F339871

General Info

Members Datasets Scaffolds Average Seq Length
227 184 450 357

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10000274|Ga0105243_1000027452
Length 388
Sequence VPGARTGVGGRPSLSRPNAHENVFQLGSVPAMISTVVWGTGNVGRAAIRAVDAHPALKLANVIVNNPDKVGRDAGDLSGLGSELGVAATDDIEAVLAASPGAVVYAASGDIRPDDALADICRAIRAGAVVVSPALYPLYDPTNAPPELRDPVLAAIAEGGGSLFASGVDPGWGNDVLPLLLSGLGSTVDVIRCQEIFDYSTYDQPDSVRYLVGMGQPMDYLPPMIAPTIPTMVWGGQIRMMARALGVELDEIRETLDRRALDATVTTKTMGEFEAGTQGAVRFEVQGIVDGEPRIVIEHVTRIHPTCATDWPMPPDGDGAHRVIIEGRPRIEVSVECTDEDGSRSAGGNATAVGRLVSAIDWLVAAEPGIYDALDVPLRPAVGKLGKR

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
74 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
75 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
76 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
77 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
86 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
87 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
88 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
89 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
110 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
111 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
114 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
128 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
138 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
139 2547132424 Nocardia nova SH22a Isolate Unclassified
140 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
141 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
142 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
143 2643221578 Streptomyces sp. Root63 Isolate Unclassified
144 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
145 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
146 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
147 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
148 2643221692 Nocardia sp. Root136 Isolate Unclassified
149 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
150 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
151 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
152 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
153 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
154 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
155 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
156 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
157 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
158 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
159 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
160 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
161 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
162 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
163 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
164 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
165 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
166 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
167 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
168 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
169 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
170 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
171 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
172 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
173 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
174 2922554459 Rhodococcus sp. 66b Isolate Unclassified
175 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
176 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
177 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
178 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
179 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
180 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
181 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
182 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
183 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
184 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76.65
Metatranscriptomes 1.76
Isolates 21.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.05
Nodule 0
Rhizoplane 3.52
Rhizosphere 71.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10000274 3300009148 Bacteria 57534
2 Ga0006562J51391_1068671 3300003578 Bacteria 1470
3 Ga0006562J51391_1246357 3300003578 Bacteria 60288
4 Ga0006562J51391_1246358 3300003578 Bacteria 60288
5 Ga0070676_10094404 3300005328 Bacteria 1838
6 Ga0068869_100018500 3300005334 Bacteria 4744
7 Ga0068868_100087745 3300005338 Bacteria 2502
8 Ga0070668_100080128 3300005347 Bacteria 2558
9 Ga0070669_100210436 3300005353 Bacteria 1534
10 Ga0070674_100051753 3300005356 Bacteria 2831
11 Ga0070673_100103577 3300005364 Bacteria 2348
12 Ga0070714_100023179 3300005435 Bacteria 5096
13 Ga0070714_100110261 3300005435 Bacteria 2436
14 Ga0070710_10000172 3300005437 Bacteria 29634
15 Ga0070710_10050702 3300005437 Bacteria 2328
16 Ga0070711_100022825 3300005439 Bacteria 4060
17 Ga0070705_100030617 3300005440 Bacteria 2972
18 Ga0070694_100052701 3300005444 Bacteria 2751
19 Ga0070663_100034590 3300005455 Bacteria 3500
20 Ga0070663_100144924 3300005455 Bacteria 1816
21 Ga0070678_100123708 3300005456 Bacteria 2044
22 Ga0068853_100019925 3300005539 Bacteria 5571
23 Ga0068853_100030423 3300005539 Bacteria 4560
24 Ga0070665_100038872 3300005548 Bacteria 4784
25 Ga0070665_100127365 3300005548 Bacteria 2549
26 Ga0068855_100010663 3300005563 Bacteria 11085
27 Ga0068857_100376695 3300005577 Bacteria 1317
28 Ga0068854_100043173 3300005578 Bacteria 3194
29 Ga0068852_100455811 3300005616 Bacteria 1267
30 Ga0068859_100062665 3300005617 Bacteria 3749
31 Ga0068864_100065617 3300005618 Bacteria 3149
32 Ga0081539_10000126 3300005985 Bacteria 180324
33 Ga0075363_100002639 3300006048 Bacteria 7393
34 Ga0075363_100075053 3300006048 Bacteria 1842
35 Ga0075364_10005551 3300006051 Bacteria 7347
36 Ga0070716_100071178 3300006173 Bacteria 2044
37 Ga0070712_100001274 3300006175 Bacteria 15214
38 Ga0075367_10005162 3300006178 Bacteria 6451
39 Ga0075369_10075393 3300006186 Bacteria 1490
40 Ga0075370_10000779 3300006353 Bacteria 12736
41 Ga0075370_10028057 3300006353 Bacteria 3127
42 Ga0075428_100007040 3300006844 Bacteria 12473
43 Ga0075428_100019011 3300006844 Bacteria 7598
44 Ga0075430_100008992 3300006846 Bacteria 8441
45 Ga0075430_100025050 3300006846 Bacteria 5076
46 Ga0075431_100003170 3300006847 Bacteria 15908
47 Ga0075429_100001035 3300006880 Bacteria 22230
48 Ga0097620_100062656 3300006931 Bacteria 3749
49 Ga0105251_10017506 3300009011 Bacteria 3839
50 Ga0105240_10008450 3300009093 Bacteria 14727
51 Ga0111539_10001628 3300009094 Bacteria 30018
52 Ga0105245_10088723 3300009098 Bacteria 2841
53 Ga0114129_10036982 3300009147 Bacteria 6893
54 Ga0114129_10122798 3300009147 Bacteria 3573
55 Ga0105237_10102961 3300009545 Bacteria 2847
56 Ga0105238_10006551 3300009551 Bacteria 11596
57 Ga0105239_10014358 3300010375 Bacteria 8787
58 Ga0157369_10353319 3300013105 Bacteria 1526
59 Ga0157374_10005046 3300013296 Bacteria 11074
60 Ga0157374_10033193 3300013296 Bacteria 4708
61 Ga0163162_10048014 3300013306 Bacteria 4277
62 Ga0157372_10386194 3300013307 Bacteria 1631
63 Ga0157376_10427907 3300014969 Bacteria 1286
64 Ga0163161_10032377 3300017792 Bacteria 3732
65 Ga0224712_10003805 3300022467 Bacteria 3982
66 Ga0207692_10000228 3300025898 Bacteria 19007
67 Ga0207692_10042738 3300025898 Bacteria 2251
68 Ga0207688_10006836 3300025901 Bacteria 6206
69 Ga0207699_10067539 3300025906 Bacteria 2174
70 Ga0207695_10011141 3300025913 Bacteria 10911
71 Ga0207671_10005478 3300025914 Bacteria 11683
72 Ga0207693_10003893 3300025915 Bacteria 12709
73 Ga0207663_10091915 3300025916 Bacteria 2016
74 Ga0207694_10004167 3300025924 Bacteria 11350
75 Ga0207664_10057021 3300025929 Bacteria 3104
76 Ga0207709_10007782 3300025935 Bacteria 5940
77 Ga0207665_10109966 3300025939 Bacteria 1935
78 Ga0207689_10066832 3300025942 Bacteria 2955
79 Ga0207667_10091252 3300025949 Bacteria 3147
80 Ga0207640_10132407 3300025981 Bacteria 1804
81 Ga0207658_10014549 3300025986 Bacteria 5388
82 Ga0207678_10000268 3300026067 Bacteria 47323
83 Ga0207678_10163925 3300026067 Bacteria 1898
84 Ga0207708_10013001 3300026075 Bacteria 6210
85 Ga0207675_100135493 3300026118 Bacteria 2336
86 Ga0207698_10176504 3300026142 Bacteria 1887
87 Ga0268266_10098318 3300028379 Bacteria 2575
88 Ga0307515_10085231 3300028794 Bacteria 4046
89 Ga0307515_10096595 3300028794 Bacteria 3622
90 Ga0307512_10007881 3300030522 Bacteria 10473
91 Ga0307512_10046485 3300030522 Bacteria 3539
92 Ga0316177_1021611 3300030731 Bacteria 2541
93 Ga0316176_1063116 3300030732 Bacteria 2341
94 Ga0314311_1083851 3300030733 Bacteria 2130
95 Ga0307513_10029889 3300031456 Bacteria 6199
96 Ga0307513_10078690 3300031456 Bacteria 3409
97 Ga0307410_10007516 3300031852 Bacteria 5971
98 Ga0307410_10020845 3300031852 Bacteria 4020
99 Ga0307407_10035893 3300031903 Bacteria 2727
100 Ga0307409_100010441 3300031995 Bacteria 5777
101 Ga0307409_100139978 3300031995 Bacteria 2083
102 Ga0307414_10377101 3300032004 Bacteria 1225
103 Ga0307411_10010779 3300032005 Bacteria 4893
104 Ga0307415_100067396 3300032126 Bacteria 2501
105 Ga0316584_0156079 3300036712 Bacteria 1697
106 Ga0439466_0005219 3300041411 Bacteria 4972
107 Ga0439465_0031256 3300041413 Bacteria 1695
108 Ga0451837_1559428 3300041494 Bacteria 5287
109 Ga0439434_0016915 3300042435 Bacteria 2180
110 Ga0466972_0042275 3300044658 Bacteria 2216
111 Ga0466965_0002764 3300044683 Bacteria 7537
112 Ga0466965_0004136 3300044683 Bacteria 6451
113 Ga0466966_0058366 3300044684 Bacteria 2439
114 Ga0466966_0107663 3300044684 Bacteria 1719
115 Ga0466961_0016233 3300044693 Bacteria 4782
116 Ga0466968_0012631 3300044735 Bacteria 3310
117 Ga0466960_0008263 3300044901 Bacteria 4257
118 Ga0466960_0049129 3300044901 Bacteria 2030
119 Ga0466958_0117979 3300045836 Bacteria 1660
120 Ga0466967_0459855 3300045976 Bacteria 1245
121 Ga0495603_0006433 3300046455 Bacteria 7034
122 Ga0495603_0015404 3300046455 Bacteria 4626
123 Ga0495603_0020858 3300046455 Bacteria 3967
124 Ga0495603_0021412 3300046455 Bacteria 3915
125 Ga0495629_0000464 3300046459 Bacteria 33947
126 Ga0495629_0000965 3300046459 Bacteria 23203
127 Ga0495629_0019392 3300046459 Bacteria 4859
128 Ga0495629_0109965 3300046459 Bacteria 1921
129 Ga0495662_0039735 3300046476 Bacteria 2272
130 Ga0495662_0043890 3300046476 Bacteria 2158
131 Ga0495662_0043953 3300046476 Bacteria 2156
132 Ga0495594_0001149 3300046499 Bacteria 13828
133 Ga0495628_0029384 3300046516 Bacteria 4458
134 Ga0495622_0024804 3300046557 Bacteria 2800
135 Ga0495668_0000294 3300046616 Bacteria 68626
136 Ga0495588_0005808 3300046674 Bacteria 5521
137 Ga0495588_0007559 3300046674 Bacteria 4952
138 Ga0495657_0010059 3300046675 Bacteria 7131
139 Ga0495613_0005017 3300046689 Bacteria 9941
140 Ga0495670_0115278 3300046691 Bacteria 1393
141 Ga0495589_0021927 3300046794 Bacteria 3263
142 Ga0495581_0055714 3300047315 Bacteria 2282
143 Ga0495636_0002725 3300047318 Bacteria 6814
144 Ga0495636_0008686 3300047318 Bacteria 4006
145 Ga0495676_0086228 3300047321 Bacteria 2363
146 Ga0495687_006521 3300047443 Bacteria 7130
147 Ga0495685_001637 3300047447 Bacteria 6909
148 Ga0495685_018926 3300047447 Bacteria 2364
149 Ga0495686_0002605 3300047472 Bacteria 16729
150 Ga0495686_0039188 3300047472 Bacteria 3027
151 Ga0495614_0013938 3300048089 Bacteria 3523
152 Ga0496101_0144103 3300048904 Bacteria 1818
153 Ga0496102_0025687 3300048905 Bacteria 5246
154 Ga0496102_0104209 3300048905 Bacteria 2638
155 Ga0496108_0000330 3300048911 Bacteria 40103
156 Ga0496108_0062100 3300048911 Bacteria 3146
157 Ga0496109_0012077 3300048912 Bacteria 7442
158 Ga0496110_0333007 3300048913 Bacteria 1383
159 Ga0496114_0199706 3300048917 Bacteria 1751
160 Ga0496125_0030121 3300048928 Bacteria 4860
161 Ga0501034_0019920 3300049571 Bacteria 6852
162 Ga0501047_0207361 3300049581 Bacteria 1819
163 Ga0501067_0007088 3300049583 Bacteria 6227
164 nmdc:mga03683_13308_c1 3300050489 Bacteria 3025
165 nmdc:mga03n38_3448_c1 3300050490 Bacteria 5081
166 nmdc:mga03n38_55267_c1 3300050490 Bacteria 1788
167 nmdc:mga00v17_3584_c1 3300050491 Bacteria 8020
168 nmdc:mga0yw44_68531_c1 3300050492 Bacteria 2195
169 nmdc:mga06z11_3480_c1 3300050494 Bacteria 6096
170 nmdc:mga07m45_543_c1 3300050496 Bacteria 16013
171 nmdc:mga05p37_81229_c1 3300050507 Bacteria 3993
172 nmdc:mga09592_141407_c1 3300050508 Bacteria 2075
173 nmdc:mga0qj67_9199_c1 3300050509 Bacteria 7339
174 nmdc:mga06r32_66876_c1 3300050510 Bacteria 3469
175 nmdc:mga0sz30_41807_c1 3300050516 Bacteria 1927
176 Ga0500641_0033266 3300053096 Bacteria 2045
177 2548693586 2547132424 Bacteria 8348532
178 2552108373 2551306166 Bacteria 9731570
179 2566993680 2565956761 Bacteria 6601618
180 2586060960 2585427649 Bacteria 9053857
181 2643901075 2643221578 Bacteria 9213798
182 2643947099 2643221587 Bacteria 7586415
183 2644407219 2643221673 Bacteria 9196637
184 2644433430 2643221677 Bacteria 7584031
185 2644441391 2643221678 Bacteria 9540101
186 2644516066 2643221692 Bacteria 7282860
187 2645721789 2643221961 Bacteria 3919167
188 2645724265 2643221962 Bacteria 3874254
189 2676491422 2675903060 Bacteria 10051191
190 2739204603 2738543005 Bacteria 5278128
191 2739237894 2738543011 Bacteria 5731169
192 2739237895 2738543011 Bacteria 5731169
193 2744955932 2744054611 Bacteria 5611514
194 2791912037 2791354901 Bacteria 8322202
195 2809198283 2808606439 Bacteria 5952208
196 2809590022 2808606522 Bacteria 9488490
197 2811842722 2808606982 Bacteria 7791042
198 2812349462 2811994878 Bacteria 5992952
199 2862185834 2862178590 Bacteria 8583590
200 2862290980 2862290372 Bacteria 7471434
201 2870784361 2870782633 Bacteria 9624083
202 2873152783 2873151551 Bacteria 8625867
203 2875398302 2875391855 Bacteria 7600475
204 2889303593 2889300758 Bacteria 5690814
205 2889303594 2889300758 Bacteria 5690814
206 2891969327 2891968417 Bacteria 5821697
207 2895428422 2895427314 Bacteria 13147766
208 2904536770 2904535858 Bacteria 6308016
209 2912715403 2912715099 Bacteria 9460473
210 2915770480 2915768154 Bacteria 8424322
211 2918501726 2918501144 Bacteria 8668083
212 2919473360 2919468124 Bacteria 9133025
213 2919719190 2919713450 Bacteria 7431245
214 2922555210 2922554459 Bacteria 6683962
215 2928145438 2928142448 Bacteria 5288925
216 2935393039 2935390628 Bacteria 7043367
217 2939747378 2939743619 Bacteria 5762299
218 2939747379 2939743619 Bacteria 5762299
219 2946045972 2946045630 Bacteria 8527308
220 3002999979 3002998708 Bacteria 11715108
221 3006491107 3006486233 Bacteria 8157040
222 8003317151 8003314358 Bacteria 10575343
223 8047711077 8047710418 Bacteria 11023148
224 8055068256 8055066027 Bacteria 9479577
225 8055173982 8055172936 Bacteria 9305943
226 Ga0105243_10000274
227 Ga0006562J51391_1068671
228 Ga0006562J51391_1246357
229 Ga0006562J51391_1246358
230 Ga0070676_10094404
231 Ga0068869_100018500
232 Ga0068868_100087745
233 Ga0070668_100080128
234 Ga0070669_100210436
235 Ga0070674_100051753
236 Ga0070673_100103577
237 Ga0070714_100023179
238 Ga0070714_100110261
239 Ga0070710_10000172
240 Ga0070710_10050702
241 Ga0070711_100022825
242 Ga0070705_100030617
243 Ga0070694_100052701
244 Ga0070663_100034590
245 Ga0070663_100144924
246 Ga0070678_100123708
247 Ga0068853_100019925
248 Ga0068853_100030423
249 Ga0070665_100038872
250 Ga0070665_100127365
251 Ga0068855_100010663
252 Ga0068857_100376695
253 Ga0068854_100043173
254 Ga0068852_100455811
255 Ga0068859_100062665
256 Ga0068864_100065617
257 Ga0081539_10000126
258 Ga0075363_100002639
259 Ga0075363_100075053
260 Ga0075364_10005551
261 Ga0070716_100071178
262 Ga0070712_100001274
263 Ga0075367_10005162
264 Ga0075369_10075393
265 Ga0075370_10000779
266 Ga0075370_10028057
267 Ga0075428_100007040
268 Ga0075428_100019011
269 Ga0075430_100008992
270 Ga0075430_100025050
271 Ga0075431_100003170
272 Ga0075429_100001035
273 Ga0097620_100062656
274 Ga0105251_10017506
275 Ga0105240_10008450
276 Ga0111539_10001628
277 Ga0105245_10088723
278 Ga0114129_10036982
279 Ga0114129_10122798
280 Ga0105237_10102961
281 Ga0105238_10006551
282 Ga0105239_10014358
283 Ga0157369_10353319
284 Ga0157374_10005046
285 Ga0157374_10033193
286 Ga0163162_10048014
287 Ga0157372_10386194
288 Ga0157376_10427907
289 Ga0163161_10032377
290 Ga0224712_10003805
291 Ga0207692_10000228
292 Ga0207692_10042738
293 Ga0207688_10006836
294 Ga0207699_10067539
295 Ga0207695_10011141
296 Ga0207671_10005478
297 Ga0207693_10003893
298 Ga0207663_10091915
299 Ga0207694_10004167
300 Ga0207664_10057021
301 Ga0207709_10007782
302 Ga0207665_10109966
303 Ga0207689_10066832
304 Ga0207667_10091252
305 Ga0207640_10132407
306 Ga0207658_10014549
307 Ga0207678_10000268
308 Ga0207678_10163925
309 Ga0207708_10013001
310 Ga0207675_100135493
311 Ga0207698_10176504
312 Ga0268266_10098318
313 Ga0307515_10085231
314 Ga0307515_10096595
315 Ga0307512_10007881
316 Ga0307512_10046485
317 Ga0316177_1021611
318 Ga0316176_1063116
319 Ga0314311_1083851
320 Ga0307513_10029889
321 Ga0307513_10078690
322 Ga0307410_10007516
323 Ga0307410_10020845
324 Ga0307407_10035893
325 Ga0307409_100010441
326 Ga0307409_100139978
327 Ga0307414_10377101
328 Ga0307411_10010779
329 Ga0307415_100067396
330 Ga0316584_0156079
331 Ga0439466_0005219
332 Ga0439465_0031256
333 Ga0451837_1559428
334 Ga0439434_0016915
335 Ga0466972_0042275
336 Ga0466965_0002764
337 Ga0466965_0004136
338 Ga0466966_0058366
339 Ga0466966_0107663
340 Ga0466961_0016233
341 Ga0466968_0012631
342 Ga0466960_0008263
343 Ga0466960_0049129
344 Ga0466958_0117979
345 Ga0466967_0459855
346 Ga0495603_0006433
347 Ga0495603_0015404
348 Ga0495603_0020858
349 Ga0495603_0021412
350 Ga0495629_0000464
351 Ga0495629_0000965
352 Ga0495629_0019392
353 Ga0495629_0109965
354 Ga0495662_0039735
355 Ga0495662_0043890
356 Ga0495662_0043953
357 Ga0495594_0001149
358 Ga0495628_0029384
359 Ga0495622_0024804
360 Ga0495668_0000294
361 Ga0495588_0005808
362 Ga0495588_0007559
363 Ga0495657_0010059
364 Ga0495613_0005017
365 Ga0495670_0115278
366 Ga0495589_0021927
367 Ga0495581_0055714
368 Ga0495636_0002725
369 Ga0495636_0008686
370 Ga0495676_0086228
371 Ga0495687_006521
372 Ga0495685_001637
373 Ga0495685_018926
374 Ga0495686_0002605
375 Ga0495686_0039188
376 Ga0495614_0013938
377 Ga0496101_0144103
378 Ga0496102_0025687
379 Ga0496102_0104209
380 Ga0496108_0000330
381 Ga0496108_0062100
382 Ga0496109_0012077
383 Ga0496110_0333007
384 Ga0496114_0199706
385 Ga0496125_0030121
386 Ga0501034_0019920
387 Ga0501047_0207361
388 Ga0501067_0007088
389 nmdc:mga03683_13308_c1
390 nmdc:mga03n38_3448_c1
391 nmdc:mga03n38_55267_c1
392 nmdc:mga00v17_3584_c1
393 nmdc:mga0yw44_68531_c1
394 nmdc:mga06z11_3480_c1
395 nmdc:mga07m45_543_c1
396 nmdc:mga05p37_81229_c1
397 nmdc:mga09592_141407_c1
398 nmdc:mga0qj67_9199_c1
399 nmdc:mga06r32_66876_c1
400 nmdc:mga0sz30_41807_c1
401 Ga0500641_0033266
402 2548693586
403 2552108373
404 2566993680
405 2586060960
406 2643901075
407 2643947099
408 2644407219
409 2644433430
410 2644441391
411 2644516066
412 2645721789
413 2645724265
414 2676491422
415 2739204603
416 2739237894
417 2739237895
418 2744955932
419 2791912037
420 2809198283
421 2809590022
422 2811842722
423 2812349462
424 2862185834
425 2862290980
426 2870784361
427 2873152783
428 2875398302
429 2889303593
430 2889303594
431 2891969327
432 2895428422
433 2904536770
434 2912715403
435 2915770480
436 2918501726
437 2919473360
438 2919719190
439 2922555210
440 2928145438
441 2935393039
442 2939747378
443 2939747379
444 2946045972
445 3002999979
446 3006491107
447 8003317151
448 8047711077
449 8055068256
450 8055173982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01113

DapB_N

Dihydrodipicolinate reductase, N-terminus

33

108

0.91

PF19328

DAP_DH_C

2,4-diaminopentanoate dehydrogenase C-terminal domain

174

386

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iau-assembly1.cif.gz_B amine dehydrogenase from cystobacter fuscus in complex with nadp+ and cyclohexylamine 0.8222 2 340
6iaq-assembly2.cif.gz_B structure of amine dehydrogenase from mycobacterium smegmatis 0.8095 2 347
7qzl-assembly1.cif.gz_A amine dehydrogenase from cystobacter fuscus (cfusamdh) w145a mutant with nadp+ and pentylamine 0.809 2 340
6g1m-assembly2.cif.gz_D amine dehydrogenase from petrotoga mobilis; open and closed form 0.8073 1 349
6g1h-assembly1.cif.gz_A-2 amine dehydrogenase from petrotoga mobilis; open form 0.8036 2 349
ID Description Score Start End Superfamily
af_I6WZS8_1_105_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.908 1 101 3.40.50.720
af_O53407_4_153_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8936 1 157 3.40.50.720
af_I6WZS8_1_105_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.868 1 101 3.40.50.720
af_O53407_4_153_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8659 1 157 3.40.50.720
af_Q10SL7_36_116_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8526 3 67 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6B3I505-F1-model_v4 Dihydrodipicolinate reductase 1.001 1 61 GO:0008839
GO:0009089
AF-A0A6G3XA33-F1-model_v4 Dihydrodipicolinate reductase 0.9915 141 348
AF-K0F1T9-F1-model_v4 Dihydrodipicolinate reductase 0.9907 1 357 GO:0008839
GO:0009089
AF-A0A378WLU4-F1-model_v4 Uncharacterized conserved protein related to dihydrodipicolinate reductase 0.9902 1 352 GO:0008839
GO:0009089
AF-A0A511M706-F1-model_v4 Dihydrodipicolinate reductase 0.9896 1 357 GO:0008839
GO:0009089

Map