F339968

General Info

Members Datasets Scaffolds Average Seq Length
227 146 454 337

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10002944|Ga0213875_100029446
Length 394
Sequence MVPELANCPEFGGRSAESRKRRVGTAVEQRLSGTYKRSARVKECRKRFWLLRSSYMTPGEKERYSRQILFAPIGEAGQKKLRGACICIVGCGALGSFQAEALVRAGVGQLRLIDRDYVDFTNLQRQWLFDEADARDEVPKAIAAARRLRHLNSGVQIEPLVTDVTPSNIEELMIGCDLILDGTDNFETRYLLNDISVKQDVPWIYGAAIGSYGIVMPISPKQGPCFACVYPEPPAGAQPTCDVNGVLASATASVAALQVALALRLLVGWPDFTCRIQTLDVWEGTAKQFSTGPRDPECRVCVGREFLYLEGHRQKPVSLCGRNAVQLHESARPLDLQQLATRLRPLGDVRVNEFALRIELPKYHMTFFPDGRAIIKGTTDIGVAKSLYARLVGA

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
41 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
42 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
71 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
72 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
73 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
74 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
111 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
112 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.48
Metatranscriptomes 3.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.76
Rhizosphere 84.58
Stem 0
Stem Tuber 0
Unclassified 13.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10002944 3300021388 Bacteria 9915
2 Ga0058861_10106119 3300004800 Unclassified 1939
3 Ga0058862_10269979 3300004803 Bacteria 3432
4 Ga0070658_10247249 3300005327 Bacteria 1513
5 Ga0070683_100000088 3300005329 Bacteria 61766
6 Ga0070680_100028826 3300005336 Bacteria 4455
7 Ga0070680_100063971 3300005336 Bacteria 3015
8 Ga0070660_100042676 3300005339 Unclassified 3463
9 Ga0070660_100051471 3300005339 Unclassified 3172
10 Ga0070659_100059227 3300005366 Bacteria 3024
11 Ga0070714_100023457 3300005435 Bacteria 5069
12 Ga0070714_100228109 3300005435 Bacteria 1715
13 Ga0070713_100006753 3300005436 Bacteria 7996
14 Ga0070713_100076993 3300005436 Bacteria 2835
15 Ga0070711_100260454 3300005439 Bacteria 1364
16 Ga0070662_100311787 3300005457 Bacteria 1281
17 Ga0070681_10003175 3300005458 Bacteria 15296
18 Ga0070681_10017730 3300005458 Bacteria 7115
19 Ga0070681_10088151 3300005458 Bacteria 3055
20 Ga0070699_100287264 3300005518 Bacteria 1474
21 Ga0070679_100017795 3300005530 Bacteria 6882
22 Ga0070679_100065991 3300005530 Bacteria 3607
23 Ga0070684_100000003 3300005535 Bacteria 248527
24 Ga0070684_100124216 3300005535 Bacteria 2323
25 Ga0070684_100283535 3300005535 Bacteria 1518
26 Ga0068853_100193437 3300005539 Unclassified 1849
27 Ga0070695_100034776 3300005545 Bacteria 3162
28 Ga0070695_100085873 3300005545 Bacteria 2090
29 Ga0070695_100183505 3300005545 Bacteria 1484
30 Ga0070696_100001031 3300005546 Bacteria 18006
31 Ga0068855_100095267 3300005563 Unclassified 3431
32 Ga0070664_100032382 3300005564 Unclassified 4372
33 Ga0068856_100057844 3300005614 Unclassified 3828
34 Ga0068856_100092156 3300005614 Bacteria 3015
35 Ga0068856_100107565 3300005614 Unclassified 2784
36 Ga0081455_10031544 3300005937 Bacteria 4792
37 Ga0070717_10015470 3300006028 Bacteria 5895
38 Ga0105240_10009379 3300009093 Bacteria 13866
39 Ga0105240_10052789 3300009093 Bacteria 5107
40 Ga0105240_10119090 3300009093 Bacteria 3181
41 Ga0111539_10709408 3300009094 Unclassified 1171
42 Ga0105243_10146111 3300009148 Unclassified 2023
43 Ga0105237_10013824 3300009545 Bacteria 8450
44 Ga0105238_10135473 3300009551 Bacteria 2441
45 Ga0105238_10177298 3300009551 Bacteria 2108
46 Ga0105239_10096228 3300010375 Bacteria 3271
47 Ga0105239_10188526 3300010375 Bacteria 2308
48 Ga0157370_10032268 3300013104 Bacteria 5115
49 Ga0157369_10003608 3300013105 Bacteria 18397
50 Ga0157369_10179691 3300013105 Unclassified 2227
51 Ga0157374_10001551 3300013296 Bacteria 19367
52 Ga0157374_10128350 3300013296 Bacteria 2452
53 Ga0157372_10095081 3300013307 Unclassified 3394
54 Ga0157379_10021261 3300014968 Bacteria 5742
55 Ga0197907_10537375 3300020069 Bacteria 4208
56 Ga0206349_1592750 3300020075 Bacteria 4354
57 Ga0206351_11001867 3300020077 Bacteria 2886
58 Ga0206354_10751708 3300020081 Bacteria 3585
59 Ga0213873_10014202 3300021358 Bacteria 1761
60 Ga0213872_10000882 3300021361 Bacteria 21700
61 Ga0213874_10009193 3300021377 Bacteria 2436
62 Ga0213876_10007940 3300021384 Bacteria 5757
63 Ga0213876_10045186 3300021384 Bacteria 2329
64 Ga0213876_10087516 3300021384 Bacteria 1649
65 Ga0213875_10000017 3300021388 Bacteria 239813
66 Ga0213875_10000069 3300021388 Bacteria 121776
67 Ga0213875_10002912 3300021388 Bacteria 9990
68 Ga0213875_10012035 3300021388 Bacteria 4285
69 Ga0213875_10032286 3300021388 Bacteria 2475
70 Ga0213871_10000208 3300021441 Bacteria 6852
71 Ga0224712_10009277 3300022467 Bacteria 2958
72 Ga0207647_10074132 3300025904 Bacteria 2050
73 Ga0207707_10001398 3300025912 Bacteria 22342
74 Ga0207695_10037341 3300025913 Bacteria 5242
75 Ga0207671_10082398 3300025914 Bacteria 2414
76 Ga0207663_10156287 3300025916 Bacteria 1605
77 Ga0207660_10077901 3300025917 Bacteria 2428
78 Ga0207660_10090565 3300025917 Bacteria 2266
79 Ga0207657_10014195 3300025919 Bacteria 7789
80 Ga0207657_10046115 3300025919 Unclassified 3819
81 Ga0207652_10200881 3300025921 Bacteria 1794
82 Ga0207652_10222381 3300025921 Bacteria 1701
83 Ga0207694_10095618 3300025924 Bacteria 2349
84 Ga0207687_10001408 3300025927 Bacteria 16423
85 Ga0207700_10039425 3300025928 Bacteria 3439
86 Ga0207700_10161410 3300025928 Bacteria 1862
87 Ga0207664_10021444 3300025929 Bacteria 4804
88 Ga0207690_10121584 3300025932 Bacteria 1898
89 Ga0207665_10031813 3300025939 Bacteria 3492
90 Ga0207661_10000019 3300025944 Bacteria 235900
91 Ga0207667_10198204 3300025949 Bacteria 2060
92 Ga0207639_10330481 3300026041 Unclassified 1356
93 Ga0207702_10119968 3300026078 Unclassified 2352
94 Ga0265760_10000004 3300031090 Bacteria 149429
95 Ga0265325_10008407 3300031241 Bacteria 6094
96 Ga0265331_10020966 3300031250 Bacteria 3348
97 Ga0265316_10003623 3300031344 Bacteria 15567
98 Ga0265316_10045785 3300031344 Bacteria 3471
99 Ga0265316_10219024 3300031344 Bacteria 1405
100 Ga0307509_10299579 3300031507 Unclassified 1357
101 Ga0265342_10070726 3300031712 Bacteria 2035
102 Ga0373926_0032653 3300035083 Bacteria 1837
103 Ga0373934_0037333 3300035086 Bacteria 1913
104 Ga0373934_0071229 3300035086 Bacteria 1390
105 Ga0373953_0015898 3300035117 Bacteria 2738
106 Ga0373953_0073843 3300035117 Bacteria 1410
107 Ga0373954_0046306 3300035118 Bacteria 2033
108 Ga0373956_0074667 3300035119 Bacteria 1550
109 Ga0373935_0033082 3300035692 Unclassified 3217
110 Ga0373935_0126633 3300035692 Bacteria 1712
111 Ga0373927_0007390 3300035695 Bacteria 7435
112 Ga0373927_0011181 3300035695 Bacteria 5977
113 Ga0373927_0059266 3300035695 Unclassified 2476
114 Ga0373927_0085235 3300035695 Bacteria 2050
115 Ga0373933_0128804 3300035724 Bacteria 1590
116 Ga0373947_0012875 3300035725 Bacteria 4795
117 Ga0373937_0002232 3300036401 Bacteria 16182
118 Ga0373937_0002415 3300036401 Bacteria 15530
119 Ga0373937_0017827 3300036401 Bacteria 6335
120 Ga0373925_0012121 3300037068 Bacteria 6239
121 Ga0395898_0246669 3300037466 Bacteria 1703
122 Ga0436364_0093151 3300037853 Bacteria 54720
123 Ga0436364_0098719 3300037853 Bacteria 5447
124 Ga0436364_0248892 3300037853 Bacteria 4978
125 Ga0436364_0272984 3300037853 Bacteria 1933
126 Ga0436364_0278774 3300037853 Bacteria 400541
127 Ga0436364_0339530 3300037853 Bacteria 240640
128 Ga0436364_0466957 3300037853 Bacteria 6929
129 Ga0436364_0642562 3300037853 Bacteria 2010
130 Ga0436364_1090742 3300037853 Bacteria 2359
131 Ga0436364_1105150 3300037853 Bacteria 3783
132 Ga0436364_1195220 3300037853 Bacteria 5368
133 Ga0436364_1264647 3300037853 Bacteria 3568
134 Ga0395901_0319847 3300038443 Unclassified 1606
135 Ga0436365_0852797 3300039437 Unclassified 3533
136 Ga0436365_1219134 3300039437 Bacteria 1717
137 Ga0436365_1429642 3300039437 Bacteria 2225
138 Ga0436365_1766956 3300039437 Bacteria 4794
139 Ga0436360_0967265 3300039438 Bacteria 7513
140 Ga0436361_0070837 3300039447 Bacteria 61377
141 Ga0436363_0103028 3300039450 Bacteria 2340
142 Ga0436363_0942676 3300039450 Bacteria 3486
143 Ga0436363_1447410 3300039450 Unclassified 1525
144 Ga0436363_1512603 3300039450 Bacteria 2375
145 Ga0436362_0198087 3300039453 Bacteria 4203
146 Ga0436362_0510929 3300039453 Unclassified 2479
147 Ga0436362_0947197 3300039453 Bacteria 1330
148 Ga0466966_0116426 3300044684 Bacteria 1645
149 Ga0451576_0319970 3300045051 Bacteria 1623
150 Ga0451576_0336309 3300045051 Bacteria 1580
151 Ga0451576_0370954 3300045051 Bacteria 1500
152 Ga0451576_0495677 3300045051 Bacteria 1283
153 Ga0466958_0098871 3300045836 Unclassified 1812
154 Ga0466967_0180326 3300045976 Unclassified 1992
155 Ga0495592_0042361 3300046454 Bacteria 3409
156 Ga0495651_0157076 3300046462 Bacteria 1634
157 Ga0495653_0033507 3300046463 Bacteria 4069
158 Ga0495580_0004774 3300046472 Bacteria 11350
159 Ga0495580_0005136 3300046472 Bacteria 10889
160 Ga0495580_0014618 3300046472 Bacteria 5950
161 Ga0495662_0007285 3300046476 Bacteria 5473
162 Ga0495664_0000920 3300046477 Bacteria 15156
163 Ga0495608_0038166 3300046511 Bacteria 3227
164 Ga0495628_0013133 3300046516 Bacteria 6972
165 Ga0495630_0051535 3300046517 Bacteria 3080
166 Ga0495666_0097677 3300046526 Bacteria 1385
167 Ga0495652_0014294 3300046529 Bacteria 7128
168 Ga0495665_0004079 3300046531 Bacteria 7878
169 Ga0495586_0060357 3300046535 Bacteria 2062
170 Ga0495645_0002704 3300046543 Bacteria 12026
171 Ga0495667_0010698 3300046559 Bacteria 6204
172 Ga0495634_0021800 3300046642 Bacteria 4522
173 Ga0495635_0074813 3300046663 Bacteria 2320
174 Ga0495599_0001426 3300046678 Bacteria 13689
175 Ga0495623_0015326 3300046679 Bacteria 4954
176 Ga0495646_0014090 3300046680 Bacteria 5085
177 Ga0495604_0109556 3300047317 Bacteria 2015
178 Ga0495674_0004483 3300047319 Bacteria 13442
179 Ga0495674_0309183 3300047319 Bacteria 1290
180 Ga0495680_0008655 3300047322 Bacteria 9236
181 Ga0495675_0033901 3300047444 Bacteria 3259
182 Ga0495684_0021920 3300047471 Bacteria 4919
183 Ga0495602_0050358 3300048088 Bacteria 3722
184 Ga0496112_0013486 3300048915 Bacteria 7547
185 Ga0496112_0014344 3300048915 Bacteria 7343
186 Ga0496114_0607900 3300048917 Unclassified 964
187 Ga0496115_0087789 3300048918 Unclassified 2538
188 Ga0501031_0004795 3300049568 Bacteria 8782
189 Ga0501033_0005256 3300049570 Bacteria 10274
190 Ga0501033_0033319 3300049570 Bacteria 3868
191 Ga0501034_0017000 3300049571 Bacteria 7457
192 Ga0501034_0122441 3300049571 Bacteria 2587
193 Ga0501036_0000169 3300049572 Bacteria 43136
194 Ga0501038_0007680 3300049574 Bacteria 9943
195 Ga0501039_0022335 3300049575 Unclassified 4857
196 Ga0501042_0243569 3300049578 Bacteria 1297
197 Ga0501043_0000890 3300049579 Bacteria 26517
198 Ga0501043_0033124 3300049579 Unclassified 4065
199 Ga0501046_0013852 3300049580 Bacteria 6811
200 Ga0501046_0039896 3300049580 Unclassified 3756
201 Ga0501047_0105363 3300049581 Bacteria 2700
202 Ga0501047_0142470 3300049581 Bacteria 2275
203 Ga0501047_0287953 3300049581 Bacteria 1486
204 Ga0501048_0070138 3300049582 Bacteria 2476
205 Ga0501067_0001492 3300049583 Bacteria 12732
206 Ga0501068_0000613 3300049584 Bacteria 18149
207 Ga0501070_0028692 3300049586 Unclassified 4665
208 Ga0501072_0009713 3300049588 Bacteria 7317
209 Ga0501073_0001756 3300049589 Bacteria 16098
210 Ga0501073_0134889 3300049589 Bacteria 1711
211 Ga0501074_0015076 3300049590 Bacteria 5623
212 Ga0501079_0003508 3300049741 Bacteria 11526
213 Ga0501080_0000578 3300049742 Bacteria 29062
214 Ga0501035_0026796 3300049822 Bacteria 5272
215 Ga0501035_0039276 3300049822 Bacteria 4283
216 Ga0501035_0101131 3300049822 Bacteria 2530
217 Ga0501035_0194968 3300049822 Unclassified 1740
218 Ga0501044_0002678 3300049823 Bacteria 20254
219 Ga0501044_0004707 3300049823 Bacteria 15255
220 Ga0501044_0010824 3300049823 Bacteria 9897
221 Ga0501044_0239313 3300049823 Bacteria 1759
222 Ga0501044_0239712 3300049823 Bacteria 1757
223 Ga0495612_0046159 3300053078 Bacteria 1784
224 Ga0495619_0093723 3300053085 Bacteria 2036
225 Ga0495619_0150611 3300053085 Bacteria 1605
226 Ga0501084_0002069 3300054114 Bacteria 16013
227 Ga0501082_0000052 3300060353 Bacteria 83141
228 Ga0213875_10002944
229 Ga0058861_10106119
230 Ga0058862_10269979
231 Ga0070658_10247249
232 Ga0070683_100000088
233 Ga0070680_100028826
234 Ga0070680_100063971
235 Ga0070660_100042676
236 Ga0070660_100051471
237 Ga0070659_100059227
238 Ga0070714_100023457
239 Ga0070714_100228109
240 Ga0070713_100006753
241 Ga0070713_100076993
242 Ga0070711_100260454
243 Ga0070662_100311787
244 Ga0070681_10003175
245 Ga0070681_10017730
246 Ga0070681_10088151
247 Ga0070699_100287264
248 Ga0070679_100017795
249 Ga0070679_100065991
250 Ga0070684_100000003
251 Ga0070684_100124216
252 Ga0070684_100283535
253 Ga0068853_100193437
254 Ga0070695_100034776
255 Ga0070695_100085873
256 Ga0070695_100183505
257 Ga0070696_100001031
258 Ga0068855_100095267
259 Ga0070664_100032382
260 Ga0068856_100057844
261 Ga0068856_100092156
262 Ga0068856_100107565
263 Ga0081455_10031544
264 Ga0070717_10015470
265 Ga0105240_10009379
266 Ga0105240_10052789
267 Ga0105240_10119090
268 Ga0111539_10709408
269 Ga0105243_10146111
270 Ga0105237_10013824
271 Ga0105238_10135473
272 Ga0105238_10177298
273 Ga0105239_10096228
274 Ga0105239_10188526
275 Ga0157370_10032268
276 Ga0157369_10003608
277 Ga0157369_10179691
278 Ga0157374_10001551
279 Ga0157374_10128350
280 Ga0157372_10095081
281 Ga0157379_10021261
282 Ga0197907_10537375
283 Ga0206349_1592750
284 Ga0206351_11001867
285 Ga0206354_10751708
286 Ga0213873_10014202
287 Ga0213872_10000882
288 Ga0213874_10009193
289 Ga0213876_10007940
290 Ga0213876_10045186
291 Ga0213876_10087516
292 Ga0213875_10000017
293 Ga0213875_10000069
294 Ga0213875_10002912
295 Ga0213875_10012035
296 Ga0213875_10032286
297 Ga0213871_10000208
298 Ga0224712_10009277
299 Ga0207647_10074132
300 Ga0207707_10001398
301 Ga0207695_10037341
302 Ga0207671_10082398
303 Ga0207663_10156287
304 Ga0207660_10077901
305 Ga0207660_10090565
306 Ga0207657_10014195
307 Ga0207657_10046115
308 Ga0207652_10200881
309 Ga0207652_10222381
310 Ga0207694_10095618
311 Ga0207687_10001408
312 Ga0207700_10039425
313 Ga0207700_10161410
314 Ga0207664_10021444
315 Ga0207690_10121584
316 Ga0207665_10031813
317 Ga0207661_10000019
318 Ga0207667_10198204
319 Ga0207639_10330481
320 Ga0207702_10119968
321 Ga0265760_10000004
322 Ga0265325_10008407
323 Ga0265331_10020966
324 Ga0265316_10003623
325 Ga0265316_10045785
326 Ga0265316_10219024
327 Ga0307509_10299579
328 Ga0265342_10070726
329 Ga0373926_0032653
330 Ga0373934_0037333
331 Ga0373934_0071229
332 Ga0373953_0015898
333 Ga0373953_0073843
334 Ga0373954_0046306
335 Ga0373956_0074667
336 Ga0373935_0033082
337 Ga0373935_0126633
338 Ga0373927_0007390
339 Ga0373927_0011181
340 Ga0373927_0059266
341 Ga0373927_0085235
342 Ga0373933_0128804
343 Ga0373947_0012875
344 Ga0373937_0002232
345 Ga0373937_0002415
346 Ga0373937_0017827
347 Ga0373925_0012121
348 Ga0395898_0246669
349 Ga0436364_0093151
350 Ga0436364_0098719
351 Ga0436364_0248892
352 Ga0436364_0272984
353 Ga0436364_0278774
354 Ga0436364_0339530
355 Ga0436364_0466957
356 Ga0436364_0642562
357 Ga0436364_1090742
358 Ga0436364_1105150
359 Ga0436364_1195220
360 Ga0436364_1264647
361 Ga0395901_0319847
362 Ga0436365_0852797
363 Ga0436365_1219134
364 Ga0436365_1429642
365 Ga0436365_1766956
366 Ga0436360_0967265
367 Ga0436361_0070837
368 Ga0436363_0103028
369 Ga0436363_0942676
370 Ga0436363_1447410
371 Ga0436363_1512603
372 Ga0436362_0198087
373 Ga0436362_0510929
374 Ga0436362_0947197
375 Ga0466966_0116426
376 Ga0451576_0319970
377 Ga0451576_0336309
378 Ga0451576_0370954
379 Ga0451576_0495677
380 Ga0466958_0098871
381 Ga0466967_0180326
382 Ga0495592_0042361
383 Ga0495651_0157076
384 Ga0495653_0033507
385 Ga0495580_0004774
386 Ga0495580_0005136
387 Ga0495580_0014618
388 Ga0495662_0007285
389 Ga0495664_0000920
390 Ga0495608_0038166
391 Ga0495628_0013133
392 Ga0495630_0051535
393 Ga0495666_0097677
394 Ga0495652_0014294
395 Ga0495665_0004079
396 Ga0495586_0060357
397 Ga0495645_0002704
398 Ga0495667_0010698
399 Ga0495634_0021800
400 Ga0495635_0074813
401 Ga0495599_0001426
402 Ga0495623_0015326
403 Ga0495646_0014090
404 Ga0495604_0109556
405 Ga0495674_0004483
406 Ga0495674_0309183
407 Ga0495680_0008655
408 Ga0495675_0033901
409 Ga0495684_0021920
410 Ga0495602_0050358
411 Ga0496112_0013486
412 Ga0496112_0014344
413 Ga0496114_0607900
414 Ga0496115_0087789
415 Ga0501031_0004795
416 Ga0501033_0005256
417 Ga0501033_0033319
418 Ga0501034_0017000
419 Ga0501034_0122441
420 Ga0501036_0000169
421 Ga0501038_0007680
422 Ga0501039_0022335
423 Ga0501042_0243569
424 Ga0501043_0000890
425 Ga0501043_0033124
426 Ga0501046_0013852
427 Ga0501046_0039896
428 Ga0501047_0105363
429 Ga0501047_0142470
430 Ga0501047_0287953
431 Ga0501048_0070138
432 Ga0501067_0001492
433 Ga0501068_0000613
434 Ga0501070_0028692
435 Ga0501072_0009713
436 Ga0501073_0001756
437 Ga0501073_0134889
438 Ga0501074_0015076
439 Ga0501079_0003508
440 Ga0501080_0000578
441 Ga0501035_0026796
442 Ga0501035_0039276
443 Ga0501035_0101131
444 Ga0501035_0194968
445 Ga0501044_0002678
446 Ga0501044_0004707
447 Ga0501044_0010824
448 Ga0501044_0239313
449 Ga0501044_0239712
450 Ga0495612_0046159
451 Ga0495619_0093723
452 Ga0495619_0150611
453 Ga0501084_0002069
454 Ga0501082_0000052

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00899

ThiF

ThiF family

64

300

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zud-assembly3.cif.gz_1 structure of this-thif protein complex 0.9674 11 254
1zfn-assembly1.cif.gz_B structural analysis of escherichia coli thif 0.9665 11 253
1zkm-assembly2.cif.gz_D structural analysis of escherichia coli thif 0.9593 11 253
1jwa-assembly1.cif.gz_B-2 structure of the atp-bound moeb-moad protein complex 0.9563 11 243
1zud-assembly2.cif.gz_3 structure of this-thif protein complex 0.9549 11 253
ID Description Score Start End Superfamily
af_Q6H7A7_75_268_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9779 10 169 3.40.50.720
af_L7N674_15_263_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9645 10 253 3.40.50.720
af_Q2FVX7_2_246_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9613 11 253 3.40.50.720
1zkmD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9593 11 253 3.40.50.720
af_P38820_40_296_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9546 11 255 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A519VYU2-F1-model_v4 HesA/MoeB/ThiF family protein 0.9917 11 153 GO:0004792
GO:0005829
GO:0008146
GO:0008641
GO:0016020
GO:0016779
AF-A0A3D2REG5-F1-model_v4 Molybdopterin biosynthesis protein MoeB 0.9906 8 146 GO:0004792
GO:0005524
GO:0005829
GO:0008146
GO:0008641
GO:0016779
AF-A0A3B0MD99-F1-model_v4 Putative adenylyltransferase/sulfurtransferase MoeZ 0.9895 13 170 GO:0004792
GO:0005737
GO:0008641
GO:0016779
AF-A0A7W1HB95-F1-model_v4 HesA/MoeB/ThiF family protein 0.9893 12 180 GO:0004792
GO:0005829
GO:0008146
GO:0008641
GO:0016779
AF-A0A2V9HWS4-F1-model_v4 Thiamine biosynthesis protein ThiF 0.989 20 176 GO:0008641
GO:0016020
GO:0061503
GO:0061504

Map