F340436

General Info

Members Datasets Scaffolds Average Seq Length
227 144 215 325

Family's Representative Sequence

Representative Sequence 3300053177|Ga0500636_0037376|Ga0500636_0037376_341_1333
Length 322
Sequence MIIRIFIPMETYDILIIGAGPIGLACGLAAKKAGLNYLIIEKGCLTNSLYNYPLYMTFFSTSEKLEIGGVPFVSISAKPIRPEALEYYRRVAVSNHLNTHLFEAVETVKQTNGSYTVTKHVIIATGFYDIPNMLNIPGEHLPKVNHYYKDPHFYAMQKVLVIGANNSSVDAALETYRKGADVTMVIREEGIGRRVKYWVKPDIENRISEGSIKAYTHSTVQSIREREVDILTPDGIVTLQNDFVLALTGYQPNFSFLEKAGIQLSEDEKKLPTYNPETMETNMSGIYLAGVVCGGMNTHVWFIENSRDHADKIIAHIKTTRY

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
4 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
5 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
6 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
7 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
8 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
9 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
10 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
11 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
12 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
64 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
90 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
91 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
92 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
102 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
105 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
106 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
125 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
126 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
129 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
133 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
134 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
135 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
136 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
139 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
140 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
144 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.27
Metatranscriptomes 0
Isolates 5.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.54
Nodule 0
Rhizoplane 0.88
Rhizosphere 73.13
Stem 0
Stem Tuber 0
Unclassified 11.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002427 3300001979 Bacteria 8462
2 JGI24739J22299_10008482 3300001989 Bacteria 3837
3 JGI25154J39366_1000047 3300002738 Bacteria 126449
4 JGI25153J46596_10005740 3300003215 Bacteria 6468
5 JGI25153J46596_10016030 3300003215 Bacteria 3023
6 rootH1_10006091 3300003316 Bacteria 3120
7 rootH1_10006091 3300003323 Bacteria 8013
8 rootH1_10058804 3300003316 Bacteria 3335
9 rootH2_10001558 3300003320 Bacteria 9795
10 rootH2_10015349 3300003320 Bacteria 24566
11 rootH2_10271063 3300003320 Bacteria 2400
12 rootL2_10066935 3300003322 Unclassified 2030
13 rootL2_10083224 3300003322 Bacteria 2640
14 rootL2_10328342 3300003322 Unclassified 1783
15 Ga0055528_1000882 3300003790 Bacteria 20299
16 Ga0055543_1016856 3300004625 Bacteria 1383
17 Ga0065165_1000190 3300005262 Bacteria 107377
18 Ga0065165_1030807 3300005262 Bacteria 1703
19 Ga0065704_10079143 3300005289 Bacteria 4247
20 Ga0070680_100000066 3300005336 Bacteria 55257
21 Ga0070682_100000455 3300005337 Bacteria 25816
22 Ga0068868_100174626 3300005338 Bacteria 1780
23 Ga0070660_100047744 3300005339 Bacteria 3286
24 Ga0070668_100041438 3300005347 Bacteria 3527
25 Ga0070667_100168712 3300005367 Bacteria 1931
26 Ga0070662_100271960 3300005457 Bacteria 1368
27 Ga0070681_10204649 3300005458 Bacteria 1891
28 Ga0070681_10324345 3300005458 Bacteria 1449
29 Ga0070679_100000973 3300005530 Bacteria 24934
30 Ga0068855_100004440 3300005563 Bacteria 17135
31 Ga0068855_100005197 3300005563 Bacteria 15879
32 Ga0068857_100001435 3300005577 Bacteria 18887
33 Ga0068857_100036700 3300005577 Bacteria 4343
34 Ga0068854_100078309 3300005578 Bacteria 2435
35 Ga0068856_100114111 3300005614 Bacteria 2701
36 Ga0068852_100000342 3300005616 Bacteria 31480
37 Ga0068852_100321383 3300005616 Bacteria 1503
38 Ga0068859_100470036 3300005617 Bacteria 1353
39 Ga0068861_100143961 3300005719 Bacteria 1949
40 Ga0068858_100298205 3300005842 Bacteria 1537
41 Ga0068860_100000060 3300005843 Bacteria 195631
42 Ga0068860_100068671 3300005843 Bacteria 3367
43 Ga0081540_1011975 3300005983 Bacteria 5750
44 Ga0075366_10093064 3300006195 Unclassified 1806
45 Ga0075366_10163847 3300006195 Bacteria 1348
46 Ga0075431_100011377 3300006847 Bacteria 8964
47 Ga0075429_100013085 3300006880 Bacteria 7197
48 Ga0097620_100470030 3300006931 Bacteria 1353
49 Ga0105240_10001336 3300009093 Bacteria 42397
50 Ga0105240_10002890 3300009093 Bacteria 27120
51 Ga0105240_10004786 3300009093 Bacteria 20421
52 Ga0105240_10004977 3300009093 Bacteria 19960
53 Ga0105240_10016576 3300009093 Bacteria 9969
54 Ga0105240_10173970 3300009093 Bacteria 2547
55 Ga0105240_10230661 3300009093 Bacteria 2152
56 Ga0111539_10086512 3300009094 Bacteria 3683
57 Ga0114129_10025061 3300009147 Bacteria 8453
58 Ga0105241_10000144 3300009174 Bacteria 50819
59 Ga0105241_10396320 3300009174 Bacteria 1210
60 Ga0105237_10000651 3300009545 Bacteria 48483
61 Ga0105237_10006210 3300009545 Bacteria 13323
62 Ga0105237_10038709 3300009545 Bacteria 4815
63 Ga0105238_10002965 3300009551 Bacteria 16945
64 Ga0105238_10008866 3300009551 Bacteria 10064
65 Ga0105238_10066986 3300009551 Bacteria 3592
66 Ga0105238_10095320 3300009551 Unclassified 2963
67 Ga0105239_10004216 3300010375 Bacteria 17268
68 Ga0105239_10004649 3300010375 Bacteria 16319
69 Ga0105239_10039968 3300010375 Bacteria 5138
70 Ga0157370_10006627 3300013104 Bacteria 12725
71 Ga0157370_10008346 3300013104 Bacteria 11172
72 Ga0157369_10011152 3300013105 Bacteria 10217
73 Ga0157374_10000007 3300013296 Bacteria 595643
74 Ga0157374_10151684 3300013296 Bacteria 2253
75 Ga0163162_10000213 3300013306 Bacteria 53744
76 Ga0163162_10000386 3300013306 Bacteria 40256
77 Ga0163162_10180628 3300013306 Bacteria 2236
78 Ga0157372_10000954 3300013307 Bacteria 31547
79 Ga0157372_10014521 3300013307 Bacteria 8429
80 Ga0157372_10055824 3300013307 Bacteria 4412
81 Ga0157372_10307877 3300013307 Bacteria 1844
82 Ga0157376_10002013 3300014969 Bacteria 13618
83 Ga0163161_10291061 3300017792 Bacteria 1284
84 Ga0209436_112575 3300025208 Bacteria 1431
85 Ga0209646_1000003 3300025246 Bacteria 1160860
86 Ga0209026_1000303 3300025250 Bacteria 53764
87 Ga0209564_1023791 3300025295 Bacteria 2114
88 Ga0209758_1002589 3300025297 Bacteria 18144
89 Ga0209758_1007517 3300025297 Bacteria 7386
90 Ga0209758_1017983 3300025297 Bacteria 3489
91 Ga0209050_1000136 3300025298 Bacteria 179113
92 Ga0207426_1000341 3300025302 Bacteria 87735
93 Ga0207426_1000655 3300025302 Bacteria 42458
94 Ga0207426_1000738 3300025302 Bacteria 37211
95 Ga0209257_1002231 3300025304 Bacteria 19906
96 Ga0207647_10012072 3300025904 Bacteria 6029
97 Ga0207654_10002008 3300025911 Bacteria 10463
98 Ga0207654_10015994 3300025911 Bacteria 3901
99 Ga0207654_10239285 3300025911 Bacteria 1212
100 Ga0207707_10000317 3300025912 Bacteria 50861
101 Ga0207695_10000170 3300025913 Bacteria 192469
102 Ga0207695_10001252 3300025913 Bacteria 43328
103 Ga0207695_10005660 3300025913 Bacteria 16495
104 Ga0207695_10010877 3300025913 Bacteria 11079
105 Ga0207695_10014637 3300025913 Bacteria 9277
106 Ga0207695_10039654 3300025913 Bacteria 5060
107 Ga0207695_10108716 3300025913 Bacteria 2756
108 Ga0207671_10007695 3300025914 Bacteria 9302
109 Ga0207671_10052047 3300025914 Bacteria 3034
110 Ga0207671_10076701 3300025914 Bacteria 2501
111 Ga0207671_10162202 3300025914 Unclassified 1732
112 Ga0207660_10001972 3300025917 Bacteria 13679
113 Ga0207652_10000456 3300025921 Bacteria 42137
114 Ga0207694_10010257 3300025924 Bacteria 7064
115 Ga0207694_10022798 3300025924 Bacteria 4749
116 Ga0207694_10071000 3300025924 Bacteria 2721
117 Ga0207694_10350556 3300025924 Bacteria 1222
118 Ga0207667_10005154 3300025949 Bacteria 15964
119 Ga0207667_10050854 3300025949 Bacteria 4371
120 Ga0207667_10061412 3300025949 Bacteria 3931
121 Ga0207640_10086756 3300025981 Bacteria 2156
122 Ga0207677_10118280 3300026023 Bacteria 1988
123 Ga0207639_10137234 3300026041 Bacteria 2033
124 Ga0207639_10158880 3300026041 Bacteria 1903
125 Ga0207702_10037601 3300026078 Bacteria 4052
126 Ga0207674_10002964 3300026116 Bacteria 21086
127 Ga0207674_10092816 3300026116 Bacteria 3008
128 Ga0207698_10058966 3300026142 Bacteria 2978
129 Ga0268264_10000109 3300028381 Bacteria 208477
130 Ga0268264_10014224 3300028381 Bacteria 6544
131 Ga0268264_10076245 3300028381 Bacteria 2852
132 Ga0307513_10058234 3300031456 Bacteria 4109
133 Ga0307509_10231311 3300031507 Bacteria 1651
134 Ga0307510_10087121 3300033180 Bacteria 2990
135 Ga0373925_0122373 3300037068 Bacteria 2021
136 Ga0451853_3961713 3300041512 Bacteria 3038
137 Ga0439449_0001224 3300042007 Bacteria 10075
138 Ga0439449_0042667 3300042007 Bacteria 1685
139 Ga0439457_010262 3300042014 Bacteria 2158
140 Ga0439462_0018707 3300042015 Bacteria 1800
141 Ga0439462_0043759 3300042015 Bacteria 1197
142 Ga0466972_0000013 3300044658 Bacteria 229345
143 Ga0466972_0001020 3300044658 Bacteria 13428
144 Ga0466972_0022726 3300044658 Bacteria 3121
145 Ga0466972_0031236 3300044658 Bacteria 2620
146 Ga0466961_0018040 3300044693 Bacteria 4538
147 Ga0453684_0092927 3300044712 Bacteria 3717
148 Ga0466968_0018657 3300044735 Bacteria 2784
149 Ga0466957_0001230 3300044842 Bacteria 13374
150 Ga0466959_0054639 3300045049 Bacteria 2917
151 Ga0495627_006134 3300046453 Bacteria 4741
152 Ga0495638_0156213 3300046460 Unclassified 1319
153 Ga0495648_0018142 3300046524 Bacteria 5000
154 Ga0495633_0000344 3300046558 Bacteria 51775
155 Ga0495625_0062667 3300046660 Bacteria 2628
156 Ga0495625_0144039 3300046660 Unclassified 1606
157 Ga0495649_0042877 3300046694 Bacteria 2471
158 Ga0495672_0015969 3300047320 Bacteria 5083
159 Ga0495672_0103775 3300047320 Unclassified 1537
160 Ga0495687_000014 3300047443 Bacteria 366896
161 Ga0495686_0000034 3300047472 Bacteria 325038
162 Ga0495686_0005149 3300047472 Bacteria 10420
163 Ga0495686_0024839 3300047472 Bacteria 3932
164 Ga0496101_0224308 3300048904 Bacteria 1459
165 Ga0496104_0465217 3300048907 Bacteria 1176
166 Ga0496121_0000010 3300048924 Bacteria 793488
167 Ga0496126_0006356 3300048929 Bacteria 13173
168 Ga0501032_0019012 3300049569 Bacteria 4807
169 Ga0501033_0127370 3300049570 Bacteria 1846
170 Ga0501034_0031601 3300049571 Bacteria 5378
171 Ga0501034_0045956 3300049571 Bacteria 4411
172 Ga0501034_0074393 3300049571 Bacteria 3405
173 Ga0501034_0384402 3300049571 Bacteria 1328
174 Ga0501034_0567544 3300049571 Bacteria 1043
175 Ga0501036_0010312 3300049572 Bacteria 7710
176 Ga0501038_0042289 3300049574 Unclassified 3968
177 Ga0501039_0055891 3300049575 Bacteria 3058
178 Ga0501043_0021088 3300049579 Bacteria 5108
179 Ga0501043_0065763 3300049579 Bacteria 2847
180 Ga0501047_0045084 3300049581 Bacteria 4262
181 Ga0501047_0059413 3300049581 Unclassified 3691
182 Ga0501047_0189478 3300049581 Bacteria 1921
183 Ga0501048_0134836 3300049582 Bacteria 1745
184 Ga0501067_0020451 3300049583 Bacteria 3664
185 Ga0501070_0133781 3300049586 Bacteria 2047
186 Ga0501073_0030294 3300049589 Bacteria 3863
187 Ga0501238_009706 3300049671 Bacteria 1278
188 Ga0501219_000385 3300049703 Bacteria 7399
189 Ga0501225_0000104 3300049705 Bacteria 26591
190 Ga0501225_0045569 3300049705 Bacteria 1215
191 Ga0501044_0006034 3300049823 Bacteria 13376
192 Ga0501044_0008528 3300049823 Bacteria 11230
193 Ga0501044_0259064 3300049823 Bacteria 1678
194 Ga0501284_00041 3300050005 Bacteria 50589
195 nmdc:mga0k408_104863_c1 3300050493 Unclassified 1669
196 nmdc:mga0k408_111523_c1 3300050493 Bacteria 1617
197 nmdc:mga0k408_37998_c1 3300050493 Bacteria 2764
198 nmdc:mga05p37_19037_c1 3300050507 Bacteria 8304
199 nmdc:mga05p37_89995_c1 3300050507 Bacteria 3782
200 nmdc:mga06r32_26442_c1 3300050510 Bacteria 4310
201 Ga0500644_0105120 3300053088 Bacteria 1079
202 Ga0500583_0000043 3300053092 Bacteria 81313
203 Ga0500583_0000936 3300053092 Bacteria 8306
204 Ga0500652_008803 3300053131 Bacteria 3381
205 Ga0500559_0033350 3300053136 Bacteria 2216
206 Ga0500568_0027970 3300053139 Bacteria 2354
207 Ga0500616_0073345 3300053153 Unclassified 1738
208 Ga0500622_0000987 3300053156 Bacteria 24103
209 Ga0500622_0014767 3300053156 Bacteria 4188
210 Ga0500633_0008350 3300053160 Bacteria 2666
211 Ga0500636_0037376 3300053177 Bacteria 2873
212 Ga0500636_0141692 3300053177 Bacteria 1330
213 Ga0501084_0000686 3300054114 Bacteria 25875
214 Ga0501082_0046764 3300060353 Bacteria 3729
215 Ga0466962_0019649 3300061719 Bacteria 3247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0567544 Ga0501034_0567544_15_929 304
2 3300050493 nmdc:mga0k408_111523_c1 nmdc:mga0k408_111523_c1_10_942 304
3 3300053136 Ga0500559_0033350 Ga0500559_0033350_644_1636 311
4 3300053177 Ga0500636_0037376 Ga0500636_0037376_341_1333 311
5 iso_pu_bacteria 2896109856 2896113708 313
6 iso_pu_bacteria 2929239360 2929244984 315
7 iso_pu_bacteria 2929921140 2929927244 315
8 iso_pu_bacteria 8003151029 8003151138 315
9 3300013296 Ga0157374_10151684 Ga0157374_101516841 316
10 3300013306 Ga0163162_10180628 Ga0163162_101806281 316
11 iso_pu_bacteria 2738541278 2738726294 316
12 iso_pu_bacteria 2818991460 2819680556 316
13 iso_pu_bacteria 2840677318 2840677683 316
14 iso_pu_bacteria 2883068021 2883071158 316
15 iso_pu_bacteria 2884791551 2884798019 316
16 iso_pu_bacteria 2896085136 2896085501 316
17 iso_pu_bacteria 2929177148 2929182850 316
18 iso_pu_bacteria 2945977869 2945978805 316
19 iso_pu_bacteria 2946013367 2946015329 316
20 3300005289 Ga0065704_10079143 Ga0065704_100791433 317
21 3300005347 Ga0070668_100041438 Ga0070668_1000414382 317
22 3300005719 Ga0068861_100143961 Ga0068861_1001439611 317
23 3300049571 Ga0501034_0031601 Ga0501034_0031601_1989_2957 318
24 3300049571 Ga0501034_0074393 Ga0501034_0074393_2077_3045 318
25 3300049581 Ga0501047_0189478 Ga0501047_0189478_776_1744 318
26 3300049823 Ga0501044_0259064 Ga0501044_0259064_287_1246 318
27 3300001979 JGI24740J21852_10002427 JGI24740J21852_100024274 319
28 3300001989 JGI24739J22299_10008482 JGI24739J22299_100084822 319
29 3300002738 JGI25154J39366_1000047 JGI25154J39366_1000047102 319
30 3300003215 JGI25153J46596_10005740 JGI25153J46596_100057405 319
31 3300003215 JGI25153J46596_10016030 JGI25153J46596_100160303 319
32 3300003316 rootH1_10006091 rootH1_100060912 319
33 3300003316 rootH1_10058804 rootH1_100588041 319
34 3300003320 rootH2_10001558 rootH2_100015589 319
35 3300003320 rootH2_10015349 rootH2_1001534916 319
36 3300003320 rootH2_10271063 rootH2_102710632 319
37 3300003322 rootL2_10066935 rootL2_100669353 319
38 3300003322 rootL2_10083224 rootL2_100832241 319
39 3300003322 rootL2_10328342 rootL2_103283422 319
40 3300003790 Ga0055528_1000882 Ga0055528_10008826 319
41 3300004625 Ga0055543_1016856 Ga0055543_10168562 319
42 3300005262 Ga0065165_1000190 Ga0065165_100019078 319
43 3300005262 Ga0065165_1030807 Ga0065165_10308072 319
44 3300005336 Ga0070680_100000066 Ga0070680_10000006619 319
45 3300005337 Ga0070682_100000455 Ga0070682_10000045510 319
46 3300005338 Ga0068868_100174626 Ga0068868_1001746262 319
47 3300005339 Ga0070660_100047744 Ga0070660_1000477441 319
48 3300005367 Ga0070667_100168712 Ga0070667_1001687122 319
49 3300005457 Ga0070662_100271960 Ga0070662_1002719601 319
50 3300005458 Ga0070681_10204649 Ga0070681_102046492 319
51 3300005458 Ga0070681_10324345 Ga0070681_103243452 319
52 3300005530 Ga0070679_100000973 Ga0070679_10000097310 319
53 3300005563 Ga0068855_100004440 Ga0068855_1000044409 319
54 3300005563 Ga0068855_100005197 Ga0068855_10000519716 319
55 3300005577 Ga0068857_100001435 Ga0068857_1000014353 319
56 3300005577 Ga0068857_100036700 Ga0068857_1000367003 319
57 3300005578 Ga0068854_100078309 Ga0068854_1000783092 319
58 3300005614 Ga0068856_100114111 Ga0068856_1001141112 319
59 3300005616 Ga0068852_100000342 Ga0068852_10000034216 319
60 3300005616 Ga0068852_100321383 Ga0068852_1003213832 319
61 3300005617 Ga0068859_100470036 Ga0068859_1004700362 319
62 3300005842 Ga0068858_100298205 Ga0068858_1002982052 319
63 3300005843 Ga0068860_100000060 Ga0068860_100000060161 319
64 3300005843 Ga0068860_100068671 Ga0068860_1000686712 319
65 3300005983 Ga0081540_1011975 Ga0081540_10119752 319
66 3300006195 Ga0075366_10093064 Ga0075366_100930642 319
67 3300006195 Ga0075366_10163847 Ga0075366_101638472 319
68 3300006847 Ga0075431_100011377 Ga0075431_1000113776 319
69 3300006880 Ga0075429_100013085 Ga0075429_1000130857 319
70 3300006931 Ga0097620_100470030 Ga0097620_1004700302 319
71 3300009093 Ga0105240_10001336 Ga0105240_1000133611 319
72 3300009093 Ga0105240_10002890 Ga0105240_1000289025 319
73 3300009093 Ga0105240_10004786 Ga0105240_1000478618 319
74 3300009093 Ga0105240_10004977 Ga0105240_1000497710 319
75 3300009093 Ga0105240_10016576 Ga0105240_100165768 319
76 3300009093 Ga0105240_10173970 Ga0105240_101739703 319
77 3300009093 Ga0105240_10230661 Ga0105240_102306612 319
78 3300009094 Ga0111539_10086512 Ga0111539_100865123 319
79 3300009147 Ga0114129_10025061 Ga0114129_100250617 319
80 3300009174 Ga0105241_10000144 Ga0105241_1000014410 319
81 3300009174 Ga0105241_10396320 Ga0105241_103963201 319
82 3300009545 Ga0105237_10000651 Ga0105237_1000065111 319
83 3300009545 Ga0105237_10006210 Ga0105237_1000621011 319
84 3300009545 Ga0105237_10038709 Ga0105237_100387092 319
85 3300009551 Ga0105238_10002965 Ga0105238_1000296514 319
86 3300009551 Ga0105238_10008866 Ga0105238_100088664 319
87 3300009551 Ga0105238_10066986 Ga0105238_100669864 319
88 3300009551 Ga0105238_10095320 Ga0105238_100953203 319
89 3300010375 Ga0105239_10004216 Ga0105239_1000421610 319
90 3300010375 Ga0105239_10004649 Ga0105239_1000464912 319
91 3300010375 Ga0105239_10039968 Ga0105239_100399683 319
92 3300013104 Ga0157370_10006627 Ga0157370_1000662711 319
93 3300013104 Ga0157370_10008346 Ga0157370_100083467 319
94 3300013105 Ga0157369_10011152 Ga0157369_100111527 319
95 3300013296 Ga0157374_10000007 Ga0157374_10000007186 319
96 3300013306 Ga0163162_10000213 Ga0163162_1000021318 319
97 3300013306 Ga0163162_10000386 Ga0163162_1000038626 319
98 3300013307 Ga0157372_10000954 Ga0157372_1000095412 319
99 3300013307 Ga0157372_10014521 Ga0157372_100145217 319
100 3300013307 Ga0157372_10055824 Ga0157372_100558244 319
101 3300013307 Ga0157372_10307877 Ga0157372_103078772 319
102 3300014969 Ga0157376_10002013 Ga0157376_1000201312 319
103 3300017792 Ga0163161_10291061 Ga0163161_102910612 319
104 3300025208 Ga0209436_112575 Ga0209436_1125752 319
105 3300025246 Ga0209646_1000003 Ga0209646_1000003888 319
106 3300025250 Ga0209026_1000303 Ga0209026_100030345 319
107 3300025295 Ga0209564_1023791 Ga0209564_10237912 319
108 3300025297 Ga0209758_1002589 Ga0209758_10025893 319
109 3300025297 Ga0209758_1007517 Ga0209758_10075175 319
110 3300025297 Ga0209758_1017983 Ga0209758_10179834 319
111 3300025298 Ga0209050_1000136 Ga0209050_100013642 319
112 3300025302 Ga0207426_1000341 Ga0207426_100034176 319
113 3300025302 Ga0207426_1000655 Ga0207426_10006552 319
114 3300025302 Ga0207426_1000738 Ga0207426_100073810 319
115 3300025304 Ga0209257_1002231 Ga0209257_10022316 319
116 3300025904 Ga0207647_10012072 Ga0207647_100120722 319
117 3300025911 Ga0207654_10002008 Ga0207654_100020081 319
118 3300025911 Ga0207654_10015994 Ga0207654_100159943 319
119 3300025911 Ga0207654_10239285 Ga0207654_102392851 319
120 3300025912 Ga0207707_10000317 Ga0207707_1000031737 319
121 3300025913 Ga0207695_10000170 Ga0207695_10000170148 319
122 3300025913 Ga0207695_10001252 Ga0207695_1000125218 319
123 3300025913 Ga0207695_10005660 Ga0207695_100056602 319
124 3300025913 Ga0207695_10010877 Ga0207695_1001087710 319
125 3300025913 Ga0207695_10014637 Ga0207695_100146378 319
126 3300025913 Ga0207695_10039654 Ga0207695_100396544 319
127 3300025913 Ga0207695_10108716 Ga0207695_101087162 319
128 3300025914 Ga0207671_10007695 Ga0207671_100076953 319
129 3300025914 Ga0207671_10052047 Ga0207671_100520473 319
130 3300025914 Ga0207671_10076701 Ga0207671_100767012 319
131 3300025914 Ga0207671_10162202 Ga0207671_101622022 319
132 3300025917 Ga0207660_10001972 Ga0207660_1000197212 319
133 3300025921 Ga0207652_10000456 Ga0207652_1000045623 319
134 3300025924 Ga0207694_10010257 Ga0207694_100102577 319
135 3300025924 Ga0207694_10022798 Ga0207694_100227984 319
136 3300025924 Ga0207694_10071000 Ga0207694_100710003 319
137 3300025924 Ga0207694_10350556 Ga0207694_103505561 319
138 3300025949 Ga0207667_10005154 Ga0207667_100051547 319
139 3300025949 Ga0207667_10050854 Ga0207667_100508542 319
140 3300025949 Ga0207667_10061412 Ga0207667_100614123 319
141 3300025981 Ga0207640_10086756 Ga0207640_100867562 319
142 3300026023 Ga0207677_10118280 Ga0207677_101182802 319
143 3300026041 Ga0207639_10137234 Ga0207639_101372341 319
144 3300026041 Ga0207639_10158880 Ga0207639_101588801 319
145 3300026078 Ga0207702_10037601 Ga0207702_100376012 319
146 3300026116 Ga0207674_10002964 Ga0207674_1000296416 319
147 3300026116 Ga0207674_10092816 Ga0207674_100928162 319
148 3300026142 Ga0207698_10058966 Ga0207698_100589662 319
149 3300028381 Ga0268264_10000109 Ga0268264_10000109125 319
150 3300028381 Ga0268264_10014224 Ga0268264_100142242 319
151 3300028381 Ga0268264_10076245 Ga0268264_100762452 319
152 3300031456 Ga0307513_10058234 Ga0307513_100582343 319
153 3300031507 Ga0307509_10231311 Ga0307509_102313112 319
154 3300033180 Ga0307510_10087121 Ga0307510_100871212 319
155 3300037068 Ga0373925_0122373 Ga0373925_0122373_441_1415 319
156 3300041512 Ga0451853_3961713 Ga0451853_3961713_1465_2457 319
157 3300042007 Ga0439449_0001224 Ga0439449_0001224_6687_7667 319
158 3300042007 Ga0439449_0042667 Ga0439449_0042667_374_1354 319
159 3300042014 Ga0439457_010262 Ga0439457_010262_482_1462 319
160 3300042015 Ga0439462_0018707 Ga0439462_0018707_470_1450 319
161 3300042015 Ga0439462_0043759 Ga0439462_0043759_134_1114 319
162 3300044658 Ga0466972_0000013 Ga0466972_0000013_161433_162413 319
163 3300044658 Ga0466972_0001020 Ga0466972_0001020_181_1161 319
164 3300044658 Ga0466972_0022726 Ga0466972_0022726_868_1836 319
165 3300044658 Ga0466972_0031236 Ga0466972_0031236_73_1047 319
166 3300044693 Ga0466961_0018040 Ga0466961_0018040_994_1962 319
167 3300044712 Ga0453684_0092927 Ga0453684_0092927_344_1309 319
168 3300044735 Ga0466968_0018657 Ga0466968_0018657_978_1952 319
169 3300044842 Ga0466957_0001230 Ga0466957_0001230_8973_9965 319
170 3300045049 Ga0466959_0054639 Ga0466959_0054639_637_1605 319
171 3300046453 Ga0495627_006134 Ga0495627_006134_703_1671 319
172 3300046460 Ga0495638_0156213 Ga0495638_0156213_294_1265 319
173 3300046524 Ga0495648_0018142 Ga0495648_0018142_2036_3007 319
174 3300046558 Ga0495633_0000344 Ga0495633_0000344_32666_33634 319
175 3300046660 Ga0495625_0062667 Ga0495625_0062667_362_1333 319
176 3300046660 Ga0495625_0144039 Ga0495625_0144039_136_1104 319
177 3300046694 Ga0495649_0042877 Ga0495649_0042877_987_1955 319
178 3300047320 Ga0495672_0015969 Ga0495672_0015969_3322_4293 319
179 3300047320 Ga0495672_0103775 Ga0495672_0103775_37_1059 319
180 3300047443 Ga0495687_000014 Ga0495687_000014_143768_144739 319
181 3300047472 Ga0495686_0000034 Ga0495686_0000034_216213_217217 319
182 3300047472 Ga0495686_0005149 Ga0495686_0005149_1604_2569 319
183 3300047472 Ga0495686_0024839 Ga0495686_0024839_2164_3129 319
184 3300048904 Ga0496101_0224308 Ga0496101_0224308_19_987 319
185 3300048907 Ga0496104_0465217 Ga0496104_0465217_87_1148 319
186 3300048924 Ga0496121_0000010 Ga0496121_0000010_766322_767287 319
187 3300048929 Ga0496126_0006356 Ga0496126_0006356_6421_7389 319
188 3300049569 Ga0501032_0019012 Ga0501032_0019012_3633_4619 319
189 3300049570 Ga0501033_0127370 Ga0501033_0127370_234_1202 319
190 3300049571 Ga0501034_0045956 Ga0501034_0045956_117_1079 319
191 3300049571 Ga0501034_0384402 Ga0501034_0384402_282_1286 319
192 3300049572 Ga0501036_0010312 Ga0501036_0010312_5978_6964 319
193 3300049574 Ga0501038_0042289 Ga0501038_0042289_2835_3821 319
194 3300049575 Ga0501039_0055891 Ga0501039_0055891_393_1379 319
195 3300049579 Ga0501043_0021088 Ga0501043_0021088_86_1072 319
196 3300049579 Ga0501043_0065763 Ga0501043_0065763_781_1785 319
197 3300049581 Ga0501047_0045084 Ga0501047_0045084_1352_2338 319
198 3300049581 Ga0501047_0059413 Ga0501047_0059413_167_1153 319
199 3300049582 Ga0501048_0134836 Ga0501048_0134836_305_1369 319
200 3300049583 Ga0501067_0020451 Ga0501067_0020451_1729_2841 319
201 3300049586 Ga0501070_0133781 Ga0501070_0133781_58_1170 319
202 3300049589 Ga0501073_0030294 Ga0501073_0030294_2138_3145 319
203 3300049671 Ga0501238_009706 Ga0501238_009706_244_1218 319
204 3300049703 Ga0501219_000385 Ga0501219_000385_1490_2464 319
205 3300049705 Ga0501225_0000104 Ga0501225_0000104_929_1909 319
206 3300049705 Ga0501225_0045569 Ga0501225_0045569_150_1124 319
207 3300049823 Ga0501044_0006034 Ga0501044_0006034_7201_8187 319
208 3300049823 Ga0501044_0008528 Ga0501044_0008528_6183_7175 319
209 3300050005 Ga0501284_00041 Ga0501284_00041_29861_30835 319
210 3300050493 nmdc:mga0k408_104863_c1 nmdc:mga0k408_104863_c1_108_1073 319
211 3300050493 nmdc:mga0k408_37998_c1 nmdc:mga0k408_37998_c1_1298_2296 319
212 3300050507 nmdc:mga05p37_19037_c1 nmdc:mga05p37_19037_c1_4057_5046 319
213 3300050507 nmdc:mga05p37_89995_c1 nmdc:mga05p37_89995_c1_68_1060 319
214 3300050510 nmdc:mga06r32_26442_c1 nmdc:mga06r32_26442_c1_28_1020 319
215 3300053088 Ga0500644_0105120 Ga0500644_0105120_11_991 319
216 3300053092 Ga0500583_0000043 Ga0500583_0000043_15231_16304 319
217 3300053092 Ga0500583_0000936 Ga0500583_0000936_4028_5008 319
218 3300053131 Ga0500652_008803 Ga0500652_008803_2337_3296 319
219 3300053139 Ga0500568_0027970 Ga0500568_0027970_839_1813 319
220 3300053153 Ga0500616_0073345 Ga0500616_0073345_175_1155 319
221 3300053156 Ga0500622_0000987 Ga0500622_0000987_18556_19524 319
222 3300053156 Ga0500622_0014767 Ga0500622_0014767_797_1768 319
223 3300053160 Ga0500633_0008350 Ga0500633_0008350_1396_2388 319
224 3300053177 Ga0500636_0141692 Ga0500636_0141692_283_1266 319
225 3300054114 Ga0501084_0000686 Ga0501084_0000686_22117_23124 319
226 3300060353 Ga0501082_0046764 Ga0501082_0046764_2216_3223 319
227 3300061719 Ga0466962_0019649 Ga0466962_0019649_2024_2992 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

15

290

0.94

PF00890

FAD_binding_2

FAD binding domain

13

51

0.93

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

12

310

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a76-assembly1.cif.gz_C bacillithiol disulfide reductase bdr (ypda) from bacillus cereus 0.9205 1 317
7a7b-assembly1.cif.gz_D bacillithiol disulfide reductase bdr (ypda) from staphylococcus aureus 0.9169 1 318
7a76-assembly1.cif.gz_C bacillithiol disulfide reductase bdr (ypda) from bacillus cereus 0.9123 1 317
7a7b-assembly1.cif.gz_D bacillithiol disulfide reductase bdr (ypda) from staphylococcus aureus 0.9115 1 318
3hdq-assembly1.cif.gz_A crystal structure of udp-galactopyranose mutase (oxidized form) in complex with substrate 0.9085 1 36
ID Description Score Start End Superfamily
af_Q2FYF3_156_325_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9375 157 318 3.50.50.60
af_P9WP27_7_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9314 5 35 3.40.50.720
5nc8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9117 5 35 3.40.50.720
af_P45522_400_562_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9111 3 34 3.40.50.720
4rcnA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9086 5 33 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A658JIW6-F1-model_v4 deleted 0.971 138 318
AF-A0A3C0ZNU9-F1-model_v4 YpdA family bacillithiol disulfide reductase 0.9612 95 318 GO:0016491
AF-A0A519RS63-F1-model_v4 YpdA family bacillithiol disulfide reductase 0.9611 101 318 GO:0016491
AF-A0A7C5I8L1-F1-model_v4 YpdA family bacillithiol disulfide reductase 0.9605 110 319
AF-A0A7C5R3F2-F1-model_v4 YpdA family bacillithiol disulfide reductase 0.9597 95 318 GO:0016491

Feature Viewer

pLDDT pTM Quality
86.03 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map