F340423

General Info

Members Datasets Scaffolds Average Seq Length
227 145 454 329

Family's Representative Sequence

Representative Sequence 3300053103|Ga0500555_019962|Ga0500555_019962_77_1291
Length 404
Sequence MYRFAISSIFLFITIFLGVQQFNKPNSTTQHFDSNPAMASVKSATKLMRAVVIHEAGGPEVLKLETRPIPVPKAGDVLIRVRAFGINRSEMFTRQGHSPSVKFPRILGIEAAGVVEEAPGGEFKPGDIVATAMGGMGRDFDGGYAEYTSVPASQVQVVKTKVSWELLGAAPEMLQTAWGALFKTLQIKKGDKLLIRGGTTSVGLAAAAIAKKHGVFVAATTRRADREEFLRDRGIDDVFIDNGTISEEVQKRYPDGFDKVLDVSYDEFSSQLRINGCDKPIIPEALSKHSELIQVIQLVGVTTMEDSMKSLKLPGITAMVGIVGGKWTAENFTPNMVIPTGRYLSTYGGSAEDFVSTPLDELLQDILDGTMDVPVGKVFQLEDIVEAHKCMDANEANGKIVVLT

Samples

Sample ID Description Type Environment
1 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
11 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
12 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
13 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
14 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
15 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
20 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
21 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
22 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
25 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
26 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
27 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
28 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
29 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
30 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
31 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
32 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
33 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
34 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
35 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
36 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
37 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
38 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
39 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
40 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
41 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
42 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
43 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
44 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
45 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
46 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
47 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
48 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
49 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
50 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
51 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
52 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
53 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
54 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
55 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
56 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
57 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
58 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
59 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
60 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
61 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
62 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
63 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
64 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
65 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
66 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
67 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
68 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
69 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
70 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
71 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
72 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
73 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
74 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
75 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
76 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
77 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
78 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
79 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
80 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
81 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
82 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
83 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
84 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
85 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
86 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
87 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
88 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
89 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
90 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
91 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
92 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
93 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
94 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
95 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
96 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
97 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
98 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
99 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
100 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
101 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
102 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
103 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
104 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
105 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
106 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
107 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
108 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
109 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
110 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
111 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
112 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
113 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
114 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
115 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
116 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
117 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
118 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
119 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
120 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
122 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
123 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
124 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
125 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
126 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
127 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
128 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
129 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
130 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
131 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
132 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
133 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
134 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
135 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
136 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
137 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
138 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
139 2643221611 Acidovorax sp. Root219 Isolate Unclassified
140 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
141 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
142 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
143 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
144 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
145 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.04
Metatranscriptomes 0
Isolates 3.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 43.17
Nodule 0.44
Rhizoplane 6.61
Rhizosphere 38.33
Stem 0
Stem Tuber 0
Unclassified 7.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500555_019962 3300053103 Eukaryota 1931
2 rootH2_10183537 3300003320 Bacteria 1911
3 rootL2_10012421 3300003322 Bacteria 14141
4 JGI25160J50197_1000017 3300003354 Bacteria 246175
5 Ga0065165_1000221 3300005262 Bacteria 99737
6 Ga0070666_10310611 3300005335 Bacteria 1124
7 Ga0070667_100067268 3300005367 Bacteria 3045
8 Ga0070678_100181986 3300005456 Bacteria 1721
9 Ga0075365_10063666 3300006038 Bacteria 2470
10 Ga0075363_100031300 3300006048 Bacteria 2758
11 Ga0075364_10000590 3300006051 Bacteria 18745
12 Ga0075364_10009148 3300006051 Bacteria 5933
13 Ga0075432_10007766 3300006058 Bacteria 3656
14 Ga0075362_10044617 3300006177 Bacteria 1967
15 Ga0075369_10005889 3300006186 Bacteria 4607
16 Ga0075369_10028009 3300006186 Bacteria 2359
17 Ga0075366_10000691 3300006195 Bacteria 15970
18 Ga0075366_10140069 3300006195 Bacteria 1462
19 Ga0075370_10006750 3300006353 Bacteria 5795
20 Ga0075370_10009962 3300006353 Bacteria 4953
21 Ga0075370_10132444 3300006353 Bacteria 1455
22 Ga0099794_10016313 3300007265 Bacteria 3290
23 Ga0105240_10077201 3300009093 Bacteria 4104
24 Ga0163161_10096521 3300017792 Bacteria 2194
25 Ga0209130_1003556 3300025284 Bacteria 6521
26 Ga0207426_1000107 3300025302 Bacteria 242623
27 Ga0207682_10087262 3300025893 Bacteria 1347
28 Ga0207683_10086727 3300026121 Bacteria 2783
29 Ga0307517_10000160 3300028786 Bacteria 108370
30 Ga0307515_10104346 3300028794 Bacteria 3388
31 Ga0307515_10109042 3300028794 Bacteria 3256
32 Ga0307515_10153072 3300028794 Eukaryota 2399
33 Ga0307515_10172894 3300028794 Bacteria 2144
34 Ga0307509_10001515 3300031507 Bacteria 39177
35 Ga0307509_10148783 3300031507 Eukaryota 2262
36 Ga0307510_10037518 3300033180 Bacteria 5375
37 Ga0373934_0018617 3300035086 Bacteria 2658
38 Ga0373927_0043398 3300035695 Bacteria 2911
39 Ga0436364_0457395 3300037853 Bacteria 5977
40 Ga0436364_1110016 3300037853 Bacteria 1922
41 Ga0436365_1419734 3300039437 Bacteria 2744
42 Ga0436360_0860292 3300039438 Bacteria 3248
43 Ga0436361_0252068 3300039447 Bacteria 11611
44 Ga0495627_000746 3300046453 Bacteria 24358
45 Ga0495592_0000175 3300046454 Bacteria 56416
46 Ga0495603_0001927 3300046455 Bacteria 12231
47 Ga0495638_0000074 3300046460 Bacteria 163843
48 Ga0495638_0007741 3300046460 Bacteria 7677
49 Ga0495650_0000130 3300046471 Bacteria 175669
50 Ga0495650_0003188 3300046471 Bacteria 12219
51 Ga0495650_0022566 3300046471 Bacteria 3016
52 Ga0495580_0000829 3300046472 Bacteria 26798
53 Ga0495594_0113933 3300046499 Eukaryota 1526
54 Ga0495607_0000073 3300046501 Bacteria 100053
55 Ga0495583_0000275 3300046506 Bacteria 83178
56 Ga0495583_0018500 3300046506 Bacteria 3666
57 Ga0495583_0040544 3300046506 Unclassified 2187
58 Ga0495606_0067750 3300046507 Bacteria 2259
59 Ga0495610_0003668 3300046512 Bacteria 11807
60 Ga0495610_0005787 3300046512 Bacteria 8700
61 Ga0495610_0061452 3300046512 Bacteria 1785
62 Ga0495616_0041766 3300046513 Bacteria 2338
63 Ga0495620_0004589 3300046515 Bacteria 7769
64 Ga0495632_0003756 3300046519 Bacteria 10622
65 Ga0495632_0010865 3300046519 Bacteria 5355
66 Ga0495632_0081445 3300046519 Unclassified 1543
67 Ga0495637_0045948 3300046520 Unclassified 1849
68 Ga0495643_0000806 3300046522 Bacteria 34503
69 Ga0495643_0020101 3300046522 Plasmid 3857
70 Ga0495643_0074562 3300046522 Bacteria 1777
71 Ga0495648_0000050 3300046524 Bacteria 163843
72 Ga0495648_0000736 3300046524 Bacteria 34882
73 Ga0495648_0023882 3300046524 Bacteria 4176
74 Ga0495648_0122221 3300046524 Bacteria 1397
75 Ga0495666_0072096 3300046526 Bacteria 1641
76 Ga0495666_0163227 3300046526 Bacteria 1032
77 Ga0495642_0025435 3300046528 Unclassified 2347
78 Ga0495654_0006780 3300046530 Bacteria 6473
79 Ga0495654_0019614 3300046530 Bacteria 3537
80 Ga0495640_0004160 3300046533 Eukaryota 11574
81 Ga0495609_0010472 3300046538 Bacteria 4445
82 Ga0495597_0030494 3300046542 Bacteria 2458
83 Ga0495622_0013128 3300046557 Plasmid 3844
84 Ga0495622_0034687 3300046557 Bacteria 2354
85 Ga0495633_0033375 3300046558 Bacteria 2482
86 Ga0495667_0026249 3300046559 Bacteria 3924
87 Ga0495668_0004446 3300046616 Bacteria 9947
88 Ga0495668_0012481 3300046616 Bacteria 5037
89 Ga0495611_0045860 3300046648 Bacteria 1959
90 Ga0495625_0002627 3300046660 Bacteria 19192
91 Ga0495625_0008763 3300046660 Bacteria 8573
92 Ga0495625_0025369 3300046660 Bacteria 4497
93 Ga0495625_0078098 3300046660 Bacteria 2311
94 Ga0495661_0068161 3300046665 Bacteria 2088
95 Ga0495670_0000160 3300046691 Bacteria 29343
96 Ga0495671_0000096 3300046692 Bacteria 82384
97 Ga0495671_0007382 3300046692 Bacteria 6272
98 Ga0495671_0116255 3300046692 Unclassified 1306
99 Ga0495674_0014069 3300047319 Bacteria 7501
100 Ga0495672_0031293 3300047320 Bacteria 3323
101 Ga0495683_0065656 3300047323 Bacteria 1789
102 Ga0495687_026645 3300047443 Bacteria 2717
103 Ga0495673_0000157 3300047469 Bacteria 117733
104 Ga0495673_0009442 3300047469 Bacteria 5400
105 Ga0495673_0046211 3300047469 Unclassified 1931
106 Ga0495673_0075926 3300047469 Bacteria 1402
107 Ga0495681_0001103 3300047470 Bacteria 20503
108 Ga0495686_0001463 3300047472 Bacteria 25718
109 Ga0495686_0166975 3300047472 Bacteria 1282
110 Ga0495615_0000012 3300048090 Bacteria 64858
111 Ga0495626_0001536 3300048091 Bacteria 18118
112 Ga0495626_0080955 3300048091 Bacteria 1443
113 Ga0496100_0000341 3300048903 Bacteria 22744
114 Ga0496100_0011104 3300048903 Bacteria 5113
115 Ga0496101_0000658 3300048904 Bacteria 20790
116 Ga0496101_0036799 3300048904 Bacteria 3468
117 Ga0496102_0001037 3300048905 Bacteria 25829
118 Ga0496102_0015608 3300048905 Bacteria 6616
119 Ga0496103_0000249 3300048906 Bacteria 52092
120 Ga0496104_0005105 3300048907 Bacteria 11457
121 Ga0496104_0215952 3300048907 Bacteria 1829
122 Ga0496105_0005773 3300048908 Bacteria 9437
123 Ga0496105_0016960 3300048908 Bacteria 5828
124 Ga0496106_0096188 3300048909 Bacteria 2291
125 Ga0496106_0098604 3300048909 Bacteria 2264
126 Ga0496110_0003952 3300048913 Bacteria 11401
127 Ga0496114_0033872 3300048917 Bacteria 4211
128 Ga0496117_0002550 3300048920 Bacteria 22699
129 Ga0496118_0002774 3300048921 Bacteria 22936
130 Ga0496119_0009403 3300048922 Bacteria 8397
131 Ga0496119_0076300 3300048922 Bacteria 1945
132 Ga0496121_0001331 3300048924 Bacteria 42256
133 Ga0496121_0010430 3300048924 Bacteria 10482
134 Ga0496123_0082124 3300048926 Bacteria 1955
135 Ga0495682_0043986 3300049460 Unclassified 1635
136 Ga0495682_0044475 3300049460 Bacteria 1624
137 Ga0501241_005964 3300049758 Bacteria 2260
138 nmdc:mga03683_2376_c1 3300050489 Bacteria 5835
139 nmdc:mga03n38_58402_c1 3300050490 Bacteria 1748
140 nmdc:mga00v17_500_c2 3300050491 Bacteria 10165
141 nmdc:mga0k408_43115_c1 3300050493 Bacteria 2599
142 nmdc:mga07m45_13782_c1 3300050496 Bacteria 4294
143 nmdc:mga07m45_48196_c1 3300050496 Unclassified 2396
144 nmdc:mga0sz30_2997_c1 3300050516 Bacteria 3550
145 Ga0500643_000674 3300053087 Bacteria 22864
146 Ga0500643_000823 3300053087 Bacteria 20041
147 Ga0500643_002239 3300053087 Bacteria 10200
148 Ga0500643_010747 3300053087 Bacteria 3385
149 Ga0500644_0000642 3300053088 Bacteria 13006
150 Ga0500581_016934 3300053089 Bacteria 3655
151 Ga0500583_0045654 3300053092 Unclassified 2013
152 Ga0500651_0002956 3300053093 Bacteria 9156
153 Ga0500566_0002826 3300053094 Bacteria 10332
154 Ga0500556_0000005 3300053104 Bacteria 581135
155 Ga0500556_0000057 3300053104 Bacteria 115093
156 Ga0500556_0000280 3300053104 Bacteria 40057
157 Ga0500556_0000957 3300053104 Bacteria 15494
158 Ga0500562_000240 3300053108 Bacteria 14264
159 Ga0500562_002422 3300053108 Bacteria 4681
160 Ga0500562_020053 3300053108 Bacteria 1735
161 Ga0500593_008122 3300053117 Bacteria 4303
162 Ga0500594_0000881 3300053118 Bacteria 6426
163 Ga0500594_0001950 3300053118 Bacteria 4462
164 Ga0500595_001508 3300053119 Bacteria 12371
165 Ga0500607_010545 3300053121 Bacteria 5491
166 Ga0500608_000446 3300053122 Bacteria 15536
167 Ga0500608_002055 3300053122 Bacteria 7211
168 Ga0500608_154203 3300053122 Bacteria 1003
169 Ga0500614_053578 3300053123 Bacteria 1066
170 Ga0500618_009968 3300053125 Bacteria 2568
171 Ga0500618_010513 3300053125 Unclassified 2483
172 Ga0500642_0000006 3300053130 Bacteria 350064
173 Ga0500642_0000694 3300053130 Bacteria 9964
174 Ga0500655_000041 3300053133 Bacteria 35332
175 Ga0500659_0054601 3300053135 Eukaryota 2144
176 Ga0500559_0000067 3300053136 Bacteria 83330
177 Ga0500559_0000118 3300053136 Bacteria 62436
178 Ga0500559_0000166 3300053136 Bacteria 51944
179 Ga0500559_0002181 3300053136 Bacteria 10347
180 Ga0500559_0002743 3300053136 Bacteria 8935
181 Ga0500559_0003393 3300053136 Bacteria 7852
182 Ga0500559_0004137 3300053136 Bacteria 6960
183 Ga0500559_0006629 3300053136 Bacteria 5211
184 Ga0500559_0006941 3300053136 Bacteria 5064
185 Ga0500559_0109654 3300053136 Unclassified 1278
186 Ga0500559_0122061 3300053136 Bacteria 1212
187 Ga0500564_000174 3300053138 Bacteria 17089
188 Ga0500564_030622 3300053138 Unclassified 2479
189 Ga0500573_0002223 3300053140 Bacteria 9605
190 Ga0500577_0024871 3300053142 Unclassified 2019
191 Ga0500586_011561 3300053145 Bacteria 2534
192 Ga0500590_001425 3300053148 Bacteria 9838
193 Ga0500616_0011275 3300053153 Bacteria 5292
194 Ga0500616_0020185 3300053153 Unclassified 3746
195 Ga0500619_038250 3300053154 Unclassified 1503
196 Ga0500622_0000060 3300053156 Bacteria 133737
197 Ga0500622_0000217 3300053156 Bacteria 60901
198 Ga0500622_0003537 3300053156 Bacteria 10354
199 Ga0500624_000039 3300053157 Bacteria 93415
200 Ga0500624_000080 3300053157 Bacteria 50463
201 Ga0500627_0026400 3300053158 Bacteria 2397
202 Ga0500633_0045593 3300053160 Bacteria 1494
203 Ga0500634_0035569 3300053161 Unclassified 2713
204 Ga0500638_023090 3300053162 Unclassified 2953
205 Ga0500639_004161 3300053163 Bacteria 7349
206 Ga0500636_0000129 3300053177 Bacteria 39152
207 Ga0500636_0176516 3300053177 Unclassified 1151
208 Ga0500637_0000020 3300053178 Bacteria 63918
209 Ga0500637_0000067 3300053178 Bacteria 37694
210 Ga0500567_025748 3300053723 Bacteria 2807
211 Ga0500570_000294 3300053724 Bacteria 17495
212 Ga0500625_000012 3300053729 Bacteria 127269
213 Ga0500625_084086 3300053729 Bacteria 1381
214 Ga0500645_000047 3300053730 Bacteria 106093
215 Ga0500645_003974 3300053730 Bacteria 5815
216 Ga0500645_007592 3300053730 Bacteria 3762
217 Ga0500552_002114 3300053733 Bacteria 1920
218 Ga0500661_000478 3300055283 Bacteria 7428
219 2563056249 2562617112 Bacteria 10918404
220 2644074385 2643221611 Bacteria 6820941
221 2713481642 2711768613 Bacteria 11048459
222 2739351246 2738543031 Bacteria 5769731
223 2739351307 2738543031 Bacteria 5769731
224 2739649539 2739367664 Bacteria 4114334
225 2740028012 2739367865 Bacteria 4114482
226 2753301998 2751185788 Bacteria 4541048
227 2921645506 2921643360 Bacteria 11448031
228 Ga0500555_019962
229 rootH2_10183537
230 rootL2_10012421
231 JGI25160J50197_1000017
232 Ga0065165_1000221
233 Ga0070666_10310611
234 Ga0070667_100067268
235 Ga0070678_100181986
236 Ga0075365_10063666
237 Ga0075363_100031300
238 Ga0075364_10000590
239 Ga0075364_10009148
240 Ga0075432_10007766
241 Ga0075362_10044617
242 Ga0075369_10005889
243 Ga0075369_10028009
244 Ga0075366_10000691
245 Ga0075366_10140069
246 Ga0075370_10006750
247 Ga0075370_10009962
248 Ga0075370_10132444
249 Ga0099794_10016313
250 Ga0105240_10077201
251 Ga0163161_10096521
252 Ga0209130_1003556
253 Ga0207426_1000107
254 Ga0207682_10087262
255 Ga0207683_10086727
256 Ga0307517_10000160
257 Ga0307515_10104346
258 Ga0307515_10109042
259 Ga0307515_10153072
260 Ga0307515_10172894
261 Ga0307509_10001515
262 Ga0307509_10148783
263 Ga0307510_10037518
264 Ga0373934_0018617
265 Ga0373927_0043398
266 Ga0436364_0457395
267 Ga0436364_1110016
268 Ga0436365_1419734
269 Ga0436360_0860292
270 Ga0436361_0252068
271 Ga0495627_000746
272 Ga0495592_0000175
273 Ga0495603_0001927
274 Ga0495638_0000074
275 Ga0495638_0007741
276 Ga0495650_0000130
277 Ga0495650_0003188
278 Ga0495650_0022566
279 Ga0495580_0000829
280 Ga0495594_0113933
281 Ga0495607_0000073
282 Ga0495583_0000275
283 Ga0495583_0018500
284 Ga0495583_0040544
285 Ga0495606_0067750
286 Ga0495610_0003668
287 Ga0495610_0005787
288 Ga0495610_0061452
289 Ga0495616_0041766
290 Ga0495620_0004589
291 Ga0495632_0003756
292 Ga0495632_0010865
293 Ga0495632_0081445
294 Ga0495637_0045948
295 Ga0495643_0000806
296 Ga0495643_0020101
297 Ga0495643_0074562
298 Ga0495648_0000050
299 Ga0495648_0000736
300 Ga0495648_0023882
301 Ga0495648_0122221
302 Ga0495666_0072096
303 Ga0495666_0163227
304 Ga0495642_0025435
305 Ga0495654_0006780
306 Ga0495654_0019614
307 Ga0495640_0004160
308 Ga0495609_0010472
309 Ga0495597_0030494
310 Ga0495622_0013128
311 Ga0495622_0034687
312 Ga0495633_0033375
313 Ga0495667_0026249
314 Ga0495668_0004446
315 Ga0495668_0012481
316 Ga0495611_0045860
317 Ga0495625_0002627
318 Ga0495625_0008763
319 Ga0495625_0025369
320 Ga0495625_0078098
321 Ga0495661_0068161
322 Ga0495670_0000160
323 Ga0495671_0000096
324 Ga0495671_0007382
325 Ga0495671_0116255
326 Ga0495674_0014069
327 Ga0495672_0031293
328 Ga0495683_0065656
329 Ga0495687_026645
330 Ga0495673_0000157
331 Ga0495673_0009442
332 Ga0495673_0046211
333 Ga0495673_0075926
334 Ga0495681_0001103
335 Ga0495686_0001463
336 Ga0495686_0166975
337 Ga0495615_0000012
338 Ga0495626_0001536
339 Ga0495626_0080955
340 Ga0496100_0000341
341 Ga0496100_0011104
342 Ga0496101_0000658
343 Ga0496101_0036799
344 Ga0496102_0001037
345 Ga0496102_0015608
346 Ga0496103_0000249
347 Ga0496104_0005105
348 Ga0496104_0215952
349 Ga0496105_0005773
350 Ga0496105_0016960
351 Ga0496106_0096188
352 Ga0496106_0098604
353 Ga0496110_0003952
354 Ga0496114_0033872
355 Ga0496117_0002550
356 Ga0496118_0002774
357 Ga0496119_0009403
358 Ga0496119_0076300
359 Ga0496121_0001331
360 Ga0496121_0010430
361 Ga0496123_0082124
362 Ga0495682_0043986
363 Ga0495682_0044475
364 Ga0501241_005964
365 nmdc:mga03683_2376_c1
366 nmdc:mga03n38_58402_c1
367 nmdc:mga00v17_500_c2
368 nmdc:mga0k408_43115_c1
369 nmdc:mga07m45_13782_c1
370 nmdc:mga07m45_48196_c1
371 nmdc:mga0sz30_2997_c1
372 Ga0500643_000674
373 Ga0500643_000823
374 Ga0500643_002239
375 Ga0500643_010747
376 Ga0500644_0000642
377 Ga0500581_016934
378 Ga0500583_0045654
379 Ga0500651_0002956
380 Ga0500566_0002826
381 Ga0500556_0000005
382 Ga0500556_0000057
383 Ga0500556_0000280
384 Ga0500556_0000957
385 Ga0500562_000240
386 Ga0500562_002422
387 Ga0500562_020053
388 Ga0500593_008122
389 Ga0500594_0000881
390 Ga0500594_0001950
391 Ga0500595_001508
392 Ga0500607_010545
393 Ga0500608_000446
394 Ga0500608_002055
395 Ga0500608_154203
396 Ga0500614_053578
397 Ga0500618_009968
398 Ga0500618_010513
399 Ga0500642_0000006
400 Ga0500642_0000694
401 Ga0500655_000041
402 Ga0500659_0054601
403 Ga0500559_0000067
404 Ga0500559_0000118
405 Ga0500559_0000166
406 Ga0500559_0002181
407 Ga0500559_0002743
408 Ga0500559_0003393
409 Ga0500559_0004137
410 Ga0500559_0006629
411 Ga0500559_0006941
412 Ga0500559_0109654
413 Ga0500559_0122061
414 Ga0500564_000174
415 Ga0500564_030622
416 Ga0500573_0002223
417 Ga0500577_0024871
418 Ga0500586_011561
419 Ga0500590_001425
420 Ga0500616_0011275
421 Ga0500616_0020185
422 Ga0500619_038250
423 Ga0500622_0000060
424 Ga0500622_0000217
425 Ga0500622_0003537
426 Ga0500624_000039
427 Ga0500624_000080
428 Ga0500627_0026400
429 Ga0500633_0045593
430 Ga0500634_0035569
431 Ga0500638_023090
432 Ga0500639_004161
433 Ga0500636_0000129
434 Ga0500636_0176516
435 Ga0500637_0000020
436 Ga0500637_0000067
437 Ga0500567_025748
438 Ga0500570_000294
439 Ga0500625_000012
440 Ga0500625_084086
441 Ga0500645_000047
442 Ga0500645_003974
443 Ga0500645_007592
444 Ga0500552_002114
445 Ga0500661_000478
446 2563056249
447 2644074385
448 2713481642
449 2739351246
450 2739351307
451 2739649539
452 2740028012
453 2753301998
454 2921645506

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

73

161

0.89

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

288

402

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jyl-assembly1.cif.gz_A crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase 0.8957 4 325
4rvu-assembly2.cif.gz_C the native structure of mycobacterial rv1454c complexed with nadph 0.8895 4 325
4a27-assembly1.cif.gz_B crystal structure of human synaptic vesicle membrane protein vat-1 homolog-like protein 0.8885 2 325
4eye-assembly1.cif.gz_A crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.8862 2 325
1qor-assembly1.cif.gz_B crystal structure of escherichia coli quinone oxidoreductase complexed with nadph 0.8854 2 325
ID Description Score Start End Superfamily
af_A0A0R0I1N1_1_153_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9147 4 120 3.90.180.10
af_I1LVH0_49_172_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9101 3 120 3.90.180.10
3tqhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9071 131 239 3.40.50.720
4idfA01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9035 1 133 3.90.180.10
af_P28304_1_127_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9025 4 124 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A428U2E7-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9821 4 325 GO:0016491
AF-A0A428U2E7-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9702 4 325 GO:0016491
AF-A0A853ERU9-F1-model_v4 Zinc-binding dehydrogenase 0.955 3 324 GO:0003677
GO:0006355
GO:0016491
AF-A0A1Y2VZ41-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9491 130 324
AF-A0A853ERU9-F1-model_v4 Zinc-binding dehydrogenase 0.9436 3 324 GO:0003677
GO:0006355
GO:0016491

Map