacteria 5323
132 Ga0207640_10003554 3300025981 Bacteria 8405
133 Ga0207677_10007915 3300026023 Bacteria 5910
134 Ga0207678_10025424 3300026067 Bacteria 5168
135 Ga0207702_10028128 3300026078 Bacteria 4671
136 Ga0207648_10024349 3300026089 Bacteria 5405
137 Ga0207674_10005164 3300026116 Bacteria 15565
138 Ga0207428_10000435 3300027907 Bacteria 51355
139 Ga0265356_1000143 3300028017 Bacteria 12736
140 Ga0265338_10001088 3300028800 Bacteria 45144
141 Ga0265338_10005486 3300028800 Bacteria 16537
142 Ga0265338_10010452 3300028800 Bacteria 10880
143 Ga0265324_10000041 3300029957 Bacteria 113679
144 Ga0265339_10003630 3300031249 Bacteria 10767
145 Ga0265316_10007966 3300031344 Bacteria 9904
146 Ga0316575_10001087 3300031665 Bacteria 8477
147 Ga0265314_10001730 3300031711 Bacteria 23665
148 Ga0265314_10006097 3300031711 Bacteria 10713
149 Ga0265314_10022266 3300031711 Bacteria 4856
150 Ga0373923_0006245 3300035111 Bacteria 4103
151 Ga0373945_0002920 3300035116 Bacteria 5372
152 Ga0373943_0000242 3300035170 Bacteria 22548
153 Ga0373924_0012704 3300035410 Bacteria 3151
154 Ga0373935_0002872 3300035692 Bacteria 9909
155 Ga0373935_0005389 3300035692 Bacteria 7536
156 Ga0373935_0005596 3300035692 Bacteria 7410
157 Ga0373927_0000240 3300035695 Bacteria 43006
158 Ga0373933_0012343 3300035724 Bacteria 4718
159 Ga0373947_0000384 3300035725 Bacteria 24915
160 Ga0373937_0015248 3300036401 Bacteria 6795
161 Ga0373925_0004916 3300037068 Bacteria 10048
162 Ga0373925_0056391 3300037068 Bacteria 2943
163 Ga0395899_0008818 3300037312 Bacteria 7762
164 Ga0395900_0000051 3300037418 Bacteria 224228
165 Ga0395900_0005182 3300037418 Bacteria 13684
166 Ga0395900_0026170 3300037418 Bacteria 5974
167 Ga0395900_0041097 3300037418 Bacteria 4768
168 Ga0395898_0080755 3300037466 Bacteria 3136
169 Ga0395905_0021887 3300037471 Bacteria 6046
170 Ga0395905_0046497 3300037471 Bacteria 4069
171 Ga0436364_0054089 3300037853 Bacteria 4532
172 Ga0436364_0441702 3300037853 Bacteria 7109
173 Ga0436364_0473919 3300037853 Bacteria 7916
174 Ga0436364_0510106 3300037853 Bacteria 33937
175 Ga0436360_1353299 3300039438 Bacteria 55854
176 Ga0436361_0424273 3300039447 Bacteria 91642
177 Ga0436363_1097442 3300039450 Bacteria 5667
178 Ga0439460_0005859 3300042461 Bacteria 3030
179 Ga0451577_0000028 3300042876 Bacteria 395361
180 Ga0453683_0001705 3300044673 Bacteria 18266
181 Ga0453684_0000120 3300044712 Bacteria 345098
182 Ga0453684_0000472 3300044712 Bacteria 159406
183 Ga0453684_0001149 3300044712 Bacteria 82600
184 Ga0453684_0011982 3300044712 Bacteria 14422
185 Ga0466970_0004880 3300044765 Bacteria 6624
186 Ga0451576_0014520 3300045051 Bacteria 8761
187 Ga0495650_0000071 3300046471 Bacteria 258374
188 Ga0495580_0002628 3300046472 Bacteria 15601
189 Ga0495580_0003599 3300046472 Bacteria 13139
190 Ga0495580_0003881 3300046472 Bacteria 12644
191 Ga0495580_0024793 3300046472 Bacteria 4386
192 Ga0495580_0034919 3300046472 Bacteria 3617
193 Ga0495582_0000543 3300046473 Bacteria 20828
194 Ga0495582_0012419 3300046473 Bacteria 4693
195 Ga0495624_0011435 3300046690 Bacteria 6098
196 Ga0495674_0021991 3300047319 Bacteria 5887
197 Ga0495674_0023970 3300047319 Bacteria 5614
198 Ga0495674_0077455 3300047319 Bacteria 2859
199 Ga0496104_0054832 3300048907 Bacteria 3768
200 Ga0496116_0005227 3300048919 Bacteria 12144
201 Ga0496122_0000019 3300048925 Bacteria 411199
202 Ga0496126_0001499 3300048929 Bacteria 36179
203 Ga0496126_0002509 3300048929 Bacteria 24575
204 Ga0496126_0022230 3300048929 Bacteria 6175
205 Ga0501034_0005014 3300049571 Bacteria 14557
206 Ga0501034_0022723 3300049571 Bacteria 6388
207 Ga0501046_0000002 3300049580 Bacteria 526908
208 Ga0501047_0100897 3300049581 Bacteria 2766
209 Ga0501070_0038823 3300049586 Bacteria 3973
210 Ga0501072_0025379 3300049588 Bacteria 4617
211 Ga0501075_0028450 3300049591 Bacteria 4126
212 Ga0501044_0008335 3300049823 Bacteria 11358
213 Ga0501044_0011006 3300049823 Bacteria 9819
214 Ga0501045_0037798 3300049824 Bacteria 3510
215 nmdc:mga05p37_25_c1 3300050507 Bacteria 116982
216 nmdc:mga06r32_1308_c1 3300050510 Bacteria 22471
217 nmdc:mga06r32_71012_c1 3300050510 Bacteria 3368
218 nmdc:mga08y16_12_c1 3300050511 Bacteria 438455
219 nmdc:mga08y16_1636_c1 3300050511 Bacteria 22691
220 nmdc:mga08y16_37535_c1 3300050511 Bacteria 5087
221 nmdc:mga08y16_99314_c1 3300050511 Bacteria 3031
222 nmdc:mga0n895_62643_c1 3300050512 Bacteria 3677
223 nmdc:mga0rr50_29908_c1 3300050513 Bacteria 3848
224 nmdc:mga0rr50_5008_c1 3300050513 Bacteria 7848
225 nmdc:mga08x19_1639_c1 3300050514 Bacteria 13824
226 nmdc:mga0a205_20682_c1 3300050515 Bacteria 6215
227 Ga0500568_0000392 3300053139 Bacteria 33395
228 Ga0501082_0024396 3300060353 Bacteria 5214
229 Ga0070709_10015292
230 LJNas_1000591
231 Ga0065715_10003851
232 Ga0070658_10015311
233 Ga0070658_10017353
234 Ga0068869_100022361
235 Ga0070680_100020112
236 Ga0068868_100013988
237 Ga0070689_100026284
238 Ga0070709_10000563
239 Ga0070714_100000099
240 Ga0070714_100054654
241 Ga0070713_100000021
242 Ga0070713_100000203
243 Ga0070713_100016763
244 Ga0070713_100035879
245 Ga0070710_10007150
246 Ga0070711_100000077
247 Ga0070711_100002146
248 Ga0070711_100027355
249 Ga0070705_100000132
250 Ga0070694_100000521
251 Ga0070708_100009372
252 Ga0070708_100029952
253 Ga0070681_10000007
254 Ga0070681_10031900
255 Ga0070698_100002674
256 Ga0070698_100053596
257 Ga0070699_100002887
258 Ga0070699_100066253
259 Ga0070679_100031171
260 Ga0070697_100005458
261 Ga0070696_100024775
262 Ga0070704_100000982
263 Ga0068855_100013847
264 Ga0070664_100020200
265 Ga0068854_100002107
266 Ga0068856_100000693
267 Ga0068856_100007720
268 Ga0068859_100009725
269 Ga0068864_100042056
270 Ga0068860_100008376
271 Ga0068862_100027532
272 Ga0070717_10004377
273 Ga0070717_10013699
274 Ga0070716_100000126
275 Ga0070716_100000838
276 Ga0070712_100000425
277 Ga0070712_100000947
278 Ga0070712_100004373
279 Ga0070712_100020347
280 Ga0075367_10003566
281 Ga0097621_100047984
282 Ga0068871_100001080
283 Ga0075428_100000398
284 Ga0075428_100001188
285 Ga0075428_100043527
286 Ga0075428_100125383
287 Ga0075431_100008584
288 Ga0075431_100028002
289 Ga0075431_100047550
290 Ga0075433_10019618
291 Ga0075434_100046954
292 Ga0075429_100062342
293 Ga0075436_100001723
294 Ga0075436_100001844
295 Ga0097620_100009725
296 Ga0075435_100011460
297 Ga0105240_10054221
298 Ga0111539_10000775
299 Ga0111539_10015098
300 Ga0111539_10028264
301 Ga0114129_10000006
302 Ga0114129_10009213
303 Ga0114129_10017249
304 Ga0105237_10000257
305 Ga0105238_10043289
306 Ga0105239_10006663
307 Ga0105239_10021474
308 Ga0157373_10002496
309 Ga0157369_10000736
310 Ga0157369_10015765
311 Ga0157369_10033284
312 Ga0157374_10000722
313 Ga0157374_10023142
314 Ga0157374_10028181
315 Ga0157374_10051593
316 Ga0157378_10000201
317 Ga0157378_10000203
318 Ga0163162_10000147
319 Ga0157372_10009769
320 Ga0157372_10030424
321 Ga0157372_10101230
322 Ga0157375_10010122
323 Ga0163163_10000022
324 Ga0157379_10068364
325 Ga0157376_10010531
326 Ga0213872_10000886
327 Ga0213875_10007430
328 Ga0213871_10001766
329 Ga0224570_100447
330 Ga0228598_1000330
331 Ga0228598_1001741
332 Ga0207692_10004464
333 Ga0207647_10004327
334 Ga0207699_10012117
335 Ga0207707_10000058
336 Ga0207695_10040245
337 Ga0207671_10002728
338 Ga0207693_10000047
339 Ga0207693_10000050
340 Ga0207693_10002996
341 Ga0207693_10005279
342 Ga0207693_10029097
343 Ga0207649_10039899
344 Ga0207694_10012602
345 Ga0207687_10004969
346 Ga0207700_10000136
347 Ga0207700_10024490
348 Ga0207700_10031931
349 Ga0207664_10000282
350 Ga0207664_10011110
351 Ga0207706_10000938
352 Ga0207686_10034903
353 Ga0207704_10009097
354 Ga0207665_10000088
355 Ga0207665_10012607
356 Ga0207689_10000769
357 Ga0207661_10013454
358 Ga0207667_10028382
359 Ga0207668_10011807
360 Ga0207640_10003554
361 Ga0207677_10007915
362 Ga0207678_10025424
363 Ga0207702_10028128
364 Ga0207648_10024349
365 Ga0207674_10005164
366 Ga0207428_10000435
367 Ga0265356_1000143
368 Ga0265338_10001088
369 Ga0265338_10005486
370 Ga0265338_10010452
371 Ga0265324_10000041
372 Ga0265339_10003630
373 Ga0265316_10007966
374 Ga0316575_10001087
375 Ga0265314_10001730
376 Ga0265314_10006097
377 Ga0265314_10022266
378 Ga0373923_0006245
379 Ga0373945_0002920
380 Ga0373943_0000242
381 Ga0373924_0012704
382 Ga0373935_0002872
383 Ga0373935_0005389
384 Ga0373935_0005596
385 Ga0373927_0000240
386 Ga0373933_0012343
387 Ga0373947_0000384
388 Ga0373937_0015248
389 Ga0373925_0004916
390 Ga0373925_0056391
391 Ga0395899_0008818
392 Ga0395900_0000051
393 Ga0395900_0005182
394 Ga0395900_0026170
395 Ga0395900_0041097
396 Ga0395898_0080755
397 Ga0395905_0021887
398 Ga0395905_0046497
399 Ga0436364_0054089
400 Ga0436364_0441702
401 Ga0436364_0473919
402 Ga0436364_0510106
403 Ga0436360_1353299
404 Ga0436361_0424273
405 Ga0436363_1097442
406 Ga0439460_0005859
407 Ga0451577_0000028
408 Ga0453683_0001705
409 Ga0453684_0000120
410 Ga0453684_0000472
411 Ga0453684_0001149
412 Ga0453684_0011982
413 Ga0466970_0004880
414 Ga0451576_0014520
415 Ga0495650_0000071
416 Ga0495580_0002628
417 Ga0495580_0003599
418 Ga0495580_0003881
419 Ga0495580_0024793
420 Ga0495580_0034919
421 Ga0495582_0000543
422 Ga0495582_0012419
423 Ga0495624_0011435
424 Ga0495674_0021991
425 Ga0495674_0023970
426 Ga0495674_0077455
427 Ga0496104_0054832
428 Ga0496116_0005227
429 Ga0496122_0000019
430 Ga0496126_0001499
431 Ga0496126_0002509
432 Ga0496126_0022230
433 Ga0501034_0005014
434 Ga0501034_0022723
435 Ga0501046_0000002
436 Ga0501047_0100897
437 Ga0501070_0038823
438 Ga0501072_0025379
439 Ga0501075_0028450
440 Ga0501044_0008335
441 Ga0501044_0011006
442 Ga0501045_0037798
443 nmdc:mga05p37_25_c1
444 nmdc:mga06r32_1308_c1
445 nmdc:mga06r32_71012_c1
446 nmdc:mga08y16_12_c1
447 nmdc:mga08y16_1636_c1
448 nmdc:mga08y16_37535_c1
449 nmdc:mga08y16_99314_c1
450 nmdc:mga0n895_62643_c1
451 nmdc:mga0rr50_29908_c1
452 nmdc:mga0rr50_5008_c1
453 nmdc:mga08x19_1639_c1
454 nmdc:mga0a205_20682_c1
455 Ga0500568_0000392
456 Ga0501082_0024396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07973

tRNA_SAD

Threonyl and Alanyl tRNA synthetase second additional domain

748

791

0.98

PF02272

DHHA1

DHHA1 domain

852

989

0.97

PF01411

tRNA-synt_2c

tRNA synthetases class II (A)

6

407

0.96

PF01411

tRNA-synt_2c

tRNA synthetases class II (A)

463

649

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g98-assembly2.cif.gz_B crystal structure of the c-ala domain from aquifex aeolicus alanyl-trna synthetase 0.9237 843 951
1v4p-assembly3.cif.gz_C crystal structure of alanyl-trna synthetase from pyrococcus horikoshii ot3 0.9177 612 753
3hxx-assembly1.cif.gz_A crystal structure of catalytic fragment of e. coli alars in complex with amppcp 0.907 1 486
3hxz-assembly1.cif.gz_A crystal structure of catalytic fragment of e. coli alars g237a in complex with alasa 0.9056 1 486
3hy1-assembly2.cif.gz_B crystal structure of catalytic fragment of e. coli alars g237a in complex with sersa 0.9012 1 484
ID Description Score Start End Superfamily
af_P00957_764_873_3.10.310.40 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.9631 843 951 3.10.310.40
af_K7KHC2_846_954_3.10.310.40 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.9569 852 948 3.10.310.40
af_P40825_614_789_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.9479 606 765 3.30.980.10
af_P00957_764_873_3.10.310.40 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.9463 843 951 3.10.310.40
af_Q2FXV9_766_874_3.10.310.40 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.9453 844 950 3.10.310.40
ID Description Score Start End GO Terms
AF-A0A534UVZ7-F1-model_v4 Alanine--tRNA ligase 0.9748 849 949 GO:0003676
GO:0016874
AF-A0A2C6M9X0-F1-model_v4 DHHA1 domain-containing protein 0.9738 842 955 GO:0002161
GO:0003723
GO:0004813
GO:0005524
GO:0005829
GO:0006419
AF-A0A3T1DJ53-F1-model_v4 deleted 0.9717 842 955
AF-A0A7Y2GVZ7-F1-model_v4 alanine--tRNA ligase (EC 6.1.1.7) 0.9705 2 173 GO:0000049
GO:0002161
GO:0004813
GO:0005524
GO:0005829
GO:0006419
AF-A0A7V7AHU3-F1-model_v4 Alanine--tRNA ligase 0.9677 852 954 GO:0003676
GO:0016874

Map