F340057

General Info

Members Datasets Scaffolds Average Seq Length
227 159 454 395

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10062478|Ga0207428_100624781
Length 444
Sequence MKGTTGSGPISARSSDMFFAQINETDVEVKMNLTSTSKCAIPFSTTMAINKKCQFPVFDADNHLYETKDAFTRHLPSRYKHAIEYVEVRGRTKIAVRGTISDYIPNPTFDVVARPGAHEDFYKRGNPEGKSLRELTGEPMHCIPAFREPGPRLELMDELGIDRALMFPTLASLLEERMRDDPDMIHAVVHSLNEWLHETWSFNYENRIFTVPVISLPVVDKAIAELEWVLERGARTILVRPAPVPGYRHSRSFAYPEFDPFWKRVEEAGILVSLHSSDSGYARYQSDWTGPSEMLPFKFDAFRMMSMLKRPIEDSMAAVVCHGLVTRFPRLKIAVIENGGSWVPHFLEQLADVYKKMPQAFGEDPIQAFKRNVYVSPFFEDNLEELIAEMGADHILFGSDYPHPEGLAEPCTYVEHLPRGTSPEDVRKIMGGTLGELMGVDATA

Samples

Sample ID Description Type Environment
1 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
15 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
28 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
34 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
36 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
37 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
38 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
39 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
40 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
43 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
44 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
45 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
46 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
47 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
48 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
49 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
50 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
51 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
52 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
53 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
54 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
55 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
56 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
57 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
58 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
59 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
60 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
63 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
64 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
65 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
66 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
67 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
68 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
69 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
70 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
71 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
72 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
73 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
74 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
75 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
76 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
77 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
78 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
79 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
83 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
84 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
87 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
88 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
91 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
92 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
107 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
108 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
120 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
121 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
130 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
131 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
132 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
133 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
137 2508501039 Frankia saprophytica CN3 Isolate Nodule
138 2517572101 Frankia sp. DC12 Isolate Nodule
139 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
140 2547132424 Nocardia nova SH22a Isolate Unclassified
141 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
142 2643221692 Nocardia sp. Root136 Isolate Unclassified
143 2671180195 Frankia sp. CcI49 Isolate Nodule
144 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
145 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
146 2687453737 Frankia sp. BMG5.36 Isolate Nodule
147 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
148 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
149 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
150 2773857922 Frankia sp. CcI49 Isolate Nodule
151 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
152 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
153 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
154 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
155 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
156 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
157 8002775197 Frankia nepalensis CN7 Isolate Nodule
158 8002784119 Frankia sp. AgB1.9 Isolate Nodule
159 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.5
Metatranscriptomes 0
Isolates 18.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.89
Nodule 11.45
Rhizoplane 0.88
Rhizosphere 66.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207428_10062478 3300027907 Bacteria 2944
2 JGI25407J50210_10000036 3300003373 Bacteria 14603
3 Ga0070671_100177204 3300005355 Bacteria 1804
4 Ga0070714_100090838 3300005435 Bacteria 2675
5 Ga0070706_100016873 3300005467 Bacteria 6744
6 Ga0070706_100050386 3300005467 Bacteria 3842
7 Ga0070707_100149039 3300005468 Bacteria 2277
8 Ga0070698_100001547 3300005471 Bacteria 25515
9 Ga0070698_100041655 3300005471 Bacteria 4714
10 Ga0070699_100012730 3300005518 Bacteria 7250
11 Ga0070697_100075145 3300005536 Bacteria 2777
12 Ga0068855_100066012 3300005563 Bacteria 4219
13 Ga0068860_100004631 3300005843 Bacteria 14044
14 Ga0081455_10008365 3300005937 Bacteria 10768
15 Ga0081455_10016998 3300005937 Bacteria 6993
16 Ga0075365_10007243 3300006038 Bacteria 6199
17 Ga0075365_10021741 3300006038 Bacteria 4007
18 Ga0075368_10001566 3300006042 Bacteria 7346
19 Ga0075368_10013233 3300006042 Bacteria 3027
20 Ga0075363_100056060 3300006048 Bacteria 2112
21 Ga0075364_10000659 3300006051 Bacteria 17879
22 Ga0075364_10043817 3300006051 Bacteria 2909
23 Ga0075367_10017532 3300006178 Bacteria 3932
24 Ga0075369_10024338 3300006186 Bacteria 2508
25 Ga0075428_100012634 3300006844 Bacteria 9389
26 Ga0075428_100083407 3300006844 Bacteria 3487
27 Ga0075430_100005685 3300006846 Bacteria 10518
28 Ga0075430_100031780 3300006846 Bacteria 4480
29 Ga0075430_100046856 3300006846 Bacteria 3650
30 Ga0075431_100039609 3300006847 Bacteria 4855
31 Ga0075431_100072775 3300006847 Bacteria 3546
32 Ga0075431_100101333 3300006847 Bacteria 2971
33 Ga0075431_100108620 3300006847 Bacteria 2863
34 Ga0075431_100142007 3300006847 Bacteria 2475
35 Ga0075429_100035566 3300006880 Bacteria 4332
36 Ga0075429_100040174 3300006880 Bacteria 4072
37 Ga0099826_10037424 3300006948 Bacteria 3420
38 Ga0111539_10130254 3300009094 Bacteria 2946
39 Ga0114129_10000160 3300009147 Bacteria 72462
40 Ga0114129_10057828 3300009147 Bacteria 5425
41 Ga0114129_10091636 3300009147 Bacteria 4211
42 Ga0114129_10119270 3300009147 Bacteria 3634
43 Ga0163163_10114135 3300014325 Bacteria 2732
44 Ga0213876_10034793 3300021384 Bacteria 2657
45 Ga0207684_10020246 3300025910 Bacteria 5684
46 Ga0207644_10039186 3300025931 Bacteria 3343
47 Ga0207709_10087861 3300025935 Bacteria 2022
48 Ga0207689_10132581 3300025942 Bacteria 2051
49 Ga0207703_10002341 3300026035 Bacteria 16519
50 Ga0209813_10012462 3300027866 Bacteria 2248
51 Ga0268264_10003239 3300028381 Bacteria 14088
52 Ga0265334_10032343 3300028573 Bacteria 2086
53 Ga0307515_10023776 3300028794 Bacteria 10717
54 Ga0307515_10078953 3300028794 Bacteria 4319
55 Ga0265338_10034363 3300028800 Bacteria 4902
56 Ga0307512_10017749 3300030522 Bacteria 6516
57 Ga0307512_10058702 3300030522 Bacteria 2994
58 Ga0307512_10058774 3300030522 Bacteria 2991
59 Ga0265327_10013285 3300031251 Bacteria 5480
60 Ga0265327_10041593 3300031251 Bacteria 2475
61 Ga0307513_10041224 3300031456 Bacteria 5099
62 Ga0307508_10095670 3300031616 Bacteria 2561
63 Ga0307514_10081721 3300031649 Bacteria 2387
64 Ga0307516_10085128 3300031730 Bacteria 2999
65 Ga0307415_100026593 3300032126 Bacteria 3653
66 Ga0307507_10000003 3300033179 Bacteria 371707
67 Ga0373928_0006023 3300035084 Bacteria 2324
68 Ga0373942_0000203 3300035207 Bacteria 15271
69 Ga0373962_0008839 3300035242 Bacteria 2487
70 Ga0316574_0069072 3300035398 Bacteria 2229
71 Ga0373931_0000005 3300035691 Bacteria 480485
72 Ga0373937_0021521 3300036401 Bacteria 5788
73 Ga0373937_0131958 3300036401 Bacteria 2333
74 Ga0373937_0141045 3300036401 Bacteria 2255
75 Ga0316584_0008993 3300036712 Bacteria 6909
76 Ga0316584_0075735 3300036712 Bacteria 2522
77 Ga0436365_1833491 3300039437 Bacteria 11026
78 Ga0436361_0283615 3300039447 Bacteria 2419
79 Ga0451845_0196511 3300041501 Bacteria 1617
80 Ga0451853_1864323 3300041512 Bacteria 2289
81 Ga0439448_0007403 3300042005 Bacteria 3183
82 Ga0439440_0001490 3300042993 Bacteria 4282
83 Ga0466961_0070718 3300044693 Bacteria 2215
84 Ga0466959_0167842 3300045049 Bacteria 1540
85 Ga0466967_0097975 3300045976 Bacteria 2677
86 Ga0495651_0204154 3300046462 Bacteria 1381
87 Ga0495605_0012189 3300046474 Bacteria 4773
88 Ga0495639_0010842 3300046475 Bacteria 3926
89 Ga0495607_0020690 3300046501 Bacteria 4153
90 Ga0495606_0003145 3300046507 Bacteria 17893
91 Ga0495616_0013459 3300046513 Bacteria 4614
92 Ga0495620_0003668 3300046515 Bacteria 8769
93 Ga0495628_0003185 3300046516 Bacteria 14705
94 Ga0495630_0019453 3300046517 Bacteria 4991
95 Ga0495630_0053706 3300046517 Bacteria 3017
96 Ga0495630_0099777 3300046517 Bacteria 2197
97 Ga0495631_0003312 3300046518 Bacteria 8859
98 Ga0495586_0019921 3300046535 Bacteria 3573
99 Ga0495586_0026497 3300046535 Bacteria 3102
100 Ga0495609_0043303 3300046538 Bacteria 2021
101 Ga0495621_0041437 3300046539 Bacteria 1617
102 Ga0495597_0030901 3300046542 Bacteria 2438
103 Ga0495622_0071294 3300046557 Bacteria 1603
104 Ga0495668_0029200 3300046616 Bacteria 3116
105 Ga0495634_0020867 3300046642 Bacteria 4641
106 Ga0495611_0006860 3300046648 Bacteria 4840
107 Ga0495625_0129059 3300046660 Bacteria 1713
108 Ga0495613_0000365 3300046689 Bacteria 39454
109 Ga0495670_0103430 3300046691 Bacteria 1469
110 Ga0495589_0015238 3300046794 Bacteria 3956
111 Ga0495604_0192809 3300047317 Bacteria 1419
112 Ga0495680_0007764 3300047322 Bacteria 9795
113 Ga0495593_0012599 3300047673 Bacteria 4828
114 Ga0495614_0041536 3300048089 Bacteria 1973
115 Ga0495626_0044973 3300048091 Bacteria 2063
116 Ga0496104_0123113 3300048907 Bacteria 2490
117 Ga0496114_0180791 3300048917 Bacteria 1842
118 Ga0495678_060853 3300049459 Bacteria 1419
119 Ga0501031_0039315 3300049568 Bacteria 3086
120 Ga0501032_0013394 3300049569 Bacteria 5835
121 Ga0501033_0000265 3300049570 Bacteria 50268
122 Ga0501033_0009305 3300049570 Bacteria 7569
123 Ga0501034_0038285 3300049571 Bacteria 4857
124 Ga0501036_0009807 3300049572 Bacteria 7887
125 Ga0501037_0006701 3300049573 Bacteria 8422
126 Ga0501038_0045745 3300049574 Bacteria 3798
127 Ga0501039_0037593 3300049575 Bacteria 3737
128 Ga0501040_0000769 3300049576 Bacteria 19943
129 Ga0501041_0005266 3300049577 Bacteria 7560
130 Ga0501043_0003545 3300049579 Bacteria 12825
131 Ga0501048_0005203 3300049582 Bacteria 9912
132 Ga0501068_0008940 3300049584 Bacteria 5591
133 Ga0501068_0084826 3300049584 Bacteria 1949
134 Ga0501070_0021432 3300049586 Bacteria 5420
135 Ga0501070_0031444 3300049586 Bacteria 4448
136 Ga0501070_0295859 3300049586 Bacteria 1319
137 Ga0501071_0004016 3300049587 Bacteria 9286
138 Ga0501072_0001259 3300049588 Bacteria 18913
139 Ga0501072_0015373 3300049588 Bacteria 5869
140 Ga0501073_0096393 3300049589 Bacteria 2054
141 Ga0501074_0040291 3300049590 Bacteria 3384
142 Ga0501075_0023079 3300049591 Bacteria 4552
143 Ga0501076_0029459 3300049592 Bacteria 4269
144 Ga0501076_0258652 3300049592 Bacteria 1425
145 Ga0501077_0001540 3300049593 Bacteria 13886
146 Ga0501077_0083521 3300049593 Bacteria 2024
147 Ga0501080_0001136 3300049742 Bacteria 21919
148 Ga0501080_0266407 3300049742 Bacteria 1560
149 Ga0501081_0000407 3300049743 Bacteria 23887
150 Ga0501083_0001154 3300049744 Bacteria 17779
151 Ga0501035_0125195 3300049822 Bacteria 2244
152 Ga0501044_0000365 3300049823 Bacteria 56845
153 Ga0501044_0014706 3300049823 Bacteria 8438
154 Ga0501045_0014913 3300049824 Bacteria 5513
155 Ga0501045_0131572 3300049824 Bacteria 1860
156 nmdc:mga03683_13227_c1 3300050489 Bacteria 2230
157 nmdc:mga03683_68590_c1 3300050489 Bacteria 1511
158 nmdc:mga00v17_146478_c1 3300050491 Bacteria 1516
159 nmdc:mga00v17_15869_c1 3300050491 Bacteria 4238
160 nmdc:mga00v17_3921_c1 3300050491 Bacteria 7675
161 nmdc:mga00v17_42459_c1 3300050491 Bacteria 2735
162 nmdc:mga0yw44_11392_c1 3300050492 Bacteria 4587
163 nmdc:mga0yw44_379_c1 3300050492 Bacteria 15437
164 nmdc:mga0yw44_46453_c1 3300050492 Bacteria 2607
165 nmdc:mga0yw44_4686_c1 3300050492 Bacteria 6319
166 nmdc:mga06z11_1462_c1 3300050494 Bacteria 8791
167 nmdc:mga04h51_3755_c1 3300050495 Bacteria 3722
168 nmdc:mga05p37_86324_c1 3300050507 Bacteria 3867
169 nmdc:mga09592_24545_c1 3300050508 Bacteria 4986
170 nmdc:mga06r32_119795_c1 3300050510 Bacteria 2595
171 nmdc:mga06r32_43512_c1 3300050510 Bacteria 4273
172 nmdc:mga06r32_48045_c1 3300050510 Bacteria 4079
173 nmdc:mga08y16_100895_c1 3300050511 Bacteria 3005
174 Ga0495601_0000136 3300053077 Bacteria 41775
175 Ga0495612_0004947 3300053078 Bacteria 5515
176 Ga0500583_0093859 3300053092 Bacteria 1463
177 Ga0500566_0002379 3300053094 Bacteria 11128
178 Ga0500566_0081537 3300053094 Bacteria 1799
179 Ga0500652_000117 3300053131 Bacteria 30916
180 Ga0500559_0010934 3300053136 Bacteria 3888
181 Ga0501084_0002109 3300054114 Bacteria 15892
182 Ga0501084_0003366 3300054114 Bacteria 12948
183 Ga0501082_0035781 3300060353 Bacteria 4279
184 Ga0501082_0301153 3300060353 Bacteria 1396
185 Ga0530510_0011244 3300061734 Bacteria 6279
186 2508676555 2508501039 Bacteria 9978592
187 2508676560 2508501039 Bacteria 9978592
188 2517763228 2517572101 Bacteria 6884336
189 2517763232 2517572101 Bacteria 6884336
190 2523382930 2523231044 Bacteria 6434991
191 2548696433 2547132424 Bacteria 8348532
192 2616697771 2616644814 Bacteria 11555299
193 2644511657 2643221692 Bacteria 7282860
194 2671833297 2671180195 Bacteria 9757215
195 2671836923 2671180195 Bacteria 9757215
196 2676200531 2675902999 Bacteria 9438463
197 2676200630 2675902999 Bacteria 9438463
198 2686539125 2684623035 Bacteria 8032739
199 2686539407 2684623035 Bacteria 8032739
200 2686539994 2684623035 Bacteria 8032739
201 2686540380 2684623035 Bacteria 8032739
202 2689956978 2687453737 Bacteria 11203906
203 2689963799 2687453737 Bacteria 11203906
204 2689964363 2687453737 Bacteria 11203906
205 2689993786 2687453743 Bacteria 8361025
206 2689994601 2687453743 Bacteria 8361025
207 2738890743 2738541308 Bacteria 7020677
208 2774845109 2773857921 Bacteria 9435764
209 2774845208 2773857921 Bacteria 9435764
210 2774851453 2773857922 Bacteria 9757215
211 2774855079 2773857922 Bacteria 9757215
212 2809193495 2808606439 Bacteria 5952208
213 2895887648 2895880812 Bacteria 11255272
214 2895887688 2895880812 Bacteria 11255272
215 2895888811 2895880812 Bacteria 11255272
216 2919713665 2919713450 Bacteria 7431245
217 2954691639 2954691527 Bacteria 10720516
218 2954706732 2954701450 Bacteria 10834262
219 3003006622 3002998708 Bacteria 11715108
220 8002776597 8002775197 Bacteria 10728764
221 8002776602 8002775197 Bacteria 10728764
222 8002779768 8002775197 Bacteria 10728764
223 8002786936 8002784119 Bacteria 9788632
224 8002788449 8002784119 Bacteria 9788632
225 8002788454 8002784119 Bacteria 9788632
226 8002788597 8002784119 Bacteria 9788632
227 8055161835 8055157932 Bacteria 6429399
228 Ga0207428_10062478
229 JGI25407J50210_10000036
230 Ga0070671_100177204
231 Ga0070714_100090838
232 Ga0070706_100016873
233 Ga0070706_100050386
234 Ga0070707_100149039
235 Ga0070698_100001547
236 Ga0070698_100041655
237 Ga0070699_100012730
238 Ga0070697_100075145
239 Ga0068855_100066012
240 Ga0068860_100004631
241 Ga0081455_10008365
242 Ga0081455_10016998
243 Ga0075365_10007243
244 Ga0075365_10021741
245 Ga0075368_10001566
246 Ga0075368_10013233
247 Ga0075363_100056060
248 Ga0075364_10000659
249 Ga0075364_10043817
250 Ga0075367_10017532
251 Ga0075369_10024338
252 Ga0075428_100012634
253 Ga0075428_100083407
254 Ga0075430_100005685
255 Ga0075430_100031780
256 Ga0075430_100046856
257 Ga0075431_100039609
258 Ga0075431_100072775
259 Ga0075431_100101333
260 Ga0075431_100108620
261 Ga0075431_100142007
262 Ga0075429_100035566
263 Ga0075429_100040174
264 Ga0099826_10037424
265 Ga0111539_10130254
266 Ga0114129_10000160
267 Ga0114129_10057828
268 Ga0114129_10091636
269 Ga0114129_10119270
270 Ga0163163_10114135
271 Ga0213876_10034793
272 Ga0207684_10020246
273 Ga0207644_10039186
274 Ga0207709_10087861
275 Ga0207689_10132581
276 Ga0207703_10002341
277 Ga0209813_10012462
278 Ga0268264_10003239
279 Ga0265334_10032343
280 Ga0307515_10023776
281 Ga0307515_10078953
282 Ga0265338_10034363
283 Ga0307512_10017749
284 Ga0307512_10058702
285 Ga0307512_10058774
286 Ga0265327_10013285
287 Ga0265327_10041593
288 Ga0307513_10041224
289 Ga0307508_10095670
290 Ga0307514_10081721
291 Ga0307516_10085128
292 Ga0307415_100026593
293 Ga0307507_10000003
294 Ga0373928_0006023
295 Ga0373942_0000203
296 Ga0373962_0008839
297 Ga0316574_0069072
298 Ga0373931_0000005
299 Ga0373937_0021521
300 Ga0373937_0131958
301 Ga0373937_0141045
302 Ga0316584_0008993
303 Ga0316584_0075735
304 Ga0436365_1833491
305 Ga0436361_0283615
306 Ga0451845_0196511
307 Ga0451853_1864323
308 Ga0439448_0007403
309 Ga0439440_0001490
310 Ga0466961_0070718
311 Ga0466959_0167842
312 Ga0466967_0097975
313 Ga0495651_0204154
314 Ga0495605_0012189
315 Ga0495639_0010842
316 Ga0495607_0020690
317 Ga0495606_0003145
318 Ga0495616_0013459
319 Ga0495620_0003668
320 Ga0495628_0003185
321 Ga0495630_0019453
322 Ga0495630_0053706
323 Ga0495630_0099777
324 Ga0495631_0003312
325 Ga0495586_0019921
326 Ga0495586_0026497
327 Ga0495609_0043303
328 Ga0495621_0041437
329 Ga0495597_0030901
330 Ga0495622_0071294
331 Ga0495668_0029200
332 Ga0495634_0020867
333 Ga0495611_0006860
334 Ga0495625_0129059
335 Ga0495613_0000365
336 Ga0495670_0103430
337 Ga0495589_0015238
338 Ga0495604_0192809
339 Ga0495680_0007764
340 Ga0495593_0012599
341 Ga0495614_0041536
342 Ga0495626_0044973
343 Ga0496104_0123113
344 Ga0496114_0180791
345 Ga0495678_060853
346 Ga0501031_0039315
347 Ga0501032_0013394
348 Ga0501033_0000265
349 Ga0501033_0009305
350 Ga0501034_0038285
351 Ga0501036_0009807
352 Ga0501037_0006701
353 Ga0501038_0045745
354 Ga0501039_0037593
355 Ga0501040_0000769
356 Ga0501041_0005266
357 Ga0501043_0003545
358 Ga0501048_0005203
359 Ga0501068_0008940
360 Ga0501068_0084826
361 Ga0501070_0021432
362 Ga0501070_0031444
363 Ga0501070_0295859
364 Ga0501071_0004016
365 Ga0501072_0001259
366 Ga0501072_0015373
367 Ga0501073_0096393
368 Ga0501074_0040291
369 Ga0501075_0023079
370 Ga0501076_0029459
371 Ga0501076_0258652
372 Ga0501077_0001540
373 Ga0501077_0083521
374 Ga0501080_0001136
375 Ga0501080_0266407
376 Ga0501081_0000407
377 Ga0501083_0001154
378 Ga0501035_0125195
379 Ga0501044_0000365
380 Ga0501044_0014706
381 Ga0501045_0014913
382 Ga0501045_0131572
383 nmdc:mga03683_13227_c1
384 nmdc:mga03683_68590_c1
385 nmdc:mga00v17_146478_c1
386 nmdc:mga00v17_15869_c1
387 nmdc:mga00v17_3921_c1
388 nmdc:mga00v17_42459_c1
389 nmdc:mga0yw44_11392_c1
390 nmdc:mga0yw44_379_c1
391 nmdc:mga0yw44_46453_c1
392 nmdc:mga0yw44_4686_c1
393 nmdc:mga06z11_1462_c1
394 nmdc:mga04h51_3755_c1
395 nmdc:mga05p37_86324_c1
396 nmdc:mga09592_24545_c1
397 nmdc:mga06r32_119795_c1
398 nmdc:mga06r32_43512_c1
399 nmdc:mga06r32_48045_c1
400 nmdc:mga08y16_100895_c1
401 Ga0495601_0000136
402 Ga0495612_0004947
403 Ga0500583_0093859
404 Ga0500566_0002379
405 Ga0500566_0081537
406 Ga0500652_000117
407 Ga0500559_0010934
408 Ga0501084_0002109
409 Ga0501084_0003366
410 Ga0501082_0035781
411 Ga0501082_0301153
412 Ga0530510_0011244
413 2508676555
414 2508676560
415 2517763228
416 2517763232
417 2523382930
418 2548696433
419 2616697771
420 2644511657
421 2671833297
422 2671836923
423 2676200531
424 2676200630
425 2686539125
426 2686539407
427 2686539994
428 2686540380
429 2689956978
430 2689963799
431 2689964363
432 2689993786
433 2689994601
434 2738890743
435 2774845109
436 2774845208
437 2774851453
438 2774855079
439 2809193495
440 2895887648
441 2895887688
442 2895888811
443 2919713665
444 2954691639
445 2954706732
446 3003006622
447 8002776597
448 8002776602
449 8002779768
450 8002786936
451 8002788449
452 8002788454
453 8002788597
454 8055161835

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

140

433

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dzi-assembly2.cif.gz_D crystal structure of amidohydrolase map2389c (target efi-500390) from mycobacterium avium subsp. paratuberculosis k-10 0.9596 5 391
4dzi-assembly1.cif.gz_A crystal structure of amidohydrolase map2389c (target efi-500390) from mycobacterium avium subsp. paratuberculosis k-10 0.9557 5 391
4dzi-assembly2.cif.gz_D crystal structure of amidohydrolase map2389c (target efi-500390) from mycobacterium avium subsp. paratuberculosis k-10 0.9547 5 391
4dzi-assembly1.cif.gz_A crystal structure of amidohydrolase map2389c (target efi-500390) from mycobacterium avium subsp. paratuberculosis k-10 0.9508 5 391
4dzi-assembly1.cif.gz_C crystal structure of amidohydrolase map2389c (target efi-500390) from mycobacterium avium subsp. paratuberculosis k-10 0.9434 5 397
ID Description Score Start End Superfamily
4dziB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9545 5 391 3.20.20.140
4dziB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9497 5 391 3.20.20.140
4eraA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7715 9 393 3.20.20.140
4ofcD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7705 10 396 3.20.20.140
4eraA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7631 9 393 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A1V3X7G1-F1-model_v4 Uncharacterized protein 1.001 93 195
AF-A0A2V2L1G8-F1-model_v4 deleted 0.9949 90 171
AF-X8E4S7-F1-model_v4 Putative conserved metal-dependent hydrolase 0.9912 90 199 GO:0016787
AF-X8C0F6-F1-model_v4 deleted 0.989 90 165
AF-A0A351IT48-F1-model_v4 Amidohydrolase 0.9888 17 355 GO:0005737
GO:0016787
GO:0016831
GO:0019748

Map