F340299

General Info

Members Datasets Scaffolds Average Seq Length
227 152 454 116

Family's Representative Sequence

Representative Sequence 3300046664|Ga0495659_0027815|Ga0495659_0027815_377_730
Length 117
Sequence MASYELNKKAQTKARALIEGRQYVLNSDWGDVQPSAEDENGFLETHSWADYAEWHLGLTEGAAEETKARYAFVCGDLHRDGLIACVYRASEWGHKEIELAAHDLLQFLDGTSVGSSK

Samples

Sample ID Description Type Environment
1 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
107 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
108 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
109 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
120 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
121 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
122 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
123 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.08
Nodule 0
Rhizoplane 6.17
Rhizosphere 90.31
Stem 0
Stem Tuber 0
Unclassified 4.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495659_0027815 3300046664 Bacteria 1953
2 JGI24751J29686_10105506 3300002459 Bacteria 589
3 Ga0070670_101018395 3300005331 Bacteria 754
4 Ga0070682_100105750 3300005337 Bacteria 1866
5 Ga0070660_100269043 3300005339 Bacteria 1393
6 Ga0070689_100593648 3300005340 Bacteria 959
7 Ga0070687_100060940 3300005343 Bacteria 1992
8 Ga0070675_100798736 3300005354 Bacteria 862
9 Ga0070674_100038463 3300005356 Bacteria 3224
10 Ga0070688_100259369 3300005365 Bacteria 1241
11 Ga0070659_101953000 3300005366 Bacteria 527
12 Ga0070709_10790378 3300005434 Bacteria 744
13 Ga0070663_100271922 3300005455 Bacteria 1347
14 Ga0070678_100225482 3300005456 Bacteria 1560
15 Ga0070678_100722721 3300005456 Bacteria 899
16 Ga0070662_100741292 3300005457 Bacteria 833
17 Ga0070681_10363674 3300005458 Bacteria 1357
18 Ga0070685_10153908 3300005466 Bacteria 1460
19 Ga0070698_100043218 3300005471 Bacteria 4621
20 Ga0070679_100159967 3300005530 Bacteria 2227
21 Ga0070679_101630638 3300005530 Bacteria 593
22 Ga0070672_100375214 3300005543 Bacteria 1216
23 Ga0070686_100390261 3300005544 Bacteria 1056
24 Ga0070686_100418828 3300005544 Bacteria 1023
25 Ga0070695_100154264 3300005545 Bacteria 1606
26 Ga0070696_100147074 3300005546 Bacteria 1727
27 Ga0070664_100087647 3300005564 Bacteria 2691
28 Ga0070664_100293837 3300005564 Bacteria 1467
29 Ga0068859_101405757 3300005617 Bacteria 770
30 Ga0068851_10552491 3300005834 Bacteria 696
31 Ga0068870_10086669 3300005840 Bacteria 1742
32 Ga0068863_100177593 3300005841 Bacteria 2044
33 Ga0068860_100498424 3300005843 Bacteria 1216
34 Ga0081455_10078960 3300005937 Bacteria 2703
35 Ga0081538_10009135 3300005981 Bacteria 8313
36 Ga0075364_10088701 3300006051 Bacteria 2051
37 Ga0097621_100555125 3300006237 Bacteria 1046
38 Ga0068871_100386169 3300006358 Bacteria 1244
39 Ga0075430_100041978 3300006846 Bacteria 3868
40 Ga0075430_100179071 3300006846 Bacteria 1763
41 Ga0075431_100686328 3300006847 Bacteria 1002
42 Ga0075434_101302970 3300006871 Bacteria 737
43 Ga0075429_100394575 3300006880 Bacteria 1212
44 Ga0068865_100036553 3300006881 Bacteria 3312
45 Ga0097620_101405547 3300006931 Bacteria 770
46 Ga0075435_100879314 3300007076 Bacteria 781
47 Ga0105251_10397669 3300009011 Bacteria 633
48 Ga0111539_11928482 3300009094 Bacteria 685
49 Ga0105245_10470245 3300009098 Bacteria 1269
50 Ga0114129_11628946 3300009147 Bacteria 789
51 Ga0105243_10249306 3300009148 Bacteria 1584
52 Ga0105241_11354725 3300009174 Unclassified 680
53 Ga0105242_10556764 3300009176 Bacteria 1100
54 Ga0105242_10683627 3300009176 Bacteria 1002
55 Ga0105248_10506817 3300009177 Bacteria 1361
56 Ga0105238_11247155 3300009551 Bacteria 769
57 Ga0105238_11247333 3300009551 Bacteria 768
58 Ga0105238_11254029 3300009551 Bacteria 766
59 Ga0105239_10108101 3300010375 Bacteria 3082
60 Ga0105239_10596772 3300010375 Bacteria 1259
61 Ga0105239_13016343 3300010375 Bacteria 549
62 Ga0157369_11327738 3300013105 Bacteria 733
63 Ga0157374_10606937 3300013296 Bacteria 1104
64 Ga0157378_10967218 3300013297 Bacteria 884
65 Ga0157372_10231421 3300013307 Bacteria 2143
66 Ga0157375_10371625 3300013308 Bacteria 1596
67 Ga0157377_10098151 3300014745 Bacteria 1741
68 Ga0157376_11433453 3300014969 Bacteria 723
69 Ga0157376_12622877 3300014969 Unclassified 544
70 Ga0207642_10057832 3300025899 Bacteria 1786
71 Ga0207710_10246453 3300025900 Bacteria 892
72 Ga0207688_10204967 3300025901 Bacteria 1184
73 Ga0207645_10146089 3300025907 Bacteria 1542
74 Ga0207645_11003578 3300025907 Unclassified 565
75 Ga0207643_10332158 3300025908 Bacteria 951
76 Ga0207643_10587593 3300025908 Bacteria 716
77 Ga0207705_11170206 3300025909 Bacteria 591
78 Ga0207662_10083621 3300025918 Bacteria 1951
79 Ga0207652_10454601 3300025921 Bacteria 1154
80 Ga0207652_10518355 3300025921 Unclassified 1073
81 Ga0207694_10232475 3300025924 Bacteria 1506
82 Ga0207650_10918027 3300025925 Bacteria 744
83 Ga0207659_10572700 3300025926 Bacteria 961
84 Ga0207659_11805303 3300025926 Unclassified 519
85 Ga0207687_10290282 3300025927 Bacteria 1314
86 Ga0207644_10129269 3300025931 Bacteria 1932
87 Ga0207690_10105930 3300025932 Bacteria 2017
88 Ga0207690_10394409 3300025932 Bacteria 1102
89 Ga0207686_10520379 3300025934 Bacteria 926
90 Ga0207709_10140894 3300025935 Bacteria 1657
91 Ga0207670_10370652 3300025936 Bacteria 1138
92 Ga0207669_10052738 3300025937 Bacteria 2445
93 Ga0207704_10055465 3300025938 Bacteria 2422
94 Ga0207691_10640699 3300025940 Bacteria 898
95 Ga0207661_10198719 3300025944 Bacteria 1762
96 Ga0207679_10133290 3300025945 Bacteria 1996
97 Ga0207679_10414931 3300025945 Bacteria 1187
98 Ga0207668_10298634 3300025972 Bacteria 1328
99 Ga0207677_11373219 3300026023 Bacteria 650
100 Ga0207678_10481004 3300026067 Bacteria 1081
101 Ga0207702_10586770 3300026078 Bacteria 1093
102 Ga0207683_10247507 3300026121 Bacteria 1626
103 Ga0207698_10391746 3300026142 Bacteria 1325
104 Ga0268266_10149711 3300028379 Bacteria 2102
105 Ga0268266_11414856 3300028379 Bacteria 671
106 Ga0268264_10587336 3300028381 Bacteria 1096
107 Ga0307408_101171629 3300031548 Bacteria 716
108 Ga0307413_10061676 3300031824 Bacteria 2315
109 Ga0307413_10118622 3300031824 Bacteria 1787
110 Ga0307413_10172034 3300031824 Bacteria 1534
111 Ga0307413_10690790 3300031824 Bacteria 847
112 Ga0307410_10105553 3300031852 Bacteria 2028
113 Ga0307410_10199489 3300031852 Bacteria 1527
114 Ga0307410_10760854 3300031852 Bacteria 821
115 Ga0307406_10068470 3300031901 Bacteria 2317
116 Ga0307406_10232921 3300031901 Bacteria 1376
117 Ga0307406_10246732 3300031901 Bacteria 1343
118 Ga0307406_11631175 3300031901 Bacteria 570
119 Ga0307407_10012337 3300031903 Bacteria 4103
120 Ga0307407_10423049 3300031903 Bacteria 960
121 Ga0307412_10487870 3300031911 Bacteria 1023
122 Ga0307412_11589654 3300031911 Bacteria 597
123 Ga0307409_100004829 3300031995 Bacteria 7654
124 Ga0307409_100332608 3300031995 Bacteria 1426
125 Ga0307409_100354170 3300031995 Bacteria 1386
126 Ga0307409_100617543 3300031995 Bacteria 1073
127 Ga0307409_100747276 3300031995 Bacteria 982
128 Ga0307409_100793481 3300031995 Bacteria 954
129 Ga0307409_100847659 3300031995 Bacteria 924
130 Ga0307409_101484804 3300031995 Bacteria 705
131 Ga0307409_102333814 3300031995 Unclassified 564
132 Ga0307409_102379287 3300031995 Bacteria 559
133 Ga0307409_102634069 3300031995 Bacteria 531
134 Ga0307409_102704080 3300031995 Bacteria 524
135 Ga0307416_100068412 3300032002 Bacteria 2934
136 Ga0307416_100295051 3300032002 Bacteria 1607
137 Ga0307416_100842547 3300032002 Bacteria 1015
138 Ga0307416_101332284 3300032002 Bacteria 824
139 Ga0307416_102179885 3300032002 Bacteria 655
140 Ga0307416_103659865 3300032002 Bacteria 514
141 Ga0307414_10140279 3300032004 Bacteria 1891
142 Ga0307414_10498817 3300032004 Bacteria 1077
143 Ga0307414_10789729 3300032004 Bacteria 865
144 Ga0307414_11640526 3300032004 Bacteria 599
145 Ga0307411_10183715 3300032005 Bacteria 1590
146 Ga0307411_10399350 3300032005 Bacteria 1136
147 Ga0307415_100002481 3300032126 Bacteria 9213
148 Ga0307415_100046047 3300032126 Bacteria 2928
149 Ga0307415_100072808 3300032126 Bacteria 2421
150 Ga0307415_101154879 3300032126 Bacteria 727
151 Ga0307415_101435644 3300032126 Bacteria 658
152 Ga0373954_0531436 3300035118 Bacteria 583
153 Ga0395899_0460549 3300037312 Bacteria 831
154 Ga0395900_0419101 3300037418 Bacteria 1300
155 Ga0395900_1182383 3300037418 Bacteria 680
156 Ga0395898_0045133 3300037466 Bacteria 4333
157 Ga0395898_0211501 3300037466 Bacteria 1850
158 Ga0395898_0298185 3300037466 Bacteria 1538
159 Ga0395905_0330552 3300037471 Bacteria 1415
160 Ga0395905_0696439 3300037471 Bacteria 918
161 Ga0395901_0000675 3300038443 Bacteria 39208
162 Ga0395901_0237189 3300038443 Bacteria 1903
163 Ga0395901_0503268 3300038443 Bacteria 1233
164 Ga0439466_0079542 3300041411 Bacteria 1035
165 Ga0451802_1172400 3300041460 Bacteria 621
166 Ga0451849_0839982 3300041505 Bacteria 533
167 Ga0439435_0287464 3300042436 Bacteria 561
168 Ga0466969_0591712 3300044656 Bacteria 509
169 Ga0466965_0042222 3300044683 Bacteria 2249
170 Ga0466965_0476140 3300044683 Bacteria 698
171 Ga0466963_0140754 3300044694 Bacteria 1671
172 Ga0466963_0364512 3300044694 Bacteria 1018
173 Ga0466970_0359689 3300044765 Bacteria 827
174 Ga0466970_0877037 3300044765 Bacteria 527
175 Ga0466957_0484226 3300044842 Bacteria 856
176 Ga0466960_0015516 3300044901 Bacteria 3285
177 Ga0466960_0026546 3300044901 Bacteria 2632
178 Ga0466960_0060983 3300044901 Bacteria 1850
179 Ga0466960_0330087 3300044901 Bacteria 866
180 Ga0466958_0071220 3300045836 Bacteria 2129
181 Ga0466958_0734431 3300045836 Bacteria 643
182 Ga0466967_0057773 3300045976 Bacteria 3426
183 Ga0466967_0130282 3300045976 Bacteria 2334
184 Ga0466967_1214550 3300045976 Bacteria 751
185 Ga0466967_1448941 3300045976 Bacteria 684
186 Ga0466967_1828034 3300045976 Bacteria 605
187 Ga0495596_0298825 3300046500 Bacteria 626
188 Ga0495620_0194811 3300046515 Bacteria 781
189 Ga0495631_0385021 3300046518 Unclassified 597
190 Ga0495644_0006707 3300046523 Bacteria 4457
191 Ga0495598_0003649 3300046537 Bacteria 3285
192 Ga0495621_0019719 3300046539 Unclassified 2205
193 Ga0495667_0480219 3300046559 Bacteria 779
194 Ga0495668_0358382 3300046616 Bacteria 801
195 Ga0495661_0160597 3300046665 Unclassified 1207
196 Ga0495658_0726171 3300046683 Bacteria 636
197 Ga0495670_0013403 3300046691 Unclassified 4034
198 Ga0495581_0315784 3300047315 Bacteria 913
199 Ga0496100_1021138 3300048903 Bacteria 651
200 Ga0496101_0469077 3300048904 Bacteria 994
201 Ga0496104_0599295 3300048907 Bacteria 1012
202 Ga0496107_0226568 3300048910 Bacteria 1391
203 Ga0496108_0621585 3300048911 Bacteria 940
204 Ga0496109_0479398 3300048912 Bacteria 1174
205 Ga0496109_1749878 3300048912 Bacteria 555
206 Ga0496110_0415038 3300048913 Bacteria 1227
207 Ga0496112_0025265 3300048915 Bacteria 5703
208 Ga0496112_0369136 3300048915 Bacteria 1377
209 Ga0496113_0632821 3300048916 Bacteria 856
210 Ga0496114_0330325 3300048917 Bacteria 1348
211 Ga0496115_0662795 3300048918 Bacteria 824
212 Ga0501290_046995 3300049513 Bacteria 663
213 Ga0501048_0210568 3300049582 Bacteria 1379
214 nmdc:mga00v17_58682_c1 3300050491 Bacteria 2358
215 nmdc:mga00v17_67916_c1 3300050491 Bacteria 2203
216 nmdc:mga0yw44_214672_c1 3300050492 Bacteria 1273
217 nmdc:mga0yw44_489468_c1 3300050492 Bacteria 834
218 nmdc:mga0yw44_865596_c1 3300050492 Bacteria 613
219 nmdc:mga06z11_1035354_c1 3300050494 Bacteria 500
220 nmdc:mga09592_381840_c1 3300050508 Unclassified 1218
221 nmdc:mga0qj67_1144338_c1 3300050509 Bacteria 607
222 nmdc:mga06r32_128266_c1 3300050510 Bacteria 2507
223 nmdc:mga06r32_429651_c1 3300050510 Bacteria 1302
224 nmdc:mga08y16_2079279_c1 3300050511 Bacteria 516
225 nmdc:mga0rr50_1161401_c1 3300050513 Bacteria 656
226 Ga0501082_1714221 3300060353 Bacteria 548
227 2795781769 2795385470 Bacteria 8317180
228 Ga0495659_0027815
229 JGI24751J29686_10105506
230 Ga0070670_101018395
231 Ga0070682_100105750
232 Ga0070660_100269043
233 Ga0070689_100593648
234 Ga0070687_100060940
235 Ga0070675_100798736
236 Ga0070674_100038463
237 Ga0070688_100259369
238 Ga0070659_101953000
239 Ga0070709_10790378
240 Ga0070663_100271922
241 Ga0070678_100225482
242 Ga0070678_100722721
243 Ga0070662_100741292
244 Ga0070681_10363674
245 Ga0070685_10153908
246 Ga0070698_100043218
247 Ga0070679_100159967
248 Ga0070679_101630638
249 Ga0070672_100375214
250 Ga0070686_100390261
251 Ga0070686_100418828
252 Ga0070695_100154264
253 Ga0070696_100147074
254 Ga0070664_100087647
255 Ga0070664_100293837
256 Ga0068859_101405757
257 Ga0068851_10552491
258 Ga0068870_10086669
259 Ga0068863_100177593
260 Ga0068860_100498424
261 Ga0081455_10078960
262 Ga0081538_10009135
263 Ga0075364_10088701
264 Ga0097621_100555125
265 Ga0068871_100386169
266 Ga0075430_100041978
267 Ga0075430_100179071
268 Ga0075431_100686328
269 Ga0075434_101302970
270 Ga0075429_100394575
271 Ga0068865_100036553
272 Ga0097620_101405547
273 Ga0075435_100879314
274 Ga0105251_10397669
275 Ga0111539_11928482
276 Ga0105245_10470245
277 Ga0114129_11628946
278 Ga0105243_10249306
279 Ga0105241_11354725
280 Ga0105242_10556764
281 Ga0105242_10683627
282 Ga0105248_10506817
283 Ga0105238_11247155
284 Ga0105238_11247333
285 Ga0105238_11254029
286 Ga0105239_10108101
287 Ga0105239_10596772
288 Ga0105239_13016343
289 Ga0157369_11327738
290 Ga0157374_10606937
291 Ga0157378_10967218
292 Ga0157372_10231421
293 Ga0157375_10371625
294 Ga0157377_10098151
295 Ga0157376_11433453
296 Ga0157376_12622877
297 Ga0207642_10057832
298 Ga0207710_10246453
299 Ga0207688_10204967
300 Ga0207645_10146089
301 Ga0207645_11003578
302 Ga0207643_10332158
303 Ga0207643_10587593
304 Ga0207705_11170206
305 Ga0207662_10083621
306 Ga0207652_10454601
307 Ga0207652_10518355
308 Ga0207694_10232475
309 Ga0207650_10918027
310 Ga0207659_10572700
311 Ga0207659_11805303
312 Ga0207687_10290282
313 Ga0207644_10129269
314 Ga0207690_10105930
315 Ga0207690_10394409
316 Ga0207686_10520379
317 Ga0207709_10140894
318 Ga0207670_10370652
319 Ga0207669_10052738
320 Ga0207704_10055465
321 Ga0207691_10640699
322 Ga0207661_10198719
323 Ga0207679_10133290
324 Ga0207679_10414931
325 Ga0207668_10298634
326 Ga0207677_11373219
327 Ga0207678_10481004
328 Ga0207702_10586770
329 Ga0207683_10247507
330 Ga0207698_10391746
331 Ga0268266_10149711
332 Ga0268266_11414856
333 Ga0268264_10587336
334 Ga0307408_101171629
335 Ga0307413_10061676
336 Ga0307413_10118622
337 Ga0307413_10172034
338 Ga0307413_10690790
339 Ga0307410_10105553
340 Ga0307410_10199489
341 Ga0307410_10760854
342 Ga0307406_10068470
343 Ga0307406_10232921
344 Ga0307406_10246732
345 Ga0307406_11631175
346 Ga0307407_10012337
347 Ga0307407_10423049
348 Ga0307412_10487870
349 Ga0307412_11589654
350 Ga0307409_100004829
351 Ga0307409_100332608
352 Ga0307409_100354170
353 Ga0307409_100617543
354 Ga0307409_100747276
355 Ga0307409_100793481
356 Ga0307409_100847659
357 Ga0307409_101484804
358 Ga0307409_102333814
359 Ga0307409_102379287
360 Ga0307409_102634069
361 Ga0307409_102704080
362 Ga0307416_100068412
363 Ga0307416_100295051
364 Ga0307416_100842547
365 Ga0307416_101332284
366 Ga0307416_102179885
367 Ga0307416_103659865
368 Ga0307414_10140279
369 Ga0307414_10498817
370 Ga0307414_10789729
371 Ga0307414_11640526
372 Ga0307411_10183715
373 Ga0307411_10399350
374 Ga0307415_100002481
375 Ga0307415_100046047
376 Ga0307415_100072808
377 Ga0307415_101154879
378 Ga0307415_101435644
379 Ga0373954_0531436
380 Ga0395899_0460549
381 Ga0395900_0419101
382 Ga0395900_1182383
383 Ga0395898_0045133
384 Ga0395898_0211501
385 Ga0395898_0298185
386 Ga0395905_0330552
387 Ga0395905_0696439
388 Ga0395901_0000675
389 Ga0395901_0237189
390 Ga0395901_0503268
391 Ga0439466_0079542
392 Ga0451802_1172400
393 Ga0451849_0839982
394 Ga0439435_0287464
395 Ga0466969_0591712
396 Ga0466965_0042222
397 Ga0466965_0476140
398 Ga0466963_0140754
399 Ga0466963_0364512
400 Ga0466970_0359689
401 Ga0466970_0877037
402 Ga0466957_0484226
403 Ga0466960_0015516
404 Ga0466960_0026546
405 Ga0466960_0060983
406 Ga0466960_0330087
407 Ga0466958_0071220
408 Ga0466958_0734431
409 Ga0466967_0057773
410 Ga0466967_0130282
411 Ga0466967_1214550
412 Ga0466967_1448941
413 Ga0466967_1828034
414 Ga0495596_0298825
415 Ga0495620_0194811
416 Ga0495631_0385021
417 Ga0495644_0006707
418 Ga0495598_0003649
419 Ga0495621_0019719
420 Ga0495667_0480219
421 Ga0495668_0358382
422 Ga0495661_0160597
423 Ga0495658_0726171
424 Ga0495670_0013403
425 Ga0495581_0315784
426 Ga0496100_1021138
427 Ga0496101_0469077
428 Ga0496104_0599295
429 Ga0496107_0226568
430 Ga0496108_0621585
431 Ga0496109_0479398
432 Ga0496109_1749878
433 Ga0496110_0415038
434 Ga0496112_0025265
435 Ga0496112_0369136
436 Ga0496113_0632821
437 Ga0496114_0330325
438 Ga0496115_0662795
439 Ga0501290_046995
440 Ga0501048_0210568
441 nmdc:mga00v17_58682_c1
442 nmdc:mga00v17_67916_c1
443 nmdc:mga0yw44_214672_c1
444 nmdc:mga0yw44_489468_c1
445 nmdc:mga0yw44_865596_c1
446 nmdc:mga06z11_1035354_c1
447 nmdc:mga09592_381840_c1
448 nmdc:mga0qj67_1144338_c1
449 nmdc:mga06r32_128266_c1
450 nmdc:mga06r32_429651_c1
451 nmdc:mga08y16_2079279_c1
452 nmdc:mga0rr50_1161401_c1
453 Ga0501082_1714221
454 2795781769

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uhq-assembly2.cif.gz_D structure of a semisweet q20a mutant 0.9741 82 112
7fia-assembly1.cif.gz_A structure of acrif23 0.9554 82 114
5uhs-assembly1.cif.gz_B structure of a semisweet d57a mutant 0.948 82 112
4rng-assembly4.cif.gz_C-2 crystal structure of a bacterial homologue of sweet transporters 0.9344 82 111
4rng-assembly2.cif.gz_D crystal structure of a bacterial homologue of sweet transporters 0.9327 82 111
ID Description Score Start End Superfamily
af_Q5PR66_13_150_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9797 82 106 1.25.40.10
3htmA02 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.966 85 110 6.10.250.3030
af_Q9UTL6_144_225_1.20.1280.20 Mainly Alpha;Up-down Bundle;Monooxygenase;HscB, C-terminal domain 0.9596 82 113 1.20.1280.20
af_O13799_800_1030_1.10.3380.30 Mainly Alpha;Orthogonal Bundle;Sec63 N-terminal domain-like fold; 0.9543 82 111 1.10.3380.30
af_A0A1D8PNA3_536_752_1.25.40.1010 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.953 82 114 1.25.40.1010
ID Description Score Start End GO Terms
AF-A0A4Q7UT68-F1-model_v4 Uncharacterized protein 0.9903 1 113
AF-A0A370CQB0-F1-model_v4 deleted 0.9823 1 115
AF-A0A6V8KPL8-F1-model_v4 Uncharacterized protein 0.9786 1 116
AF-A0A3D9V2E1-F1-model_v4 Uncharacterized protein 0.9782 1 116
AF-A0A7V8Z5C6-F1-model_v4 Uncharacterized protein 0.978 1 99

Map