F340041

General Info

Members Datasets Scaffolds Average Seq Length
227 142 454 202

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10470840|Ga0207678_104708401
Length 230
Sequence MAQKVQAIDDPAATRDLENHLENDLKNQEPERPRVYCVVGLGNPGTRYENTPHNLGFLVIDRLAERNGMKIRSNEGVTLTGKGQVCGRDVILAKPLTFMNRSGMSVKTLMQSRRLTNRDLIVVYDDIDLPWMALRIKKKGSSGGHNGMKSIIAEVGTDWFARVRVGIHPGHEVEDTATYDLAPFERGLKEGLDEMLTYAAEAVESIIADGAIQAMTKFNRRAKGLKDEEE

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
75 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
132 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.32
Rhizosphere 95.59
Stem 0
Stem Tuber 0
Unclassified 29.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10470840 3300026067 Bacteria 1093
2 Ga0058863_10029568 3300004799 Bacteria 2846
3 Ga0070658_10116322 3300005327 Bacteria 2219
4 Ga0070658_10258048 3300005327 Bacteria 1480
5 Ga0070676_10210398 3300005328 Unclassified 1279
6 Ga0070683_100082632 3300005329 Bacteria 3008
7 Ga0068869_100382433 3300005334 Bacteria 1154
8 Ga0070680_100000603 3300005336 Bacteria 24867
9 Ga0070680_100038805 3300005336 Unclassified 3852
10 Ga0070680_100193564 3300005336 Bacteria 1714
11 Ga0070689_100536860 3300005340 Bacteria 1006
12 Ga0070689_100987209 3300005340 Bacteria 748
13 Ga0070673_100154671 3300005364 Bacteria 1945
14 Ga0070709_10070566 3300005434 Unclassified 2252
15 Ga0070709_10175467 3300005434 Unclassified 1501
16 Ga0070714_100006165 3300005435 Bacteria 9219
17 Ga0070714_100048017 3300005435 Unclassified 3629
18 Ga0070714_100308568 3300005435 Unclassified 1477
19 Ga0070713_100006943 3300005436 Bacteria 7903
20 Ga0070713_100449540 3300005436 Bacteria 1210
21 Ga0070713_101011621 3300005436 Unclassified 802
22 Ga0070711_100083114 3300005439 Bacteria 2287
23 Ga0070708_100064208 3300005445 Bacteria 3289
24 Ga0070708_100121754 3300005445 Bacteria 2407
25 Ga0070708_100225489 3300005445 Bacteria 1758
26 Ga0070706_100008429 3300005467 Bacteria 9601
27 Ga0070707_100000149 3300005468 Bacteria 67234
28 Ga0070707_100032298 3300005468 Bacteria 4987
29 Ga0070707_101199163 3300005468 Unclassified 725
30 Ga0070698_100008831 3300005471 Bacteria 10840
31 Ga0070699_100012164 3300005518 Bacteria 7427
32 Ga0070699_100066552 3300005518 Bacteria 3128
33 Ga0070699_100196653 3300005518 Bacteria 1792
34 Ga0070697_100019956 3300005536 Bacteria 5297
35 Ga0070697_100036205 3300005536 Bacteria 3985
36 Ga0070697_100063729 3300005536 Bacteria 3010
37 Ga0068853_100516449 3300005539 Bacteria 1129
38 Ga0070672_100207761 3300005543 Bacteria 1639
39 Ga0070696_100001210 3300005546 Bacteria 16756
40 Ga0070696_100250925 3300005546 Bacteria 1338
41 Ga0068855_100017859 3300005563 Bacteria 8526
42 Ga0068855_100155965 3300005563 Bacteria 2594
43 Ga0068856_100263966 3300005614 Bacteria 1738
44 Ga0068852_100030029 3300005616 Unclassified 4470
45 Ga0068852_101132484 3300005616 Unclassified 803
46 Ga0068858_100273219 3300005842 Bacteria 1608
47 Ga0070717_10020812 3300006028 Bacteria 5164
48 Ga0097621_100064053 3300006237 Unclassified 3022
49 Ga0097621_100333116 3300006237 Bacteria 1347
50 Ga0068871_100030076 3300006358 Bacteria 4273
51 Ga0068871_100539067 3300006358 Unclassified 1056
52 Ga0075428_100732965 3300006844 Bacteria 1052
53 Ga0075430_100060082 3300006846 Bacteria 3194
54 Ga0075431_100042438 3300006847 Bacteria 4692
55 Ga0075434_100174686 3300006871 Unclassified 2168
56 Ga0075434_101218203 3300006871 Bacteria 765
57 Ga0068865_100234768 3300006881 Unclassified 1440
58 Ga0099794_10004732 3300007265 Bacteria 5394
59 Ga0105240_10078591 3300009093 Bacteria 4063
60 Ga0105240_10152022 3300009093 Bacteria 2756
61 Ga0105240_10569441 3300009093 Bacteria 1251
62 Ga0105245_10541235 3300009098 Bacteria 1185
63 Ga0114129_10497231 3300009147 Unclassified 1593
64 Ga0105243_10261583 3300009148 Unclassified 1549
65 Ga0105242_10071287 3300009176 Bacteria 2883
66 Ga0105242_10187927 3300009176 Unclassified 1827
67 Ga0105242_10446154 3300009176 Bacteria 1218
68 Ga0105242_10489110 3300009176 Bacteria 1168
69 Ga0105248_10169672 3300009177 Bacteria 2459
70 Ga0105248_11874456 3300009177 Unclassified 680
71 Ga0105237_10242750 3300009545 Unclassified 1803
72 Ga0105238_10018128 3300009551 Bacteria 7158
73 Ga0105249_11418642 3300009553 Bacteria 766
74 Ga0105246_10119002 3300011119 Unclassified 1954
75 Ga0157373_10867346 3300013100 Unclassified 668
76 Ga0157370_10000944 3300013104 Bacteria 36878
77 Ga0157370_10240370 3300013104 Unclassified 1675
78 Ga0157369_10000788 3300013105 Bacteria 40686
79 Ga0157374_10222031 3300013296 Bacteria 1854
80 Ga0157374_10239007 3300013296 Bacteria 1786
81 Ga0157378_10897163 3300013297 Bacteria 917
82 Ga0157378_11060163 3300013297 Bacteria 846
83 Ga0157372_10030117 3300013307 Bacteria 5934
84 Ga0157375_10107647 3300013308 Bacteria 2881
85 Ga0157375_10201565 3300013308 Unclassified 2146
86 Ga0157376_10293067 3300014969 Bacteria 1537
87 Ga0157376_10553155 3300014969 Unclassified 1139
88 Ga0213875_10003390 3300021388 Bacteria 9075
89 Ga0213875_10017281 3300021388 Bacteria 3487
90 Ga0207699_10059762 3300025906 Bacteria 2286
91 Ga0207705_10911776 3300025909 Bacteria 680
92 Ga0207707_10654940 3300025912 Unclassified 885
93 Ga0207695_10035400 3300025913 Bacteria 5415
94 Ga0207671_10133805 3300025914 Unclassified 1905
95 Ga0207652_10125494 3300025921 Bacteria 2286
96 Ga0207646_10000020 3300025922 Bacteria 272909
97 Ga0207646_10000227 3300025922 Bacteria 77131
98 Ga0207646_10842159 3300025922 Unclassified 815
99 Ga0207687_10085836 3300025927 Bacteria 2284
100 Ga0207700_10116365 3300025928 Bacteria 2160
101 Ga0207664_10060138 3300025929 Unclassified 3028
102 Ga0207664_10098070 3300025929 Bacteria 2416
103 Ga0207709_10767228 3300025935 Unclassified 776
104 Ga0207670_10705431 3300025936 Bacteria 835
105 Ga0207665_10569372 3300025939 Unclassified 882
106 Ga0207711_10123641 3300025941 Bacteria 2312
107 Ga0207667_10012644 3300025949 Bacteria 9700
108 Ga0207641_11402615 3300026088 Bacteria 700
109 Ga0207698_10263225 3300026142 Bacteria 1585
110 Ga0207698_10918084 3300026142 Bacteria 883
111 Ga0265336_10068275 3300028666 Unclassified 1063
112 Ga0265338_10079554 3300028800 Unclassified 2758
113 Ga0265338_10380928 3300028800 Bacteria 1009
114 Ga0265330_10107536 3300031235 Unclassified 1192
115 Ga0265328_10009924 3300031239 Bacteria 3852
116 Ga0265328_10266230 3300031239 Unclassified 658
117 Ga0265320_10066675 3300031240 Unclassified 1705
118 Ga0265325_10015390 3300031241 Bacteria 4300
119 Ga0265325_10063391 3300031241 Unclassified 1870
120 Ga0265325_10326314 3300031241 Unclassified 681
121 Ga0265331_10002235 3300031250 Bacteria 13252
122 Ga0265316_10004839 3300031344 Bacteria 13275
123 Ga0265316_10005224 3300031344 Bacteria 12688
124 Ga0265314_10007710 3300031711 Bacteria 9307
125 Ga0265314_10032599 3300031711 Bacteria 3831
126 Ga0265314_10072083 3300031711 Bacteria 2309
127 Ga0265314_10208872 3300031711 Unclassified 1148
128 Ga0373934_0043166 3300035086 Unclassified 1782
129 Ga0373954_0029804 3300035118 Bacteria 2515
130 Ga0373956_0272873 3300035119 Unclassified 805
131 Ga0373955_0171244 3300035172 Unclassified 1285
132 Ga0373955_0291536 3300035172 Unclassified 983
133 Ga0373935_0033808 3300035692 Bacteria 3185
134 Ga0373927_0029363 3300035695 Bacteria 3584
135 Ga0373927_0041067 3300035695 Bacteria 3000
136 Ga0373927_0351424 3300035695 Bacteria 971
137 Ga0373933_0037175 3300035724 Bacteria 2855
138 Ga0373933_0246786 3300035724 Unclassified 1149
139 Ga0373933_0327781 3300035724 Unclassified 993
140 Ga0373947_0137484 3300035725 Bacteria 1565
141 Ga0373937_0004091 3300036401 Bacteria 12373
142 Ga0373937_0162169 3300036401 Bacteria 2096
143 Ga0373937_1090338 3300036401 Unclassified 747
144 Ga0373925_0029895 3300037068 Bacteria 3996
145 Ga0373925_0057546 3300037068 Bacteria 2913
146 Ga0395899_0153157 3300037312 Bacteria 1633
147 Ga0395900_0144684 3300037418 Bacteria 2432
148 Ga0395898_0295949 3300037466 Bacteria 1544
149 Ga0395905_0178729 3300037471 Bacteria 1992
150 Ga0395905_0418339 3300037471 Unclassified 1236
151 Ga0395905_0564120 3300037471 Bacteria 1040
152 Ga0395905_1199475 3300037471 Bacteria 662
153 Ga0436364_0135044 3300037853 Bacteria 3552
154 Ga0436364_0479789 3300037853 Bacteria 2380
155 Ga0436364_0683917 3300037853 Bacteria 8658
156 Ga0436364_1551526 3300037853 Bacteria 905
157 Ga0395901_0826264 3300038443 Unclassified 914
158 Ga0436363_0133813 3300039450 Unclassified 1258
159 Ga0451577_0028769 3300042876 Bacteria 5025
160 Ga0451577_0148739 3300042876 Unclassified 2106
161 Ga0451577_0744046 3300042876 Unclassified 887
162 Ga0451577_0898798 3300042876 Bacteria 797
163 Ga0453683_0004147 3300044673 Bacteria 10383
164 Ga0453683_0009458 3300044673 Bacteria 6504
165 Ga0453683_0180114 3300044673 Unclassified 1340
166 Ga0453683_0471888 3300044673 Unclassified 813
167 Ga0466963_0283433 3300044694 Bacteria 1165
168 Ga0453684_0013140 3300044712 Bacteria 13503
169 Ga0453684_0125041 3300044712 Unclassified 3097
170 Ga0453684_0312549 3300044712 Unclassified 1782
171 Ga0466959_0311624 3300045049 Bacteria 1077
172 Ga0451576_0156114 3300045051 Bacteria 2380
173 Ga0466967_0219752 3300045976 Bacteria 1805
174 Ga0495651_0287899 3300046462 Unclassified 1107
175 Ga0495580_0005800 3300046472 Bacteria 10139
176 Ga0495580_0048384 3300046472 Bacteria 3011
177 Ga0495580_0059078 3300046472 Unclassified 2695
178 Ga0495664_0096465 3300046477 Unclassified 1780
179 Ga0495645_0487822 3300046543 Unclassified 772
180 Ga0495624_0287089 3300046690 Unclassified 993
181 Ga0496104_0742571 3300048907 Bacteria 889
182 Ga0496108_0561812 3300048911 Bacteria 995
183 Ga0496109_0361831 3300048912 Unclassified 1371
184 Ga0501031_0004244 3300049568 Bacteria 9254
185 Ga0501032_0001765 3300049569 Bacteria 17062
186 Ga0501033_0012239 3300049570 Bacteria 6549
187 Ga0501033_0247446 3300049570 Bacteria 1264
188 Ga0501034_0014605 3300049571 Bacteria 8086
189 Ga0501034_0033377 3300049571 Bacteria 5222
190 Ga0501036_0001222 3300049572 Bacteria 19610
191 Ga0501036_0027378 3300049572 Unclassified 4817
192 Ga0501037_0098477 3300049573 Unclassified 2112
193 Ga0501038_0020093 3300049574 Bacteria 6009
194 Ga0501038_0127904 3300049574 Unclassified 2089
195 Ga0501039_0095604 3300049575 Bacteria 2316
196 Ga0501043_0006526 3300049579 Bacteria 9359
197 Ga0501043_0020503 3300049579 Bacteria 5186
198 Ga0501046_0001287 3300049580 Bacteria 24285
199 Ga0501046_0175306 3300049580 Unclassified 1606
200 Ga0501047_0023118 3300049581 Bacteria 5968
201 Ga0501047_0120492 3300049581 Unclassified 2506
202 Ga0501048_0060275 3300049582 Unclassified 2689
203 Ga0501067_0007609 3300049583 Bacteria 6024
204 Ga0501068_0007887 3300049584 Bacteria 5898
205 Ga0501070_0047153 3300049586 Bacteria 3582
206 Ga0501072_0003647 3300049588 Bacteria 11593
207 Ga0501073_0002520 3300049589 Bacteria 13685
208 Ga0501073_0042315 3300049589 Bacteria 3215
209 Ga0501074_0002177 3300049590 Bacteria 13583
210 Ga0501074_0131906 3300049590 Unclassified 1787
211 Ga0501076_0004020 3300049592 Bacteria 10392
212 Ga0501077_0003143 3300049593 Bacteria 9929
213 Ga0501079_0007705 3300049741 Bacteria 8150
214 Ga0501080_0002089 3300049742 Bacteria 17337
215 Ga0501083_0003451 3300049744 Bacteria 11042
216 Ga0501035_0012051 3300049822 Bacteria 7998
217 Ga0501035_0021760 3300049822 Bacteria 5894
218 Ga0501035_0154843 3300049822 Bacteria 1987
219 Ga0501044_0001806 3300049823 Bacteria 24933
220 Ga0501044_0002981 3300049823 Bacteria 19200
221 Ga0501044_0034509 3300049823 Bacteria 5304
222 Ga0501044_0061261 3300049823 Unclassified 3850
223 nmdc:mga0qj67_13897_c2 3300050509 Bacteria 3115
224 nmdc:mga06r32_16670_c1 3300050510 Bacteria 6695
225 nmdc:mga0n895_115188_c1 3300050512 Bacteria 2706
226 Ga0501084_0001785 3300054114 Bacteria 17123
227 Ga0501082_0023255 3300060353 Bacteria 5346
228 Ga0207678_10470840
229 Ga0058863_10029568
230 Ga0070658_10116322
231 Ga0070658_10258048
232 Ga0070676_10210398
233 Ga0070683_100082632
234 Ga0068869_100382433
235 Ga0070680_100000603
236 Ga0070680_100038805
237 Ga0070680_100193564
238 Ga0070689_100536860
239 Ga0070689_100987209
240 Ga0070673_100154671
241 Ga0070709_10070566
242 Ga0070709_10175467
243 Ga0070714_100006165
244 Ga0070714_100048017
245 Ga0070714_100308568
246 Ga0070713_100006943
247 Ga0070713_100449540
248 Ga0070713_101011621
249 Ga0070711_100083114
250 Ga0070708_100064208
251 Ga0070708_100121754
252 Ga0070708_100225489
253 Ga0070706_100008429
254 Ga0070707_100000149
255 Ga0070707_100032298
256 Ga0070707_101199163
257 Ga0070698_100008831
258 Ga0070699_100012164
259 Ga0070699_100066552
260 Ga0070699_100196653
261 Ga0070697_100019956
262 Ga0070697_100036205
263 Ga0070697_100063729
264 Ga0068853_100516449
265 Ga0070672_100207761
266 Ga0070696_100001210
267 Ga0070696_100250925
268 Ga0068855_100017859
269 Ga0068855_100155965
270 Ga0068856_100263966
271 Ga0068852_100030029
272 Ga0068852_101132484
273 Ga0068858_100273219
274 Ga0070717_10020812
275 Ga0097621_100064053
276 Ga0097621_100333116
277 Ga0068871_100030076
278 Ga0068871_100539067
279 Ga0075428_100732965
280 Ga0075430_100060082
281 Ga0075431_100042438
282 Ga0075434_100174686
283 Ga0075434_101218203
284 Ga0068865_100234768
285 Ga0099794_10004732
286 Ga0105240_10078591
287 Ga0105240_10152022
288 Ga0105240_10569441
289 Ga0105245_10541235
290 Ga0114129_10497231
291 Ga0105243_10261583
292 Ga0105242_10071287
293 Ga0105242_10187927
294 Ga0105242_10446154
295 Ga0105242_10489110
296 Ga0105248_10169672
297 Ga0105248_11874456
298 Ga0105237_10242750
299 Ga0105238_10018128
300 Ga0105249_11418642
301 Ga0105246_10119002
302 Ga0157373_10867346
303 Ga0157370_10000944
304 Ga0157370_10240370
305 Ga0157369_10000788
306 Ga0157374_10222031
307 Ga0157374_10239007
308 Ga0157378_10897163
309 Ga0157378_11060163
310 Ga0157372_10030117
311 Ga0157375_10107647
312 Ga0157375_10201565
313 Ga0157376_10293067
314 Ga0157376_10553155
315 Ga0213875_10003390
316 Ga0213875_10017281
317 Ga0207699_10059762
318 Ga0207705_10911776
319 Ga0207707_10654940
320 Ga0207695_10035400
321 Ga0207671_10133805
322 Ga0207652_10125494
323 Ga0207646_10000020
324 Ga0207646_10000227
325 Ga0207646_10842159
326 Ga0207687_10085836
327 Ga0207700_10116365
328 Ga0207664_10060138
329 Ga0207664_10098070
330 Ga0207709_10767228
331 Ga0207670_10705431
332 Ga0207665_10569372
333 Ga0207711_10123641
334 Ga0207667_10012644
335 Ga0207641_11402615
336 Ga0207698_10263225
337 Ga0207698_10918084
338 Ga0265336_10068275
339 Ga0265338_10079554
340 Ga0265338_10380928
341 Ga0265330_10107536
342 Ga0265328_10009924
343 Ga0265328_10266230
344 Ga0265320_10066675
345 Ga0265325_10015390
346 Ga0265325_10063391
347 Ga0265325_10326314
348 Ga0265331_10002235
349 Ga0265316_10004839
350 Ga0265316_10005224
351 Ga0265314_10007710
352 Ga0265314_10032599
353 Ga0265314_10072083
354 Ga0265314_10208872
355 Ga0373934_0043166
356 Ga0373954_0029804
357 Ga0373956_0272873
358 Ga0373955_0171244
359 Ga0373955_0291536
360 Ga0373935_0033808
361 Ga0373927_0029363
362 Ga0373927_0041067
363 Ga0373927_0351424
364 Ga0373933_0037175
365 Ga0373933_0246786
366 Ga0373933_0327781
367 Ga0373947_0137484
368 Ga0373937_0004091
369 Ga0373937_0162169
370 Ga0373937_1090338
371 Ga0373925_0029895
372 Ga0373925_0057546
373 Ga0395899_0153157
374 Ga0395900_0144684
375 Ga0395898_0295949
376 Ga0395905_0178729
377 Ga0395905_0418339
378 Ga0395905_0564120
379 Ga0395905_1199475
380 Ga0436364_0135044
381 Ga0436364_0479789
382 Ga0436364_0683917
383 Ga0436364_1551526
384 Ga0395901_0826264
385 Ga0436363_0133813
386 Ga0451577_0028769
387 Ga0451577_0148739
388 Ga0451577_0744046
389 Ga0451577_0898798
390 Ga0453683_0004147
391 Ga0453683_0009458
392 Ga0453683_0180114
393 Ga0453683_0471888
394 Ga0466963_0283433
395 Ga0453684_0013140
396 Ga0453684_0125041
397 Ga0453684_0312549
398 Ga0466959_0311624
399 Ga0451576_0156114
400 Ga0466967_0219752
401 Ga0495651_0287899
402 Ga0495580_0005800
403 Ga0495580_0048384
404 Ga0495580_0059078
405 Ga0495664_0096465
406 Ga0495645_0487822
407 Ga0495624_0287089
408 Ga0496104_0742571
409 Ga0496108_0561812
410 Ga0496109_0361831
411 Ga0501031_0004244
412 Ga0501032_0001765
413 Ga0501033_0012239
414 Ga0501033_0247446
415 Ga0501034_0014605
416 Ga0501034_0033377
417 Ga0501036_0001222
418 Ga0501036_0027378
419 Ga0501037_0098477
420 Ga0501038_0020093
421 Ga0501038_0127904
422 Ga0501039_0095604
423 Ga0501043_0006526
424 Ga0501043_0020503
425 Ga0501046_0001287
426 Ga0501046_0175306
427 Ga0501047_0023118
428 Ga0501047_0120492
429 Ga0501048_0060275
430 Ga0501067_0007609
431 Ga0501068_0007887
432 Ga0501070_0047153
433 Ga0501072_0003647
434 Ga0501073_0002520
435 Ga0501073_0042315
436 Ga0501074_0002177
437 Ga0501074_0131906
438 Ga0501076_0004020
439 Ga0501077_0003143
440 Ga0501079_0007705
441 Ga0501080_0002089
442 Ga0501083_0003451
443 Ga0501035_0012051
444 Ga0501035_0021760
445 Ga0501035_0154843
446 Ga0501044_0001806
447 Ga0501044_0002981
448 Ga0501044_0034509
449 Ga0501044_0061261
450 nmdc:mga0qj67_13897_c2
451 nmdc:mga06r32_16670_c1
452 nmdc:mga0n895_115188_c1
453 Ga0501084_0001785
454 Ga0501082_0023255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

37

219

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.9486 2 178
4yly-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution 0.9347 1 186
4yly-assembly2.cif.gz_B crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution 0.9325 1 186
7wt6-assembly1.cif.gz_A crystal structure of full-length peptidyl-trna hydrolase from mycobacterium tuberculosis 0.932 2 186
2z2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9273 2 178
ID Description Score Start End Superfamily
af_Q54V95_265_452_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.948 60 187 3.40.50.1470
af_Q10LI6_46_183_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9372 2 133 3.40.50.1470
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9347 1 186 3.40.50.1470
5zx8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9253 1 187 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9228 2 186 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A3D6AAE0-F1-model_v4 deleted 0.9916 1 103
AF-A0A699YRB7-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9907 4 103 GO:0004045
AF-A0A287K1J8-F1-model_v4 deleted 0.9888 2 88
AF-A0A359JK19-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9873 1 117 GO:0004045
AF-A0A453DDS2-F1-model_v4 Peptidyl-tRNA hydrolase, mitochondrial 0.9857 2 90 GO:0004045

Map