F339990

General Info

Members Datasets Scaffolds Average Seq Length
227 148 454 178

Family's Representative Sequence

Representative Sequence 3300025904|Ga0207647_10362593|Ga0207647_103625931
Length 215
Sequence MTGPNGHPAGQPARANQAAGTELGSVLRPTIGRVSTPAVPEPDTKDWTWAIREPCPDCGFDPGAVRPADVPDLTRRYAATVAAATTQPGANARPTPTTWSPLEYACHVRDVCELFDHRLHRMLDEDDPLFANWDQDETALEQRYWEQDPSEVAERLTANADRIAESFAGVRADQWDRPGRRSNGSLFTVDTFARYFLHDIAHHAWDVRQQGQPAR

Samples

Sample ID Description Type Environment
1 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
26 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
32 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
33 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
34 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
35 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
61 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
66 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
67 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
68 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
69 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
70 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
71 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
72 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
73 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
74 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
75 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
76 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
77 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
78 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
79 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
80 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
81 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
82 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
83 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
140 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
145 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
146 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
147 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
148 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.24
Metatranscriptomes 0
Isolates 1.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.64
Nodule 0
Rhizoplane 5.29
Rhizosphere 88.55
Stem 0
Stem Tuber 0
Unclassified 2.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207647_10362593 3300025904 Bacteria 820
2 rootH2_10215001 3300003320 Bacteria 1108
3 Ga0070658_10242065 3300005327 Bacteria 1529
4 Ga0070658_10590991 3300005327 Bacteria 962
5 Ga0068869_100044926 3300005334 Bacteria 3178
6 Ga0068868_101092311 3300005338 Bacteria 734
7 Ga0070692_10034218 3300005345 Bacteria 2565
8 Ga0070692_10686337 3300005345 Bacteria 687
9 Ga0070674_100191258 3300005356 Bacteria 1575
10 Ga0070679_100766692 3300005530 Bacteria 908
11 Ga0070665_100383640 3300005548 Bacteria 1413
12 Ga0068855_100035814 3300005563 Bacteria 5910
13 Ga0068854_100030524 3300005578 Bacteria 3739
14 Ga0068854_101030582 3300005578 Bacteria 730
15 Ga0068856_100044659 3300005614 Bacteria 4362
16 Ga0068852_101825622 3300005616 Bacteria 630
17 Ga0075363_100111863 3300006048 Bacteria 1518
18 Ga0105244_10015484 3300009036 Bacteria 4372
19 Ga0105240_10053114 3300009093 Bacteria 5089
20 Ga0105240_10386021 3300009093 Bacteria 1580
21 Ga0105245_10581793 3300009098 Bacteria 1144
22 Ga0105243_10046656 3300009148 Bacteria 3409
23 Ga0105241_10063644 3300009174 Bacteria 2847
24 Ga0105241_10627228 3300009174 Bacteria 974
25 Ga0105248_11504991 3300009177 Bacteria 762
26 Ga0105237_10008116 3300009545 Bacteria 11405
27 Ga0105237_10084056 3300009545 Bacteria 3174
28 Ga0105237_10127584 3300009545 Bacteria 2538
29 Ga0105237_10422728 3300009545 Bacteria 1338
30 Ga0105238_10210855 3300009551 Bacteria 1918
31 Ga0105239_10086356 3300010375 Bacteria 3458
32 Ga0105239_10254416 3300010375 Bacteria 1973
33 Ga0105239_10485172 3300010375 Bacteria 1404
34 Ga0105246_10001461 3300011119 Bacteria 14021
35 Ga0105246_10116840 3300011119 Bacteria 1970
36 Ga0157317_1001030 3300012475 Bacteria 1413
37 Ga0157314_1012351 3300012500 Bacteria 767
38 Ga0157369_10036407 3300013105 Bacteria 5392
39 Ga0157369_10480266 3300013105 Bacteria 1286
40 Ga0157369_10555379 3300013105 Bacteria 1187
41 Ga0157374_10180245 3300013296 Bacteria 2063
42 Ga0157372_11014323 3300013307 Bacteria 961
43 Ga0157380_10032928 3300014326 Bacteria 3989
44 Ga0157380_10599305 3300014326 Bacteria 1090
45 Ga0213874_10064659 3300021377 Bacteria 1154
46 Ga0209759_1038582 3300025256 Bacteria 847
47 Ga0209129_1000301 3300025258 Bacteria 45425
48 Ga0209025_1001340 3300025294 Bacteria 33205
49 Ga0209051_1053065 3300025303 Bacteria 1335
50 Ga0207655_1007322 3300025728 Bacteria 7172
51 Ga0207688_10096162 3300025901 Bacteria 1705
52 Ga0207705_10280801 3300025909 Bacteria 1275
53 Ga0207654_10134766 3300025911 Bacteria 1567
54 Ga0207654_10224793 3300025911 Bacteria 1247
55 Ga0207671_10074723 3300025914 Bacteria 2533
56 Ga0207671_10108470 3300025914 Bacteria 2110
57 Ga0207671_11009870 3300025914 Bacteria 655
58 Ga0207671_11050674 3300025914 Bacteria 641
59 Ga0207687_10370393 3300025927 Bacteria 1171
60 Ga0207709_10099335 3300025935 Bacteria 1921
61 Ga0207691_10068006 3300025940 Bacteria 3219
62 Ga0207689_10049739 3300025942 Bacteria 3458
63 Ga0207661_10159761 3300025944 Bacteria 1955
64 Ga0207667_10024793 3300025949 Bacteria 6578
65 Ga0207651_10374863 3300025960 Bacteria 1205
66 Ga0207640_10973042 3300025981 Bacteria 745
67 Ga0207702_10039042 3300026078 Bacteria 3977
68 Ga0207702_10379983 3300026078 Bacteria 1358
69 Ga0207648_10207514 3300026089 Bacteria 1739
70 Ga0207698_10336172 3300026142 Bacteria 1421
71 Ga0307512_10195876 3300030522 Bacteria 1104
72 Ga0307408_100036131 3300031548 Bacteria 3472
73 Ga0307408_100161111 3300031548 Bacteria 1782
74 Ga0307413_10003756 3300031824 Bacteria 6464
75 Ga0307413_10123762 3300031824 Bacteria 1757
76 Ga0307410_10021993 3300031852 Bacteria 3934
77 Ga0307410_10047041 3300031852 Bacteria 2881
78 Ga0307407_10026003 3300031903 Bacteria 3094
79 Ga0307412_10215934 3300031911 Bacteria 1467
80 Ga0307412_10242208 3300031911 Bacteria 1395
81 Ga0307412_10851614 3300031911 Bacteria 795
82 Ga0307409_100001019 3300031995 Bacteria 13135
83 Ga0307409_100005236 3300031995 Bacteria 7434
84 Ga0307409_100159251 3300031995 Bacteria 1972
85 Ga0307416_100105123 3300032002 Bacteria 2470
86 Ga0307414_10148426 3300032004 Bacteria 1846
87 Ga0307414_10407688 3300032004 Bacteria 1182
88 Ga0307414_11311336 3300032004 Bacteria 672
89 Ga0307411_10135105 3300032005 Bacteria 1809
90 Ga0307411_10171593 3300032005 Bacteria 1636
91 Ga0307415_100101266 3300032126 Bacteria 2114
92 Ga0307415_100121838 3300032126 Bacteria 1957
93 Ga0395905_1257689 3300037471 Unclassified 644
94 Ga0395901_1368247 3300038443 Bacteria 667
95 Ga0436363_1268162 3300039450 Bacteria 2062
96 Ga0439438_003369 3300041405 Bacteria 6470
97 Ga0439447_088809 3300041407 Bacteria 711
98 Ga0439466_0024968 3300041411 Bacteria 2090
99 Ga0451797_1163470 3300041453 Bacteria 573
100 Ga0439431_0077826 3300041997 Bacteria 891
101 Ga0439433_0009407 3300041999 Bacteria 2127
102 Ga0439432_028050 3300042006 Bacteria 1835
103 Ga0439452_006779 3300042010 Bacteria 3560
104 Ga0439462_0019602 3300042015 Bacteria 1761
105 Ga0450919_002826 3300042121 Bacteria 2228
106 Ga0450920_007422 3300042122 Bacteria 1987
107 Ga0450923_012292 3300042125 Bacteria 1556
108 Ga0450907_005998 3300042146 Bacteria 2037
109 Ga0439446_0024488 3300042156 Bacteria 1722
110 Ga0450908_004075 3300042184 Bacteria 2825
111 Ga0450909_001189 3300042185 Bacteria 3611
112 Ga0450918_001281 3300042531 Bacteria 5103
113 Ga0466969_0099999 3300044656 Bacteria 1366
114 Ga0466972_0030141 3300044658 Bacteria 2671
115 Ga0466972_0108792 3300044658 Bacteria 1310
116 Ga0466972_0187322 3300044658 Unclassified 970
117 Ga0466965_0085342 3300044683 Bacteria 1600
118 Ga0466966_0038761 3300044684 Bacteria 3069
119 Ga0466966_0045782 3300044684 Bacteria 2796
120 Ga0466966_0274357 3300044684 Bacteria 1015
121 Ga0466961_0029349 3300044693 Bacteria 3536
122 Ga0466961_0048289 3300044693 Bacteria 2720
123 Ga0466961_0112650 3300044693 Bacteria 1711
124 Ga0466961_0280467 3300044693 Bacteria 1020
125 Ga0466963_0002872 3300044694 Bacteria 9728
126 Ga0466963_0038078 3300044694 Bacteria 3144
127 Ga0466963_0066898 3300044694 Bacteria 2411
128 Ga0466963_0161969 3300044694 Unclassified 1557
129 Ga0466963_0281763 3300044694 Bacteria 1168
130 Ga0466963_0461052 3300044694 Bacteria 897
131 Ga0466971_0049600 3300044719 Unclassified 1889
132 Ga0466971_0067741 3300044719 Bacteria 1618
133 Ga0466971_0398630 3300044719 Bacteria 670
134 Ga0466968_0078757 3300044735 Bacteria 1445
135 Ga0466970_0024407 3300044765 Bacteria 3161
136 Ga0466970_0040439 3300044765 Bacteria 2476
137 Ga0466970_0210661 3300044765 Bacteria 1083
138 Ga0466957_0009657 3300044842 Bacteria 5508
139 Ga0466957_0036095 3300044842 Bacteria 2970
140 Ga0466957_0072280 3300044842 Unclassified 2135
141 Ga0466960_0022450 3300044901 Bacteria 2822
142 Ga0466959_0022410 3300045049 Bacteria 4670
143 Ga0466959_0030116 3300045049 Bacteria 4019
144 Ga0466959_0078725 3300045049 Bacteria 2377
145 Ga0466958_0054188 3300045836 Bacteria 2432
146 Ga0466958_0147618 3300045836 Bacteria 1482
147 Ga0466967_0000939 3300045976 Bacteria 15697
148 Ga0466967_0007953 3300045976 Bacteria 7715
149 Ga0466967_0015413 3300045976 Bacteria 5990
150 Ga0466967_0057635 3300045976 Bacteria 3430
151 Ga0466967_0091673 3300045976 Bacteria 2762
152 Ga0466967_0137584 3300045976 Bacteria 2272
153 Ga0466967_1217100 3300045976 Bacteria 750
154 Ga0495653_0122072 3300046463 Bacteria 1855
155 Ga0495653_0180146 3300046463 Bacteria 1451
156 Ga0495580_0699451 3300046472 Bacteria 663
157 Ga0495608_0203418 3300046511 Bacteria 1247
158 Ga0495586_0126970 3300046535 Bacteria 1427
159 Ga0495635_0069957 3300046663 Bacteria 2406
160 Ga0495588_0467265 3300046674 Bacteria 662
161 Ga0495674_0298232 3300047319 Bacteria 1317
162 Ga0495680_0073514 3300047322 Bacteria 2598
163 Ga0495593_0444391 3300047673 Bacteria 649
164 Ga0496100_0079165 3300048903 Bacteria 2214
165 Ga0496101_0180684 3300048904 Bacteria 1625
166 Ga0496102_0459669 3300048905 Bacteria 1194
167 Ga0496107_0164146 3300048910 Bacteria 1647
168 Ga0496110_0421599 3300048913 Bacteria 1217
169 Ga0496112_0004659 3300048915 Bacteria 11660
170 Ga0496114_0059779 3300048917 Bacteria 3184
171 Ga0496114_0191512 3300048917 Bacteria 1790
172 Ga0496114_0316346 3300048917 Bacteria 1379
173 Ga0496115_0435296 3300048918 Bacteria 1061
174 Ga0496115_0784742 3300048918 Bacteria 743
175 Ga0501032_0135773 3300049569 Bacteria 1621
176 Ga0501033_0156615 3300049570 Bacteria 1641
177 Ga0501036_0008642 3300049572 Bacteria 8355
178 Ga0501037_0544082 3300049573 Bacteria 784
179 Ga0501038_0044061 3300049574 Bacteria 3878
180 Ga0501039_0044583 3300049575 Bacteria 3426
181 Ga0501039_0504555 3300049575 Bacteria 950
182 Ga0501040_0066703 3300049576 Bacteria 2479
183 Ga0501041_0027233 3300049577 Bacteria 3444
184 Ga0501041_0103805 3300049577 Bacteria 1761
185 Ga0501042_0009459 3300049578 Bacteria 6494
186 Ga0501042_0441064 3300049578 Bacteria 944
187 Ga0501042_0539139 3300049578 Bacteria 848
188 Ga0501046_0023409 3300049580 Bacteria 5083
189 Ga0501047_0030201 3300049581 Bacteria 5226
190 Ga0501047_0378092 3300049581 Bacteria 1251
191 Ga0501048_0045921 3300049582 Bacteria 3118
192 Ga0501070_0008770 3300049586 Bacteria 8550
193 Ga0501071_0377087 3300049587 Bacteria 1081
194 Ga0501071_1247178 3300049587 Bacteria 574
195 Ga0501072_0019432 3300049588 Bacteria 5251
196 Ga0501073_0091798 3300049589 Bacteria 2111
197 Ga0501074_0006119 3300049590 Bacteria 8690
198 Ga0501079_0003489 3300049741 Bacteria 11557
199 Ga0501080_0016260 3300049742 Bacteria 6869
200 Ga0501080_0105404 3300049742 Bacteria 2614
201 Ga0501081_0023804 3300049743 Bacteria 4107
202 Ga0501035_0119671 3300049822 Bacteria 2303
203 Ga0501035_0375335 3300049822 Bacteria 1187
204 Ga0501044_0186631 3300049823 Bacteria 2038
205 Ga0501044_0207297 3300049823 Bacteria 1916
206 Ga0501044_0343427 3300049823 Bacteria 1413
207 Ga0501045_0000759 3300049824 Bacteria 20665
208 Ga0501045_0032977 3300049824 Bacteria 3754
209 Ga0501045_0391844 3300049824 Bacteria 1034
210 Ga0495595_0210157 3300053084 Bacteria 970
211 Ga0495595_0260080 3300053084 Bacteria 870
212 Ga0495619_0214333 3300053085 Bacteria 1334
213 Ga0495619_0415329 3300053085 Bacteria 928
214 Ga0500566_0010874 3300053094 Bacteria 5364
215 Ga0500641_0007345 3300053096 Bacteria 3927
216 Ga0501084_0650755 3300054114 Bacteria 890
217 Ga0501084_0743414 3300054114 Bacteria 827
218 Ga0501082_0010305 3300060353 Bacteria 8048
219 Ga0466962_0003675 3300061719 Bacteria 7314
220 Ga0466962_0007295 3300061719 Bacteria 5302
221 Ga0466962_0020222 3300061719 Bacteria 3201
222 Ga0466962_0118524 3300061719 Bacteria 1276
223 Ga0530510_0008516 3300061734 Bacteria 7156
224 2643851835 2643221567 Bacteria 4163945
225 2644137576 2643221624 Bacteria 4384879
226 2808872370 2808606365 Bacteria 4301966
227 2939661468 2939660829 Bacteria 3784848
228 Ga0207647_10362593
229 rootH2_10215001
230 Ga0070658_10242065
231 Ga0070658_10590991
232 Ga0068869_100044926
233 Ga0068868_101092311
234 Ga0070692_10034218
235 Ga0070692_10686337
236 Ga0070674_100191258
237 Ga0070679_100766692
238 Ga0070665_100383640
239 Ga0068855_100035814
240 Ga0068854_100030524
241 Ga0068854_101030582
242 Ga0068856_100044659
243 Ga0068852_101825622
244 Ga0075363_100111863
245 Ga0105244_10015484
246 Ga0105240_10053114
247 Ga0105240_10386021
248 Ga0105245_10581793
249 Ga0105243_10046656
250 Ga0105241_10063644
251 Ga0105241_10627228
252 Ga0105248_11504991
253 Ga0105237_10008116
254 Ga0105237_10084056
255 Ga0105237_10127584
256 Ga0105237_10422728
257 Ga0105238_10210855
258 Ga0105239_10086356
259 Ga0105239_10254416
260 Ga0105239_10485172
261 Ga0105246_10001461
262 Ga0105246_10116840
263 Ga0157317_1001030
264 Ga0157314_1012351
265 Ga0157369_10036407
266 Ga0157369_10480266
267 Ga0157369_10555379
268 Ga0157374_10180245
269 Ga0157372_11014323
270 Ga0157380_10032928
271 Ga0157380_10599305
272 Ga0213874_10064659
273 Ga0209759_1038582
274 Ga0209129_1000301
275 Ga0209025_1001340
276 Ga0209051_1053065
277 Ga0207655_1007322
278 Ga0207688_10096162
279 Ga0207705_10280801
280 Ga0207654_10134766
281 Ga0207654_10224793
282 Ga0207671_10074723
283 Ga0207671_10108470
284 Ga0207671_11009870
285 Ga0207671_11050674
286 Ga0207687_10370393
287 Ga0207709_10099335
288 Ga0207691_10068006
289 Ga0207689_10049739
290 Ga0207661_10159761
291 Ga0207667_10024793
292 Ga0207651_10374863
293 Ga0207640_10973042
294 Ga0207702_10039042
295 Ga0207702_10379983
296 Ga0207648_10207514
297 Ga0207698_10336172
298 Ga0307512_10195876
299 Ga0307408_100036131
300 Ga0307408_100161111
301 Ga0307413_10003756
302 Ga0307413_10123762
303 Ga0307410_10021993
304 Ga0307410_10047041
305 Ga0307407_10026003
306 Ga0307412_10215934
307 Ga0307412_10242208
308 Ga0307412_10851614
309 Ga0307409_100001019
310 Ga0307409_100005236
311 Ga0307409_100159251
312 Ga0307416_100105123
313 Ga0307414_10148426
314 Ga0307414_10407688
315 Ga0307414_11311336
316 Ga0307411_10135105
317 Ga0307411_10171593
318 Ga0307415_100101266
319 Ga0307415_100121838
320 Ga0395905_1257689
321 Ga0395901_1368247
322 Ga0436363_1268162
323 Ga0439438_003369
324 Ga0439447_088809
325 Ga0439466_0024968
326 Ga0451797_1163470
327 Ga0439431_0077826
328 Ga0439433_0009407
329 Ga0439432_028050
330 Ga0439452_006779
331 Ga0439462_0019602
332 Ga0450919_002826
333 Ga0450920_007422
334 Ga0450923_012292
335 Ga0450907_005998
336 Ga0439446_0024488
337 Ga0450908_004075
338 Ga0450909_001189
339 Ga0450918_001281
340 Ga0466969_0099999
341 Ga0466972_0030141
342 Ga0466972_0108792
343 Ga0466972_0187322
344 Ga0466965_0085342
345 Ga0466966_0038761
346 Ga0466966_0045782
347 Ga0466966_0274357
348 Ga0466961_0029349
349 Ga0466961_0048289
350 Ga0466961_0112650
351 Ga0466961_0280467
352 Ga0466963_0002872
353 Ga0466963_0038078
354 Ga0466963_0066898
355 Ga0466963_0161969
356 Ga0466963_0281763
357 Ga0466963_0461052
358 Ga0466971_0049600
359 Ga0466971_0067741
360 Ga0466971_0398630
361 Ga0466968_0078757
362 Ga0466970_0024407
363 Ga0466970_0040439
364 Ga0466970_0210661
365 Ga0466957_0009657
366 Ga0466957_0036095
367 Ga0466957_0072280
368 Ga0466960_0022450
369 Ga0466959_0022410
370 Ga0466959_0030116
371 Ga0466959_0078725
372 Ga0466958_0054188
373 Ga0466958_0147618
374 Ga0466967_0000939
375 Ga0466967_0007953
376 Ga0466967_0015413
377 Ga0466967_0057635
378 Ga0466967_0091673
379 Ga0466967_0137584
380 Ga0466967_1217100
381 Ga0495653_0122072
382 Ga0495653_0180146
383 Ga0495580_0699451
384 Ga0495608_0203418
385 Ga0495586_0126970
386 Ga0495635_0069957
387 Ga0495588_0467265
388 Ga0495674_0298232
389 Ga0495680_0073514
390 Ga0495593_0444391
391 Ga0496100_0079165
392 Ga0496101_0180684
393 Ga0496102_0459669
394 Ga0496107_0164146
395 Ga0496110_0421599
396 Ga0496112_0004659
397 Ga0496114_0059779
398 Ga0496114_0191512
399 Ga0496114_0316346
400 Ga0496115_0435296
401 Ga0496115_0784742
402 Ga0501032_0135773
403 Ga0501033_0156615
404 Ga0501036_0008642
405 Ga0501037_0544082
406 Ga0501038_0044061
407 Ga0501039_0044583
408 Ga0501039_0504555
409 Ga0501040_0066703
410 Ga0501041_0027233
411 Ga0501041_0103805
412 Ga0501042_0009459
413 Ga0501042_0441064
414 Ga0501042_0539139
415 Ga0501046_0023409
416 Ga0501047_0030201
417 Ga0501047_0378092
418 Ga0501048_0045921
419 Ga0501070_0008770
420 Ga0501071_0377087
421 Ga0501071_1247178
422 Ga0501072_0019432
423 Ga0501073_0091798
424 Ga0501074_0006119
425 Ga0501079_0003489
426 Ga0501080_0016260
427 Ga0501080_0105404
428 Ga0501081_0023804
429 Ga0501035_0119671
430 Ga0501035_0375335
431 Ga0501044_0186631
432 Ga0501044_0207297
433 Ga0501044_0343427
434 Ga0501045_0000759
435 Ga0501045_0032977
436 Ga0501045_0391844
437 Ga0495595_0210157
438 Ga0495595_0260080
439 Ga0495619_0214333
440 Ga0495619_0415329
441 Ga0500566_0010874
442 Ga0500641_0007345
443 Ga0501084_0650755
444 Ga0501084_0743414
445 Ga0501082_0010305
446 Ga0466962_0003675
447 Ga0466962_0007295
448 Ga0466962_0020222
449 Ga0466962_0118524
450 Ga0530510_0008516
451 2643851835
452 2644137576
453 2808872370
454 2939661468

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

72

207

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.8716 31 176
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7791 32 172
2nsg-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant 0.7682 29 175
2nsf-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase 0.7475 29 175
3cex-assembly1.cif.gz_A crystal structure of the conserved protein of locus ef_3021 from enterococcus faecalis 0.7398 37 176
ID Description Score Start End Superfamily
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8931 31 176 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7892 31 176 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7624 27 175 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7314 34 171 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7172 27 175 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7W0JMZ5-F1-model_v4 DinB-like domain-containing protein 0.9951 37 170
AF-A0A653NAV5-F1-model_v4 DinB-like domain-containing protein 0.9898 47 173
AF-A0A7Y9IBM0-F1-model_v4 DinB-like domain-containing protein 0.988 5 177
AF-A1SJ57-F1-model_v4 Methyltransferase type 12 0.9877 6 173 GO:0008168
GO:0032259
AF-A0A0D8HEA7-F1-model_v4 DinB-like domain-containing protein 0.9877 7 175

Map