F340256

General Info

Members Datasets Scaffolds Average Seq Length
227 156 454 310

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0055977|Ga0495629_0055977_548_1606
Length 352
Sequence MPPEAIFDPPGRRSASCAFHVALSGWPAMSDVLAVDAVDLTKTFGPRIAVDHITLRVGQGEVYGVLGPNGAGKTTLLRMLFGLIRPDAGTLEVLGRAWPRDGVHTLDGVAGFIESPKFYPGLSGRQNLRLLAALDGLDAKTAAVRAGEVLDTVDLRARSQDKVRGYSFGMRQRLGVAAALLRAPRLMVLDEPANGLDPAGIRDMRALVKRLADSGLTVLLSSHDMAEVEQICDDVTIMRTGQVVYHGPIARLREQAPAQAHRVATTDDEATAKLASVRGLDVTLVEDGLAVRGDQSELDALITDVVTAGIGLRGLSRTETPLEALFFMLTEAAPDAPTADLDHDTANAGARR

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
46 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
47 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
50 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
51 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
52 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
53 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
54 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
55 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
56 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
57 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
61 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
66 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
76 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
77 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
78 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
81 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
85 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
86 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
87 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
103 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
116 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
134 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
135 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
138 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
142 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
143 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
144 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
145 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
146 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
147 2506783011 Frankia datiscae Dg1 Isolate Nodule
148 2527291627 Frankia casuarinae Thr Isolate Nodule
149 2643221561 Nocardioides sp. Root151 Isolate Unclassified
150 2643221615 Nocardioides sp. Root224 Isolate Unclassified
151 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
152 2739367898 Nocardioides sp. CF479 Isolate Unclassified
153 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
154 2858868258 Micromonospora sp. MH33 Isolate Unclassified
155 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
156 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.27
Metatranscriptomes 0.44
Isolates 5.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.98
Nodule 1.32
Rhizoplane 7.93
Rhizosphere 67.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0055977 3300046459 Bacteria 2758
2 Ga0070658_10037926 3300005327 Bacteria 3886
3 Ga0070658_10346673 3300005327 Bacteria 1271
4 Ga0070683_100032624 3300005329 Bacteria 4743
5 Ga0070683_100068634 3300005329 Bacteria 3303
6 Ga0070675_100328465 3300005354 Bacteria 1352
7 Ga0070659_100222233 3300005366 Bacteria 1559
8 Ga0070713_100093799 3300005436 Bacteria 2587
9 Ga0070708_100057688 3300005445 Bacteria 3457
10 Ga0070681_10173026 3300005458 Bacteria 2081
11 Ga0070685_10004885 3300005466 Bacteria 6781
12 Ga0070706_100189825 3300005467 Bacteria 1920
13 Ga0070698_100028858 3300005471 Bacteria 5759
14 Ga0070699_100042148 3300005518 Bacteria 3949
15 Ga0070684_100029463 3300005535 Bacteria 4652
16 Ga0070684_100117421 3300005535 Bacteria 2391
17 Ga0070684_100176280 3300005535 Bacteria 1943
18 Ga0070664_100156961 3300005564 Bacteria 2011
19 Ga0068857_100030371 3300005577 Bacteria 4772
20 Ga0068856_100142483 3300005614 Bacteria 2404
21 Ga0068858_100000116 3300005842 Bacteria 83925
22 Ga0068860_100001027 3300005843 Bacteria 30749
23 Ga0081539_10054960 3300005985 Bacteria 2218
24 Ga0070717_10152492 3300006028 Bacteria 2000
25 Ga0075365_10003300 3300006038 Bacteria 8280
26 Ga0075365_10026464 3300006038 Bacteria 3683
27 Ga0075365_10036035 3300006038 Bacteria 3204
28 Ga0075365_10060794 3300006038 Bacteria 2521
29 Ga0075368_10000452 3300006042 Bacteria 12112
30 Ga0075368_10028405 3300006042 Bacteria 2161
31 Ga0075363_100003637 3300006048 Bacteria 6612
32 Ga0075363_100007425 3300006048 Bacteria 5038
33 Ga0075364_10009613 3300006051 Bacteria 5808
34 Ga0075364_10035438 3300006051 Bacteria 3224
35 Ga0075362_10037944 3300006177 Bacteria 2115
36 Ga0075367_10002191 3300006178 Bacteria 8806
37 Ga0075370_10001823 3300006353 Bacteria 9529
38 Ga0075370_10005090 3300006353 Bacteria 6479
39 Ga0075428_100426576 3300006844 Bacteria 1421
40 Ga0111539_10010517 3300009094 Bacteria 11647
41 Ga0105247_10001737 3300009101 Bacteria 15351
42 Ga0105239_10007963 3300010375 Bacteria 12104
43 Ga0157375_10402085 3300013308 Bacteria 1536
44 Ga0157379_10000574 3300014968 Bacteria 29743
45 Ga0157379_10038172 3300014968 Bacteria 4285
46 Ga0163161_10024437 3300017792 Bacteria 4268
47 Ga0207710_10000047 3300025900 Bacteria 191694
48 Ga0207705_10231571 3300025909 Bacteria 1405
49 Ga0207700_10168123 3300025928 Bacteria 1827
50 Ga0207661_10062584 3300025944 Bacteria 3011
51 Ga0207679_10124532 3300025945 Bacteria 2058
52 Ga0207658_10030524 3300025986 Bacteria 3817
53 Ga0207703_10000107 3300026035 Bacteria 98187
54 Ga0207674_10058194 3300026116 Bacteria 3917
55 Ga0209813_10001516 3300027866 Bacteria 5218
56 Ga0268264_10000238 3300028381 Bacteria 105229
57 Ga0307515_10014830 3300028794 Bacteria 14409
58 Ga0307508_10093368 3300031616 Bacteria 2599
59 Ga0307508_10120400 3300031616 Bacteria 2227
60 Ga0307516_10103258 3300031730 Bacteria 2664
61 Ga0307409_100121497 3300031995 Bacteria 2213
62 Ga0307416_100110670 3300032002 Bacteria 2419
63 Ga0307414_10143449 3300032004 Bacteria 1873
64 Ga0307411_10101353 3300032005 Bacteria 2037
65 Ga0307510_10092249 3300033180 Bacteria 2866
66 Ga0373953_0102285 3300035117 Bacteria 1207
67 Ga0373943_0365183 3300035170 Bacteria 829
68 Ga0373955_0004315 3300035172 Bacteria 6282
69 Ga0373937_0026741 3300036401 Bacteria 5214
70 Ga0372808_007073 3300036459 Bacteria 1529
71 Ga0373925_0011915 3300037068 Bacteria 6292
72 Ga0373925_0044821 3300037068 Bacteria 3284
73 Ga0373925_0455283 3300037068 Bacteria 1048
74 Ga0395900_0028780 3300037418 Bacteria 5695
75 Ga0451833_0341608 3300041491 Bacteria 9164
76 Ga0466965_0015455 3300044683 Bacteria 3627
77 Ga0466965_0025715 3300044683 Bacteria 2851
78 Ga0466965_0072261 3300044683 Bacteria 1736
79 Ga0466966_0090553 3300044684 Bacteria 1899
80 Ga0466961_0002223 3300044693 Bacteria 12082
81 Ga0466961_0006527 3300044693 Bacteria 7415
82 Ga0466961_0020389 3300044693 Bacteria 4264
83 Ga0466961_0067639 3300044693 Bacteria 2269
84 Ga0466963_0008459 3300044694 Bacteria 6166
85 Ga0466963_0034962 3300044694 Bacteria 3272
86 Ga0466971_0002432 3300044719 Bacteria 7860
87 Ga0466971_0048747 3300044719 Bacteria 1904
88 Ga0466968_0029930 3300044735 Bacteria 2254
89 Ga0466970_0013889 3300044765 Bacteria 4130
90 Ga0466970_0055584 3300044765 Bacteria 2114
91 Ga0466970_0081870 3300044765 Bacteria 1745
92 Ga0466957_0014893 3300044842 Bacteria 4535
93 Ga0466957_0057455 3300044842 Bacteria 2381
94 Ga0466957_0102865 3300044842 Bacteria 1802
95 Ga0466957_0325970 3300044842 Bacteria 1037
96 Ga0466960_0044206 3300044901 Bacteria 2123
97 Ga0466959_0051779 3300045049 Bacteria 3009
98 Ga0466958_0000549 3300045836 Bacteria 15983
99 Ga0466958_0254382 3300045836 Bacteria 1124
100 Ga0466967_0001220 3300045976 Bacteria 14498
101 Ga0466967_0031561 3300045976 Bacteria 4461
102 Ga0466967_0048840 3300045976 Bacteria 3698
103 Ga0466967_0061132 3300045976 Bacteria 3341
104 Ga0466967_0137903 3300045976 Bacteria 2270
105 Ga0466967_0224555 3300045976 Bacteria 1786
106 Ga0466967_0582382 3300045976 Bacteria 1103
107 Ga0495592_0043621 3300046454 Bacteria 3354
108 Ga0495603_0020513 3300046455 Bacteria 4005
109 Ga0495629_0110186 3300046459 Bacteria 1919
110 Ga0495651_0003095 3300046462 Bacteria 12845
111 Ga0495653_0004936 3300046463 Bacteria 10830
112 Ga0495664_0064805 3300046477 Bacteria 2178
113 Ga0495594_0137476 3300046499 Bacteria 1385
114 Ga0495608_0003564 3300046511 Bacteria 11153
115 Ga0495618_0121893 3300046514 Bacteria 1670
116 Ga0495618_0161495 3300046514 Bacteria 1428
117 Ga0495620_0084007 3300046515 Bacteria 1285
118 Ga0495628_0013908 3300046516 Bacteria 6759
119 Ga0495630_0053219 3300046517 Bacteria 3031
120 Ga0495632_0039015 3300046519 Bacteria 2401
121 Ga0495648_0026829 3300046524 Bacteria 3868
122 Ga0495666_0061260 3300046526 Bacteria 1798
123 Ga0495652_0001264 3300046529 Bacteria 28303
124 Ga0495652_0154102 3300046529 Bacteria 1791
125 Ga0495640_0014199 3300046533 Bacteria 6037
126 Ga0495640_0161765 3300046533 Bacteria 1434
127 Ga0495586_0017073 3300046535 Bacteria 3859
128 Ga0495587_0006270 3300046536 Bacteria 7762
129 Ga0495667_0002798 3300046559 Bacteria 11648
130 Ga0495667_0132105 3300046559 Bacteria 1610
131 Ga0495634_0062341 3300046642 Bacteria 2476
132 Ga0495635_0006563 3300046663 Bacteria 8117
133 Ga0495657_0001445 3300046675 Bacteria 20563
134 Ga0495657_0071735 3300046675 Bacteria 2260
135 Ga0495599_0026718 3300046678 Bacteria 3618
136 Ga0495646_0046585 3300046680 Bacteria 2643
137 Ga0495613_0026251 3300046689 Bacteria 4340
138 Ga0495624_0012226 3300046690 Bacteria 5876
139 Ga0495600_0004360 3300046809 Bacteria 8470
140 Ga0495604_0003958 3300047317 Bacteria 11794
141 Ga0495604_0091209 3300047317 Bacteria 2260
142 Ga0495674_0009906 3300047319 Bacteria 9039
143 Ga0495674_0270677 3300047319 Bacteria 1393
144 Ga0495676_0003706 3300047321 Bacteria 13877
145 Ga0495680_0004193 3300047322 Bacteria 13845
146 Ga0495675_0005019 3300047444 Bacteria 8052
147 Ga0495684_0004720 3300047471 Bacteria 10640
148 Ga0495602_0003487 3300048088 Bacteria 16264
149 Ga0496101_0092234 3300048904 Bacteria 2255
150 Ga0496102_0094908 3300048905 Bacteria 2764
151 Ga0496105_0010392 3300048908 Bacteria 7320
152 Ga0496108_0044099 3300048911 Bacteria 3724
153 Ga0496108_0078803 3300048911 Bacteria 2789
154 Ga0496108_0079421 3300048911 Bacteria 2778
155 Ga0496108_0123488 3300048911 Bacteria 2222
156 Ga0496108_0144371 3300048911 Bacteria 2051
157 Ga0496108_0265228 3300048911 Bacteria 1495
158 Ga0496109_0010580 3300048912 Bacteria 7890
159 Ga0496109_0091375 3300048912 Bacteria 2815
160 Ga0496110_0033990 3300048913 Bacteria 4413
161 Ga0496110_0111386 3300048913 Bacteria 2460
162 Ga0496110_0165157 3300048913 Bacteria 2008
163 Ga0496112_0055959 3300048915 Bacteria 3881
164 Ga0496112_0527804 3300048915 Bacteria 1115
165 Ga0496114_0062359 3300048917 Bacteria 3120
166 Ga0496114_0373421 3300048917 Bacteria 1262
167 Ga0496119_0032346 3300048922 Bacteria 3488
168 Ga0496121_0021768 3300048924 Bacteria 6261
169 Ga0496121_0096144 3300048924 Bacteria 2300
170 Ga0501032_0191339 3300049569 Bacteria 1337
171 Ga0501034_0000520 3300049571 Bacteria 61951
172 Ga0501034_0008580 3300049571 Bacteria 10785
173 Ga0501036_0002079 3300049572 Bacteria 15599
174 Ga0501038_0024826 3300049574 Bacteria 5343
175 Ga0501043_0060058 3300049579 Bacteria 2984
176 Ga0501047_0161059 3300049581 Bacteria 2115
177 Ga0501067_0067833 3300049583 Bacteria 1975
178 Ga0501068_0000466 3300049584 Bacteria 20436
179 Ga0501068_0012919 3300049584 Bacteria 4745
180 Ga0501068_0109351 3300049584 Bacteria 1718
181 Ga0501070_0044277 3300049586 Bacteria 3704
182 Ga0501070_0240069 3300049586 Bacteria 1483
183 Ga0501072_0060798 3300049588 Bacteria 2978
184 Ga0501072_0133504 3300049588 Bacteria 1979
185 Ga0501073_0008716 3300049589 Bacteria 7508
186 Ga0501074_0014108 3300049590 Bacteria 5809
187 Ga0501076_0012131 3300049592 Bacteria 6442
188 Ga0501080_0009355 3300049742 Bacteria 8935
189 Ga0501083_0097722 3300049744 Bacteria 1937
190 Ga0501035_0008892 3300049822 Bacteria 9345
191 nmdc:mga03n38_15949_c1 3300050490 Bacteria 2913
192 nmdc:mga03n38_24832_c1 3300050490 Bacteria 2455
193 nmdc:mga03n38_7410_c1 3300050490 Bacteria 3882
194 nmdc:mga00v17_71701_c1 3300050491 Bacteria 2148
195 nmdc:mga00v17_9063_c1 3300050491 Bacteria 5372
196 nmdc:mga0yw44_39442_c1 3300050492 Bacteria 2801
197 nmdc:mga0yw44_600_c1 3300050492 Bacteria 13034
198 nmdc:mga0yw44_73958_c1 3300050492 Bacteria 2121
199 nmdc:mga06z11_10386_c1 3300050494 Bacteria 3966
200 nmdc:mga06z11_70896_c1 3300050494 Bacteria 1844
201 nmdc:mga04h51_20200_c1 3300050495 Bacteria 1985
202 nmdc:mga07m45_21474_c1 3300050496 Bacteria 3516
203 nmdc:mga07m45_2535_c1 3300050496 Bacteria 8577
204 Ga0495601_0030471 3300053077 Bacteria 3350
205 Ga0495619_0016086 3300053085 Bacteria 4735
206 Ga0500644_0000093 3300053088 Bacteria 55990
207 Ga0500556_0000134 3300053104 Bacteria 63361
208 Ga0500593_000133 3300053117 Bacteria 29664
209 Ga0500573_0018494 3300053140 Bacteria 3971
210 Ga0500616_0001072 3300053153 Bacteria 28597
211 Ga0500616_0038614 3300053153 Bacteria 2578
212 Ga0466962_0000431 3300061719 Bacteria 18188
213 Ga0466962_0007582 3300061719 Bacteria 5206
214 Ga0466962_0063145 3300061719 Bacteria 1768
215 Ga0466962_0108187 3300061719 Bacteria 1338
216 2506868309 2506783011 Bacteria 5323186
217 2528206190 2527291627 Bacteria 5309833
218 2643826629 2643221561 Bacteria 4984412
219 2644091354 2643221615 Bacteria 5487866
220 2644091948 2643221615 Bacteria 5487866
221 2644321157 2643221657 Bacteria 5490246
222 2644321751 2643221657 Bacteria 5490246
223 2740168728 2739367898 Bacteria 4367674
224 2857482073 2857481737 Bacteria 4761446
225 2858875630 2858868258 Bacteria 7683772
226 2862182017 2862178590 Bacteria 8583590
227 8002788774 8002784119 Bacteria 9788632
228 Ga0495629_0055977
229 Ga0070658_10037926
230 Ga0070658_10346673
231 Ga0070683_100032624
232 Ga0070683_100068634
233 Ga0070675_100328465
234 Ga0070659_100222233
235 Ga0070713_100093799
236 Ga0070708_100057688
237 Ga0070681_10173026
238 Ga0070685_10004885
239 Ga0070706_100189825
240 Ga0070698_100028858
241 Ga0070699_100042148
242 Ga0070684_100029463
243 Ga0070684_100117421
244 Ga0070684_100176280
245 Ga0070664_100156961
246 Ga0068857_100030371
247 Ga0068856_100142483
248 Ga0068858_100000116
249 Ga0068860_100001027
250 Ga0081539_10054960
251 Ga0070717_10152492
252 Ga0075365_10003300
253 Ga0075365_10026464
254 Ga0075365_10036035
255 Ga0075365_10060794
256 Ga0075368_10000452
257 Ga0075368_10028405
258 Ga0075363_100003637
259 Ga0075363_100007425
260 Ga0075364_10009613
261 Ga0075364_10035438
262 Ga0075362_10037944
263 Ga0075367_10002191
264 Ga0075370_10001823
265 Ga0075370_10005090
266 Ga0075428_100426576
267 Ga0111539_10010517
268 Ga0105247_10001737
269 Ga0105239_10007963
270 Ga0157375_10402085
271 Ga0157379_10000574
272 Ga0157379_10038172
273 Ga0163161_10024437
274 Ga0207710_10000047
275 Ga0207705_10231571
276 Ga0207700_10168123
277 Ga0207661_10062584
278 Ga0207679_10124532
279 Ga0207658_10030524
280 Ga0207703_10000107
281 Ga0207674_10058194
282 Ga0209813_10001516
283 Ga0268264_10000238
284 Ga0307515_10014830
285 Ga0307508_10093368
286 Ga0307508_10120400
287 Ga0307516_10103258
288 Ga0307409_100121497
289 Ga0307416_100110670
290 Ga0307414_10143449
291 Ga0307411_10101353
292 Ga0307510_10092249
293 Ga0373953_0102285
294 Ga0373943_0365183
295 Ga0373955_0004315
296 Ga0373937_0026741
297 Ga0372808_007073
298 Ga0373925_0011915
299 Ga0373925_0044821
300 Ga0373925_0455283
301 Ga0395900_0028780
302 Ga0451833_0341608
303 Ga0466965_0015455
304 Ga0466965_0025715
305 Ga0466965_0072261
306 Ga0466966_0090553
307 Ga0466961_0002223
308 Ga0466961_0006527
309 Ga0466961_0020389
310 Ga0466961_0067639
311 Ga0466963_0008459
312 Ga0466963_0034962
313 Ga0466971_0002432
314 Ga0466971_0048747
315 Ga0466968_0029930
316 Ga0466970_0013889
317 Ga0466970_0055584
318 Ga0466970_0081870
319 Ga0466957_0014893
320 Ga0466957_0057455
321 Ga0466957_0102865
322 Ga0466957_0325970
323 Ga0466960_0044206
324 Ga0466959_0051779
325 Ga0466958_0000549
326 Ga0466958_0254382
327 Ga0466967_0001220
328 Ga0466967_0031561
329 Ga0466967_0048840
330 Ga0466967_0061132
331 Ga0466967_0137903
332 Ga0466967_0224555
333 Ga0466967_0582382
334 Ga0495592_0043621
335 Ga0495603_0020513
336 Ga0495629_0110186
337 Ga0495651_0003095
338 Ga0495653_0004936
339 Ga0495664_0064805
340 Ga0495594_0137476
341 Ga0495608_0003564
342 Ga0495618_0121893
343 Ga0495618_0161495
344 Ga0495620_0084007
345 Ga0495628_0013908
346 Ga0495630_0053219
347 Ga0495632_0039015
348 Ga0495648_0026829
349 Ga0495666_0061260
350 Ga0495652_0001264
351 Ga0495652_0154102
352 Ga0495640_0014199
353 Ga0495640_0161765
354 Ga0495586_0017073
355 Ga0495587_0006270
356 Ga0495667_0002798
357 Ga0495667_0132105
358 Ga0495634_0062341
359 Ga0495635_0006563
360 Ga0495657_0001445
361 Ga0495657_0071735
362 Ga0495599_0026718
363 Ga0495646_0046585
364 Ga0495613_0026251
365 Ga0495624_0012226
366 Ga0495600_0004360
367 Ga0495604_0003958
368 Ga0495604_0091209
369 Ga0495674_0009906
370 Ga0495674_0270677
371 Ga0495676_0003706
372 Ga0495680_0004193
373 Ga0495675_0005019
374 Ga0495684_0004720
375 Ga0495602_0003487
376 Ga0496101_0092234
377 Ga0496102_0094908
378 Ga0496105_0010392
379 Ga0496108_0044099
380 Ga0496108_0078803
381 Ga0496108_0079421
382 Ga0496108_0123488
383 Ga0496108_0144371
384 Ga0496108_0265228
385 Ga0496109_0010580
386 Ga0496109_0091375
387 Ga0496110_0033990
388 Ga0496110_0111386
389 Ga0496110_0165157
390 Ga0496112_0055959
391 Ga0496112_0527804
392 Ga0496114_0062359
393 Ga0496114_0373421
394 Ga0496119_0032346
395 Ga0496121_0021768
396 Ga0496121_0096144
397 Ga0501032_0191339
398 Ga0501034_0000520
399 Ga0501034_0008580
400 Ga0501036_0002079
401 Ga0501038_0024826
402 Ga0501043_0060058
403 Ga0501047_0161059
404 Ga0501067_0067833
405 Ga0501068_0000466
406 Ga0501068_0012919
407 Ga0501068_0109351
408 Ga0501070_0044277
409 Ga0501070_0240069
410 Ga0501072_0060798
411 Ga0501072_0133504
412 Ga0501073_0008716
413 Ga0501074_0014108
414 Ga0501076_0012131
415 Ga0501080_0009355
416 Ga0501083_0097722
417 Ga0501035_0008892
418 nmdc:mga03n38_15949_c1
419 nmdc:mga03n38_24832_c1
420 nmdc:mga03n38_7410_c1
421 nmdc:mga00v17_71701_c1
422 nmdc:mga00v17_9063_c1
423 nmdc:mga0yw44_39442_c1
424 nmdc:mga0yw44_600_c1
425 nmdc:mga0yw44_73958_c1
426 nmdc:mga06z11_10386_c1
427 nmdc:mga06z11_70896_c1
428 nmdc:mga04h51_20200_c1
429 nmdc:mga07m45_21474_c1
430 nmdc:mga07m45_2535_c1
431 Ga0495601_0030471
432 Ga0495619_0016086
433 Ga0500644_0000093
434 Ga0500556_0000134
435 Ga0500593_000133
436 Ga0500573_0018494
437 Ga0500616_0001072
438 Ga0500616_0038614
439 Ga0466962_0000431
440 Ga0466962_0007582
441 Ga0466962_0063145
442 Ga0466962_0108187
443 2506868309
444 2528206190
445 2643826629
446 2644091354
447 2644091948
448 2644321157
449 2644321751
450 2740168728
451 2857482073
452 2858875630
453 2862182017
454 8002788774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

50

194

0.92

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

152

229

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9415 4 215
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9367 5 223
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9361 1 215
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9313 5 220
2it1-assembly1.cif.gz_B structure of ph0203 protein from pyrococcus horikoshii 0.9235 6 219
ID Description Score Start End Superfamily
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9426 5 215 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9416 2 222 3.40.50.300
af_Q8T6J0_514_774_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.939 2 223 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9382 5 223 3.40.50.300
1vplA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9367 5 223 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A519QDZ9-F1-model_v4 ABC transporter ATP-binding protein 0.9522 4 201 GO:0005524
GO:0016887
AF-A0A7C7E3U0-F1-model_v4 ABC transporter ATP-binding protein 0.948 1 215 GO:0005524
GO:0016887
AF-A0A535H2A8-F1-model_v4 ABC transporter ATP-binding protein 0.9477 4 219 GO:0005524
GO:0016887
AF-A0A535F3M6-F1-model_v4 ABC transporter ATP-binding protein 0.9471 6 222 GO:0005524
GO:0016887
AF-A0A1F9CYT8-F1-model_v4 ABC transporter domain-containing protein 0.946 21 218 GO:0005524
GO:0016887

Map