F340217

General Info

Members Datasets Scaffolds Average Seq Length
227 155 454 87

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0301148|Ga0451577_0301148_98_373
Length 91
Sequence MYMTPELVTQLARRSFEVSLMLAAPLLIFSLAVGLVISIFQAVTSINEATLAFVPKIVAVMVAMIIFFPWMMSYMSDFTREIFALIPNLRH

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
10 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
11 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
12 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
13 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
14 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
15 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
16 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
17 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
18 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
19 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
20 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
21 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
23 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
26 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
27 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
28 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
29 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
30 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
31 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
32 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
33 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
34 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
35 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
36 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
37 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
38 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
39 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
40 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
41 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
42 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
43 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
44 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
45 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
46 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
47 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
48 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
49 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
50 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
51 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
52 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
53 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
54 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
55 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
56 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
57 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
58 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
59 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
60 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
61 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
62 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
63 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
64 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
65 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
66 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
67 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
68 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
71 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
72 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
73 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
74 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
75 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
76 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
80 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
81 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
82 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
83 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
84 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
85 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
86 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
87 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
88 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
89 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
90 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
91 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
92 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
93 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
94 2671180694 Paenibacillus sp. A3 Isolate Unclassified
95 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
96 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
97 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
98 2738543017 Bacillus sp. OV186 Isolate Unclassified
99 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
100 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
101 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
102 2818991441 Niallia circulans 3243 Isolate Rhizosphere
103 2818991459 Paenibacillus sp. 597 Isolate Unclassified
104 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
105 2842682962 Bacillus sp. R-72492 Isolate Unclassified
106 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
107 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
108 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
109 2857581216 Bacillus sp. R-71922 Isolate Unclassified
110 2857586860 Bacillus sp. R-71935 Isolate Unclassified
111 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
112 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
113 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
114 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
115 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
116 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
117 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
118 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
119 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
120 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
121 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
122 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
123 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
124 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
125 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
126 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
127 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
128 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
129 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
130 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
131 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
132 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
133 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
134 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
135 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
136 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
137 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
138 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
139 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
140 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
141 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
142 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
143 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
144 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
145 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
146 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
147 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
148 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
149 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
150 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
151 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
152 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
153 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
154 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
155 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 64.32
Metatranscriptomes 2.2
Isolates 33.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.88
Bulb 0
Endosphere 8.37
Nodule 0.44
Rhizoplane 1.76
Rhizosphere 60.35
Stem 0
Stem Tuber 0
Unclassified 2.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0301148 3300042876 Bacteria 1453
2 JGI25162J39368_1009393 3300002737 Bacteria 1312
3 JGI25151J46595_10000427 3300003187 Bacteria 42073
4 JGI25151J46595_10010695 3300003187 Bacteria 4246
5 JGI25151J46595_10010705 3300003187 Bacteria 4245
6 Ga0055536_1015919 3300003781 Bacteria 2544
7 Ga0055534_1049842 3300003784 Bacteria 597
8 Ga0055541_1018382 3300003841 Bacteria 864
9 Ga0065704_10680153 3300005289 Bacteria 564
10 Ga0070709_10390925 3300005434 Bacteria 1036
11 Ga0070712_101889503 3300006175 Bacteria 523
12 Ga0105244_10164037 3300009036 Bacteria 1060
13 Ga0105244_10198567 3300009036 Bacteria 946
14 Ga0111539_12688955 3300009094 Bacteria 577
15 Ga0114129_11057648 3300009147 Bacteria 1018
16 Ga0105242_11984049 3300009176 Unclassified 624
17 Ga0105246_10009437 3300011119 Bacteria 6013
18 Ga0157371_10489051 3300013102 Bacteria 908
19 Ga0209566_100253 3300025225 Bacteria 51127
20 Ga0209566_107870 3300025225 Bacteria 1180
21 Ga0209147_103785 3300025229 Bacteria 2767
22 Ga0209147_109340 3300025229 Bacteria 1171
23 Ga0209437_100542 3300025233 Bacteria 25920
24 Ga0209130_1057615 3300025284 Bacteria 684
25 Ga0209675_1012478 3300025291 Bacteria 2733
26 Ga0209676_1001069 3300025292 Bacteria 31243
27 Ga0209025_1001098 3300025294 Bacteria 39004
28 Ga0209025_1003726 3300025294 Bacteria 13994
29 Ga0209025_1004909 3300025294 Bacteria 11252
30 Ga0207655_1069428 3300025728 Bacteria 1317
31 Ga0207699_10734963 3300025906 Bacteria 723
32 Ga0209371_1008832 3300027312 Bacteria 3283
33 Ga0268256_1010762 3300030500 Bacteria 2943
34 Ga0307509_10251224 3300031507 Bacteria 1552
35 Ga0307509_10319568 3300031507 Bacteria 1290
36 Ga0307509_10989205 3300031507 Bacteria 508
37 Ga0265313_10174650 3300031595 Unclassified 906
38 Ga0307409_100275194 3300031995 Bacteria 1553
39 Ga0307416_100672754 3300032002 Bacteria 1122
40 Ga0373925_0170802 3300037068 Bacteria 1717
41 Ga0395900_0272289 3300037418 Bacteria 1688
42 Ga0395900_1386891 3300037418 Unclassified 616
43 Ga0395898_0337213 3300037466 Bacteria 1438
44 Ga0395901_1521012 3300038443 Bacteria 625
45 Ga0439439_0001748 3300041406 Bacteria 4435
46 Ga0439439_0029683 3300041406 Bacteria 1388
47 Ga0451855_0876138 3300041511 Bacteria 1017
48 Ga0439433_0021443 3300041999 Bacteria 1445
49 Ga0439449_0000070 3300042007 Bacteria 32061
50 Ga0439462_0002041 3300042015 Bacteria 4634
51 Ga0439462_0106958 3300042015 Bacteria 773
52 Ga0451577_0003077 3300042876 Bacteria 18865
53 Ga0451577_0004899 3300042876 Bacteria 13953
54 Ga0451577_0082693 3300042876 Bacteria 2864
55 Ga0451577_0209636 3300042876 Bacteria 1760
56 Ga0451577_0263414 3300042876 Bacteria 1561
57 Ga0451577_1004170 3300042876 Bacteria 749
58 Ga0453683_0000165 3300044673 Bacteria 94483
59 Ga0453683_0024234 3300044673 Bacteria 3863
60 Ga0453683_0075654 3300044673 Bacteria 2107
61 Ga0453683_0218744 3300044673 Bacteria 1211
62 Ga0453683_0321451 3300044673 Bacteria 992
63 Ga0453683_0430003 3300044673 Bacteria 853
64 Ga0453683_0525675 3300044673 Bacteria 769
65 Ga0453683_0885019 3300044673 Bacteria 590
66 Ga0453683_1169085 3300044673 Bacteria 514
67 Ga0453684_0000123 3300044712 Bacteria 339304
68 Ga0453684_0000903 3300044712 Bacteria 99008
69 Ga0453684_0001709 3300044712 Bacteria 59094
70 Ga0453684_0002222 3300044712 Bacteria 48165
71 Ga0453684_0003876 3300044712 Bacteria 32928
72 Ga0453684_0008391 3300044712 Bacteria 18536
73 Ga0453684_0016726 3300044712 Bacteria 11439
74 Ga0453684_0030983 3300044712 Bacteria 7536
75 Ga0453684_0055569 3300044712 Bacteria 5146
76 Ga0453684_0067529 3300044712 Bacteria 4546
77 Ga0453684_0094224 3300044712 Bacteria 3684
78 Ga0453684_0116428 3300044712 Bacteria 3236
79 Ga0453684_0256821 3300044712 Bacteria 2004
80 Ga0453684_0269944 3300044712 Bacteria 1944
81 Ga0453684_0324488 3300044712 Bacteria 1742
82 Ga0453684_0360884 3300044712 Bacteria 1636
83 Ga0453684_0875456 3300044712 Bacteria 963
84 Ga0453684_0905229 3300044712 Bacteria 944
85 Ga0453684_1602413 3300044712 Bacteria 668
86 Ga0453684_1623775 3300044712 Unclassified 663
87 Ga0453684_2214914 3300044712 Unclassified 548
88 Ga0453684_2477369 3300044712 Bacteria 512
89 Ga0466960_0688992 3300044901 Bacteria 612
90 Ga0451576_0001553 3300045051 Bacteria 38677
91 Ga0451576_0030175 3300045051 Bacteria 5798
92 Ga0451576_0042796 3300045051 Unclassified 4782
93 Ga0451576_0131473 3300045051 Bacteria 2609
94 Ga0451576_0392989 3300045051 Bacteria 1454
95 Ga0451576_0463406 3300045051 Bacteria 1331
96 Ga0451576_0642187 3300045051 Bacteria 1115
97 Ga0451576_0689636 3300045051 Bacteria 1073
98 Ga0451576_0878672 3300045051 Bacteria 941
99 Ga0451576_0890673 3300045051 Bacteria 934
100 Ga0451576_1189554 3300045051 Bacteria 796
101 Ga0451576_1598908 3300045051 Bacteria 676
102 Ga0451576_1710542 3300045051 Bacteria 651
103 Ga0451576_2229403 3300045051 Bacteria 562
104 Ga0495603_0804806 3300046455 Bacteria 536
105 Ga0495585_0494398 3300046492 Bacteria 582
106 Ga0495607_0328773 3300046501 Bacteria 711
107 Ga0495606_0109543 3300046507 Bacteria 1668
108 Ga0495620_0119772 3300046515 Bacteria 1038
109 Ga0495654_0377482 3300046530 Bacteria 566
110 Ga0495661_0080288 3300046665 Bacteria 1883
111 Ga0495649_0511778 3300046694 Bacteria 596
112 Ga0495626_0063626 3300048091 Bacteria 1673
113 Ga0496104_0902972 3300048907 Bacteria 788
114 Ga0496110_0034397 3300048913 Bacteria 4389
115 Ga0496111_0022771 3300048914 Bacteria 4390
116 Ga0496113_0895102 3300048916 Bacteria 702
117 Ga0496116_0005512 3300048919 Bacteria 11696
118 Ga0496116_0008662 3300048919 Bacteria 8799
119 Ga0496116_0020979 3300048919 Bacteria 4940
120 Ga0496117_0004998 3300048920 Bacteria 14225
121 Ga0496118_0040686 3300048921 Bacteria 3692
122 Ga0496119_0136683 3300048922 Bacteria 1328
123 Ga0496120_0088576 3300048923 Bacteria 1658
124 Ga0496121_0015639 3300048924 Bacteria 7919
125 Ga0496121_0065741 3300048924 Bacteria 2948
126 Ga0496121_0308616 3300048924 Bacteria 1071
127 Ga0496122_0019520 3300048925 Bacteria 6186
128 Ga0496122_0045302 3300048925 Bacteria 3420
129 Ga0496122_0082578 3300048925 Bacteria 2231
130 Ga0496123_0002669 3300048926 Bacteria 21505
131 Ga0496123_0009064 3300048926 Bacteria 9012
132 Ga0496123_0354834 3300048926 Bacteria 681
133 Ga0496124_0014543 3300048927 Bacteria 7602
134 Ga0496124_0043974 3300048927 Bacteria 3836
135 Ga0496124_0205687 3300048927 Bacteria 1493
136 Ga0496124_0351880 3300048927 Bacteria 1042
137 Ga0496125_0001554 3300048928 Bacteria 32767
138 Ga0496125_0006231 3300048928 Bacteria 12974
139 Ga0496126_0193470 3300048929 Bacteria 1721
140 Ga0501312_001787 3300049528 Bacteria 2201
141 Ga0501335_030482 3300049551 Bacteria 608
142 Ga0501072_0964727 3300049588 Bacteria 665
143 Ga0501208_020894 3300049655 Bacteria 1069
144 Ga0501216_167578 3300049660 Bacteria 530
145 Ga0501217_001691 3300049661 Bacteria 4201
146 Ga0501083_0329390 3300049744 Bacteria 993
147 Ga0500639_266638 3300053163 Bacteria 672
148 Ga0587083_0195149 3300059505 Bacteria 575
149 Ga0587067_017430 3300059640 Bacteria 1192
150 Ga0587072_066137 3300059643 Bacteria 755
151 Ga0501082_1683975 3300060353 Bacteria 553
152 2512035516 2511231221 Bacteria 6846400
153 2512734603 2512564039 Bacteria 8739048
154 2523105620 2522572158 Bacteria 6514390
155 2524186349 2524023129 Bacteria 6762600
156 2524609516 2524023250 Bacteria 5457705
157 2540606766 2540341094 Bacteria 4061186
158 2556063151 2554235469 Bacteria 3590176
159 2563929639 2563366752 Bacteria 4961801
160 2587738102 2585428059 Bacteria 8696589
161 2595316672 2593339198 Bacteria 7267884
162 2599101850 2597490356 Bacteria 7030811
163 2643739990 2643221543 Bacteria 6628015
164 2644421425 2643221676 Bacteria 8119172
165 2672335120 2671180330 Bacteria 5521719
166 2673817524 2671180694 Bacteria 7506943
167 2712199609 2711768088 Bacteria 3195027
168 2723603517 2721755693 Bacteria 6126117
169 2730139512 2728369359 Bacteria 5621728
170 2739268561 2738543017 Bacteria 4271950
171 2753808173 2751185905 Bacteria 6142767
172 2793182979 2791355222 Bacteria 5898266
173 2802435965 2802428803 Bacteria 5806948
174 2819567586 2818991441 Bacteria 5062707
175 2819670170 2818991459 Bacteria 8736032
176 2821113565 2821111986 Bacteria 6894338
177 2842685107 2842682962 Bacteria 5589973
178 2846957994 2846952575 Bacteria 6587527
179 2848864509 2848858292 Bacteria 7391279
180 2857456922 2857453340 Bacteria 8090534
181 2857584248 2857581216 Bacteria 5522813
182 2857588590 2857586860 Bacteria 4354574
183 2857605140 2857604169 Bacteria 5111450
184 2864734148 2864733723 Bacteria 6770668
185 2864997616 2864997549 Bacteria 5139696
186 2865005947 2865002811 Bacteria 6333767
187 2885526934 2885526491 Bacteria 7164189
188 2888581371 2888578766 Bacteria 6743310
189 2889044812 2889042446 Bacteria 7618936
190 2889050004 2889049205 Bacteria 7524325
191 2889279442 2889276214 Bacteria 5979355
192 2889296429 2889295896 Bacteria 4704906
193 2897804975 2897803580 Bacteria 7000062
194 2898907679 2898907183 Bacteria 4067722
195 2904115049 2904113452 Bacteria 7796941
196 2904165459 2904162308 Bacteria 7086713
197 2904491698 2904490793 Bacteria 7046938
198 2904596771 2904595352 Bacteria 6124848
199 2904756939 2904755435 Bacteria 7986759
200 2907203799 2907202186 Bacteria 6632024
201 2919160955 2919160200 Bacteria 6929020
202 2919430968 2919425241 Bacteria 8055701
203 2925329942 2925326138 Bacteria 9652120
204 2929210345 2929206907 Bacteria 5918291
205 2931388248 2931384279 Bacteria 7299545
206 2939681383 2939679117 Bacteria 6921672
207 2939703500 2939702853 Bacteria 5139229
208 2945993145 2945991243 Bacteria 7008369
209 2946055899 2946053406 Bacteria 6978655
210 2971411723 2971410472 Bacteria 8311090
211 2980128198 2980125574 Bacteria 5567337
212 2980184610 2980182181 Bacteria 9454109
213 2981284894 2981284811 Bacteria 4641497
214 2981289838 2981289755 Bacteria 4641509
215 2981981524 2981980479 Bacteria 4641628
216 2981986420 2981985349 Bacteria 4641497
217 2984528992 2984527788 Bacteria 5288478
218 2984535094 2984532647 Bacteria 5288506
219 2996710321 2996706504 Bacteria 5757485
220 3006974846 3006973921 Bacteria 4423788
221 648169826 648028048 Bacteria 5394884
222 8054007976 8054002106 Bacteria 7987183
223 8054281886 8054280661 Bacteria 4232245
224 8054795947 8054795415 Bacteria 9785225
225 8055635501 8055632911 Bacteria 5283357
226 8056539696 8056533031 Bacteria 8964429
227 8057978724 8057977335 Bacteria 5694872
228 Ga0451577_0301148
229 JGI25162J39368_1009393
230 JGI25151J46595_10000427
231 JGI25151J46595_10010695
232 JGI25151J46595_10010705
233 Ga0055536_1015919
234 Ga0055534_1049842
235 Ga0055541_1018382
236 Ga0065704_10680153
237 Ga0070709_10390925
238 Ga0070712_101889503
239 Ga0105244_10164037
240 Ga0105244_10198567
241 Ga0111539_12688955
242 Ga0114129_11057648
243 Ga0105242_11984049
244 Ga0105246_10009437
245 Ga0157371_10489051
246 Ga0209566_100253
247 Ga0209566_107870
248 Ga0209147_103785
249 Ga0209147_109340
250 Ga0209437_100542
251 Ga0209130_1057615
252 Ga0209675_1012478
253 Ga0209676_1001069
254 Ga0209025_1001098
255 Ga0209025_1003726
256 Ga0209025_1004909
257 Ga0207655_1069428
258 Ga0207699_10734963
259 Ga0209371_1008832
260 Ga0268256_1010762
261 Ga0307509_10251224
262 Ga0307509_10319568
263 Ga0307509_10989205
264 Ga0265313_10174650
265 Ga0307409_100275194
266 Ga0307416_100672754
267 Ga0373925_0170802
268 Ga0395900_0272289
269 Ga0395900_1386891
270 Ga0395898_0337213
271 Ga0395901_1521012
272 Ga0439439_0001748
273 Ga0439439_0029683
274 Ga0451855_0876138
275 Ga0439433_0021443
276 Ga0439449_0000070
277 Ga0439462_0002041
278 Ga0439462_0106958
279 Ga0451577_0003077
280 Ga0451577_0004899
281 Ga0451577_0082693
282 Ga0451577_0209636
283 Ga0451577_0263414
284 Ga0451577_1004170
285 Ga0453683_0000165
286 Ga0453683_0024234
287 Ga0453683_0075654
288 Ga0453683_0218744
289 Ga0453683_0321451
290 Ga0453683_0430003
291 Ga0453683_0525675
292 Ga0453683_0885019
293 Ga0453683_1169085
294 Ga0453684_0000123
295 Ga0453684_0000903
296 Ga0453684_0001709
297 Ga0453684_0002222
298 Ga0453684_0003876
299 Ga0453684_0008391
300 Ga0453684_0016726
301 Ga0453684_0030983
302 Ga0453684_0055569
303 Ga0453684_0067529
304 Ga0453684_0094224
305 Ga0453684_0116428
306 Ga0453684_0256821
307 Ga0453684_0269944
308 Ga0453684_0324488
309 Ga0453684_0360884
310 Ga0453684_0875456
311 Ga0453684_0905229
312 Ga0453684_1602413
313 Ga0453684_1623775
314 Ga0453684_2214914
315 Ga0453684_2477369
316 Ga0466960_0688992
317 Ga0451576_0001553
318 Ga0451576_0030175
319 Ga0451576_0042796
320 Ga0451576_0131473
321 Ga0451576_0392989
322 Ga0451576_0463406
323 Ga0451576_0642187
324 Ga0451576_0689636
325 Ga0451576_0878672
326 Ga0451576_0890673
327 Ga0451576_1189554
328 Ga0451576_1598908
329 Ga0451576_1710542
330 Ga0451576_2229403
331 Ga0495603_0804806
332 Ga0495585_0494398
333 Ga0495607_0328773
334 Ga0495606_0109543
335 Ga0495620_0119772
336 Ga0495654_0377482
337 Ga0495661_0080288
338 Ga0495649_0511778
339 Ga0495626_0063626
340 Ga0496104_0902972
341 Ga0496110_0034397
342 Ga0496111_0022771
343 Ga0496113_0895102
344 Ga0496116_0005512
345 Ga0496116_0008662
346 Ga0496116_0020979
347 Ga0496117_0004998
348 Ga0496118_0040686
349 Ga0496119_0136683
350 Ga0496120_0088576
351 Ga0496121_0015639
352 Ga0496121_0065741
353 Ga0496121_0308616
354 Ga0496122_0019520
355 Ga0496122_0045302
356 Ga0496122_0082578
357 Ga0496123_0002669
358 Ga0496123_0009064
359 Ga0496123_0354834
360 Ga0496124_0014543
361 Ga0496124_0043974
362 Ga0496124_0205687
363 Ga0496124_0351880
364 Ga0496125_0001554
365 Ga0496125_0006231
366 Ga0496126_0193470
367 Ga0501312_001787
368 Ga0501335_030482
369 Ga0501072_0964727
370 Ga0501208_020894
371 Ga0501216_167578
372 Ga0501217_001691
373 Ga0501083_0329390
374 Ga0500639_266638
375 Ga0587083_0195149
376 Ga0587067_017430
377 Ga0587072_066137
378 Ga0501082_1683975
379 2512035516
380 2512734603
381 2523105620
382 2524186349
383 2524609516
384 2540606766
385 2556063151
386 2563929639
387 2587738102
388 2595316672
389 2599101850
390 2643739990
391 2644421425
392 2672335120
393 2673817524
394 2712199609
395 2723603517
396 2730139512
397 2739268561
398 2753808173
399 2793182979
400 2802435965
401 2819567586
402 2819670170
403 2821113565
404 2842685107
405 2846957994
406 2848864509
407 2857456922
408 2857584248
409 2857588590
410 2857605140
411 2864734148
412 2864997616
413 2865005947
414 2885526934
415 2888581371
416 2889044812
417 2889050004
418 2889279442
419 2889296429
420 2897804975
421 2898907679
422 2904115049
423 2904165459
424 2904491698
425 2904596771
426 2904756939
427 2907203799
428 2919160955
429 2919430968
430 2925329942
431 2929210345
432 2931388248
433 2939681383
434 2939703500
435 2945993145
436 2946055899
437 2971411723
438 2980128198
439 2980184610
440 2981284894
441 2981289838
442 2981981524
443 2981986420
444 2984528992
445 2984535094
446 2996710321
447 3006974846
448 648169826
449 8054007976
450 8054281886
451 8054795947
452 8055635501
453 8056539696
454 8057978724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01313

Bac_export_3

Bacterial export proteins, family 3

7

80

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s3s-assembly1.cif.gz_J structure of the flipqr complex from the flagellar type 3 secretion system of vibrio mimicus. 0.9092 1 89
6rwy-assembly1.cif.gz_i export apparatus core and inner rod of the shigella type 3 secretion system 0.9032 4 86
6s3s-assembly1.cif.gz_J structure of the flipqr complex from the flagellar type 3 secretion system of vibrio mimicus. 0.8989 1 89
6s3s-assembly1.cif.gz_H structure of the flipqr complex from the flagellar type 3 secretion system of vibrio mimicus. 0.8858 1 89
6s3l-assembly1.cif.gz_G structure of the core of the flagellar export apparatus from vibrio mimicus, the flipqr-flhb complex. 0.8812 1 89
ID Description Score Start End Superfamily
4cbjB00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.7754 16 75 1.20.20.10
4cbjB00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.6813 16 75 1.20.20.10
4v1hA00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.6488 9 72 1.20.20.10
4v1fC00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.6314 9 79 1.20.20.10
4v1fB00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.627 9 79 1.20.20.10
ID Description Score Start End GO Terms
AF-A0A2G6HW22-F1-model_v4 Flagellar biosynthetic protein FliQ 0.9869 1 89 GO:0005886
GO:0009306
GO:0009425
GO:0044780
AF-A0A6I0EUC9-F1-model_v4 Flagellar biosynthetic protein FliQ 0.9858 1 87 GO:0005886
GO:0009306
GO:0009425
GO:0044780
AF-U4QRS8-F1-model_v4 Flagellar biosynthetic protein FliQ 0.9797 1 84 GO:0005886
GO:0009306
GO:0009425
GO:0044780
AF-D2TZS3-F1-model_v4 Type III secretion protein EscS,SsaS,YscS 0.979 14 84 GO:0005886
GO:0009306
AF-A0A143BH96-F1-model_v4 Transporter 0.9786 1 89 GO:0005886
GO:0009306

Map