F339836

General Info

Members Datasets Scaffolds Average Seq Length
227 138 207 299

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10032683|Ga0099795_100326832
Length 313
Sequence MDRYCGKDANLKFKVSRILGLMCLFCGAASALARAPLVMLTDFGTQDGAVSAMKGVAYSVSQDLLISDLSHENPSIFVGAYRLYQAEQFWPPGTVFVTVVDPGVGTSRLSVVLKTRTGHYFVGPNNGLLSLVAERDGIAGLRQIDERINRRKGSDDSHTFHGRDVFAYTGARLAAGVISFEQVGPPLEDQALISIPYRKPERAGNTVKGIIPVLDVQFGNVWTNIPKALFDELKVGLGDPVRVRIFHNDQLVDDASAPYERTFGDVALGKPLVYVNSLLNLAVALNQGSYAAAHKIDSGPDWFIELSRGATSQ

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
3 2643221645 Massilia sp. Root351 Isolate Unclassified
4 2738541297 Duganella sp. GV083 Isolate Unclassified
5 2738541357 Duganella sp. GV053 Isolate Unclassified
6 2738543003 Duganella sp. GV066 Isolate Unclassified
7 2738543026 Duganella sp. GV089 Isolate Unclassified
8 2738543029 Duganella sp. GV039 Isolate Unclassified
9 2821131069 Duganella sp. 1224 Isolate Unclassified
10 2842711865 Duganella sp. R-73148 Isolate Unclassified
11 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
12 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
13 2857553236 Duganella sp. R-74557 Isolate Unclassified
14 2857558681 Duganella sp. R-74565 Isolate Unclassified
15 2857564685 Duganella sp. R-74599 Isolate Unclassified
16 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
17 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
18 2904424332 Duganella sp. 1411 Isolate Rhizosphere
19 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
20 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
38 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
45 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
46 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
62 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
66 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
69 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
70 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
71 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
74 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
80 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
81 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
85 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
86 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
87 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
93 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
94 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
95 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
96 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
99 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
100 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
101 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
102 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
106 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
107 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
108 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
109 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
110 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
111 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
112 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
121 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
122 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
123 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
130 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
132 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
136 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
137 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
138 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.75
Metatranscriptomes 0.44
Isolates 8.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.17
Nodule 1.76
Rhizoplane 4.41
Rhizosphere 70.48
Stem 0
Stem Tuber 0
Unclassified 17.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1002520 3300002738 Bacteria 4660
2 rootH2_10015002 3300003320 Bacteria 4743
3 rootL2_10010615 3300003322 Bacteria 13887
4 rootH1_10027434 3300003323 Bacteria 11868
5 rootH1_10247179 3300003323 Bacteria 2260
6 Ga0055526_1000025 3300003771 Bacteria 154279
7 Ga0055526_1000045 3300003771 Bacteria 121703
8 Ga0055524_1001075 3300003775 Bacteria 16780
9 Ga0065165_1029702 3300005262 Bacteria 1748
10 Ga0070682_100079827 3300005337 Bacteria 2114
11 Ga0070689_100747467 3300005340 Bacteria 857
12 Ga0070673_100002677 3300005364 Bacteria 10907
13 Ga0070714_100125416 3300005435 Bacteria 2289
14 Ga0070681_10192092 3300005458 Bacteria 1961
15 Ga0070681_10343513 3300005458 Bacteria 1402
16 Ga0068867_100298445 3300005459 Bacteria 1327
17 Ga0068867_100460949 3300005459 Unclassified 1085
18 Ga0070679_100032693 3300005530 Bacteria 5148
19 Ga0068855_100045312 3300005563 Bacteria 5201
20 Ga0068855_100205094 3300005563 Bacteria 2218
21 Ga0075434_100596022 3300006871 Bacteria 1124
22 Ga0079104_1005352 3300006946 Bacteria 5151
23 Ga0099826_10000001 3300006948 Bacteria 1155201
24 Ga0099794_10023317 3300007265 Bacteria 2829
25 Ga0099795_10032683 3300007788 Bacteria 1801
26 Ga0105244_10000609 3300009036 Bacteria 31805
27 Ga0105244_10000629 3300009036 Bacteria 31204
28 Ga0163163_10047228 3300014325 Bacteria 4232
29 Ga0182008_10000364 3300014497 Bacteria 35299
30 Ga0182006_1000155 3300015261 Bacteria 73019
31 Ga0182006_1000264 3300015261 Bacteria 47930
32 Ga0182007_10000275 3300015262 Bacteria 34048
33 Ga0182005_1000016 3300015265 Bacteria 346889
34 Ga0182005_1000084 3300015265 Bacteria 71765
35 Ga0163161_10022988 3300017792 Bacteria 4393
36 Ga0213872_10000695 3300021361 Bacteria 25249
37 Ga0213872_10001172 3300021361 Bacteria 17818
38 Ga0213872_10003865 3300021361 Bacteria 8137
39 Ga0213872_10008422 3300021361 Bacteria 4992
40 Ga0213872_10019610 3300021361 Unclassified 3114
41 Ga0213872_10024110 3300021361 Bacteria 2798
42 Ga0213872_10040153 3300021361 Bacteria 2136
43 Ga0213875_10070542 3300021388 Bacteria 1631
44 Ga0207425_1002403 3300025245 Bacteria 6603
45 Ga0209646_1000068 3300025246 Bacteria 233765
46 Ga0209025_1004751 3300025294 Bacteria 11549
47 Ga0209564_1000027 3300025295 Bacteria 518458
48 Ga0209564_1000047 3300025295 Bacteria 368031
49 Ga0209758_1000403 3300025297 Bacteria 74086
50 Ga0209256_1000005 3300025299 Bacteria 1315082
51 Ga0207655_1000758 3300025728 Bacteria 36172
52 Ga0207655_1004475 3300025728 Bacteria 9899
53 Ga0207705_10125858 3300025909 Bacteria 1905
54 Ga0207651_10104405 3300025960 Bacteria 2111
55 Ga0207676_10036892 3300026095 Unclassified 3721
56 Ga0207675_100409854 3300026118 Bacteria 1337
57 Ga0209281_1004266 3300027111 Bacteria 4336
58 Ga0209179_1006221 3300027512 Bacteria 1912
59 Ga0209282_1000001 3300027666 Bacteria 2450367
60 Ga0265338_10071035 3300028800 Bacteria 2981
61 Ga0316181_1056198 3300030744 Bacteria 1646
62 Ga0265762_1004259 3300030760 Unclassified 2565
63 Ga0265340_10162527 3300031247 Bacteria 1014
64 Ga0316576_10001160 3300031727 Bacteria 13806
65 Ga0307516_10000285 3300031730 Bacteria 65510
66 Ga0307516_10002886 3300031730 Bacteria 22584
67 Ga0373939_0011256 3300035114 Bacteria 2253
68 Ga0373931_0011670 3300035691 Bacteria 4245
69 Ga0436364_0037496 3300037853 Bacteria 12823
70 Ga0436364_0433374 3300037853 Bacteria 1205
71 Ga0436361_0057357 3300039447 Bacteria 12321
72 Ga0436361_0313546 3300039447 Bacteria 35556
73 Ga0436361_0405830 3300039447 Bacteria 2012
74 Ga0436361_0510235 3300039447 Bacteria 25534
75 Ga0436361_0522385 3300039447 Bacteria 3114
76 Ga0436361_0721194 3300039447 Bacteria 4180
77 Ga0436361_0744478 3300039447 Bacteria 2581
78 Ga0436361_1023996 3300039447 Bacteria 3484
79 Ga0436361_1057060 3300039447 Bacteria 33617
80 Ga0436361_1119900 3300039447 Bacteria 1991
81 Ga0436361_1177525 3300039447 Bacteria 1405
82 Ga0466982_0235945 3300044672 Bacteria 1077
83 Ga0466965_0007073 3300044683 Bacteria 5136
84 Ga0466961_0187686 3300044693 Bacteria 1282
85 Ga0466970_0011327 3300044765 Bacteria 4545
86 Ga0466960_0025675 3300044901 Bacteria 2668
87 Ga0495617_000032 3300046452 Bacteria 148986
88 Ga0495617_001246 3300046452 Bacteria 11430
89 Ga0495627_000011 3300046453 Bacteria 354522
90 Ga0495590_0000021 3300046457 Bacteria 210878
91 Ga0495638_0000359 3300046460 Bacteria 56640
92 Ga0495638_0009254 3300046460 Bacteria 6928
93 Ga0495638_0013484 3300046460 Bacteria 5563
94 Ga0495653_0000077 3300046463 Bacteria 82295
95 Ga0495650_0000100 3300046471 Bacteria 213752
96 Ga0495650_0000179 3300046471 Bacteria 138628
97 Ga0495650_0000426 3300046471 Bacteria 68340
98 Ga0495650_0000956 3300046471 Bacteria 33254
99 Ga0495650_0002122 3300046471 Bacteria 16937
100 Ga0495605_0000097 3300046474 Bacteria 109966
101 Ga0495639_0005233 3300046475 Bacteria 5576
102 Ga0495585_0001145 3300046492 Bacteria 21658
103 Ga0495607_0000659 3300046501 Bacteria 33567
104 Ga0495607_0016536 3300046501 Bacteria 4759
105 Ga0495583_0000795 3300046506 Bacteria 39056
106 Ga0495606_0000080 3300046507 Bacteria 161866
107 Ga0495606_0000090 3300046507 Bacteria 154737
108 Ga0495606_0000099 3300046507 Bacteria 150950
109 Ga0495606_0000517 3300046507 Bacteria 62468
110 Ga0495606_0001421 3300046507 Bacteria 32136
111 Ga0495606_0013586 3300046507 Bacteria 6422
112 Ga0495608_0186282 3300046511 Bacteria 1312
113 Ga0495610_0000017 3300046512 Bacteria 365675
114 Ga0495610_0000854 3300046512 Bacteria 28430
115 Ga0495610_0004663 3300046512 Bacteria 10028
116 Ga0495610_0017150 3300046512 Bacteria 4137
117 Ga0495610_0028904 3300046512 Bacteria 2926
118 Ga0495637_0000047 3300046520 Bacteria 106648
119 Ga0495637_0008976 3300046520 Bacteria 4891
120 Ga0495643_0000189 3300046522 Bacteria 98146
121 Ga0495643_0000218 3300046522 Bacteria 88082
122 Ga0495643_0024569 3300046522 Bacteria 3417
123 Ga0495643_0032781 3300046522 Bacteria 2881
124 Ga0495648_0000168 3300046524 Bacteria 75736
125 Ga0495648_0001779 3300046524 Bacteria 20723
126 Ga0495648_0028554 3300046524 Bacteria 3714
127 Ga0495642_0000473 3300046528 Bacteria 20819
128 Ga0495642_0059041 3300046528 Bacteria 1589
129 Ga0495652_0267804 3300046529 Bacteria 1257
130 Ga0495654_0000030 3300046530 Bacteria 216715
131 Ga0495654_0002855 3300046530 Bacteria 10847
132 Ga0495654_0003708 3300046530 Bacteria 9271
133 Ga0495609_0000112 3300046538 Bacteria 94699
134 Ga0495609_0014319 3300046538 Bacteria 3731
135 Ga0495609_0014333 3300046538 Bacteria 3730
136 Ga0495609_0057717 3300046538 Bacteria 1718
137 Ga0495597_0000017 3300046542 Bacteria 165491
138 Ga0495597_0000394 3300046542 Bacteria 37702
139 Ga0495622_0000288 3300046557 Bacteria 38225
140 Ga0495633_0000070 3300046558 Bacteria 133333
141 Ga0495633_0000441 3300046558 Bacteria 42881
142 Ga0495633_0000614 3300046558 Bacteria 33797
143 Ga0495633_0003371 3300046558 Bacteria 10703
144 Ga0495633_0011080 3300046558 Bacteria 4891
145 Ga0495633_0034901 3300046558 Bacteria 2417
146 Ga0495668_0000183 3300046616 Bacteria 93646
147 Ga0495668_0000560 3300046616 Bacteria 45755
148 Ga0495668_0000591 3300046616 Bacteria 44101
149 Ga0495668_0000690 3300046616 Bacteria 40541
150 Ga0495625_0000303 3300046660 Bacteria 75996
151 Ga0495625_0000965 3300046660 Bacteria 38283
152 Ga0495625_0020160 3300046660 Bacteria 5152
153 Ga0495625_0031823 3300046660 Bacteria 3919
154 Ga0495625_0053056 3300046660 Bacteria 2902
155 Ga0495671_0000026 3300046692 Bacteria 237110
156 Ga0495649_0001748 3300046694 Bacteria 16034
157 Ga0495649_0035736 3300046694 Bacteria 2732
158 Ga0495660_0000278 3300046810 Bacteria 47773
159 Ga0495660_0001460 3300046810 Bacteria 16161
160 Ga0495660_0133720 3300046810 Bacteria 1241
161 Ga0495672_0000022 3300047320 Bacteria 420632
162 Ga0495672_0000189 3300047320 Bacteria 89175
163 Ga0495683_0016652 3300047323 Bacteria 3814
164 Ga0495687_001348 3300047443 Bacteria 22854
165 Ga0495687_001926 3300047443 Bacteria 17797
166 Ga0495673_0000069 3300047469 Bacteria 218170
167 Ga0495673_0000080 3300047469 Bacteria 201831
168 Ga0495673_0000144 3300047469 Bacteria 127747
169 Ga0495681_0003549 3300047470 Bacteria 10856
170 Ga0495686_0162589 3300047472 Bacteria 1303
171 Ga0496102_0130220 3300048905 Bacteria 2354
172 Ga0496103_0001695 3300048906 Bacteria 14409
173 Ga0496111_0011079 3300048914 Bacteria 6069
174 Ga0496111_0319913 3300048914 Bacteria 1149
175 Ga0496112_0000635 3300048915 Bacteria 24368
176 Ga0496112_0001889 3300048915 Bacteria 16523
177 Ga0496112_0035718 3300048915 Bacteria 4844
178 Ga0496113_0486451 3300048916 Bacteria 991
179 Ga0496114_0174237 3300048917 Bacteria 1876
180 Ga0496116_0032149 3300048919 Bacteria 3744
181 Ga0496116_0050378 3300048919 Bacteria 2775
182 Ga0496116_0051173 3300048919 Bacteria 2746
183 Ga0496117_0000032 3300048920 Bacteria 375533
184 Ga0496118_0000027 3300048921 Bacteria 375533
185 Ga0496121_0005510 3300048924 Bacteria 16176
186 Ga0496121_0010013 3300048924 Bacteria 10777
187 Ga0496121_0021570 3300048924 Bacteria 6302
188 Ga0496122_0001272 3300048925 Bacteria 42099
189 Ga0496122_0034838 3300048925 Bacteria 4110
190 Ga0496123_0003399 3300048926 Bacteria 17913
191 Ga0496123_0007590 3300048926 Bacteria 10165
192 Ga0496124_0045120 3300048927 Bacteria 3779
193 Ga0496125_0025201 3300048928 Bacteria 5452
194 Ga0496126_0006300 3300048929 Bacteria 13252
195 Ga0495678_000010 3300049459 Bacteria 357896
196 Ga0495678_000314 3300049459 Bacteria 51759
197 Ga0495678_002161 3300049459 Bacteria 13870
198 Ga0501238_000454 3300049671 Bacteria 4760
199 Ga0501081_0319349 3300049743 Bacteria 1141
200 Ga0501269_000587 3300049766 Bacteria 6639
201 nmdc:mga08y16_111823_c1 3300050511 Bacteria 2843
202 nmdc:mga0a205_382765_c1 3300050515 Bacteria 1272
203 Ga0500594_0001450 3300053118 Bacteria 5149
204 Ga0500618_000095 3300053125 Bacteria 72432
205 Ga0500586_000050 3300053145 Bacteria 20673
206 Ga0500586_000770 3300053145 Bacteria 6570
207 Ga0466962_0048072 3300061719 Bacteria 2039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014325 Ga0163163_10047228 Ga0163163_100472283 253
2 3300026095 Ga0207676_10036892 Ga0207676_100368923 253
3 3300026118 Ga0207675_100409854 Ga0207675_1004098542 253
4 3300005340 Ga0070689_100747467 Ga0070689_1007474671 254
5 3300048914 Ga0496111_0319913 Ga0496111_0319913_123_941 257
6 3300031727 Ga0316576_10001160 Ga0316576_1000116011 260
7 3300044672 Ga0466982_0235945 Ga0466982_0235945_10_798 261
8 3300003323 rootH1_10247179 rootH1_102471792 263
9 3300005337 Ga0070682_100079827 Ga0070682_1000798273 266
10 3300005458 Ga0070681_10192092 Ga0070681_101920922 266
11 3300005530 Ga0070679_100032693 Ga0070679_1000326933 266
12 3300005563 Ga0068855_100045312 Ga0068855_1000453124 266
13 3300005563 Ga0068855_100205094 Ga0068855_1002050942 266
14 3300025909 Ga0207705_10125858 Ga0207705_101258582 266
15 3300037853 Ga0436364_0433374 Ga0436364_0433374_28_828 266
16 3300048905 Ga0496102_0130220 Ga0496102_0130220_946_1746 266
17 3300048915 Ga0496112_0000635 Ga0496112_0000635_2991_3791 266
18 3300048915 Ga0496112_0001889 Ga0496112_0001889_13531_14331 266
19 3300048915 Ga0496112_0035718 Ga0496112_0035718_336_1136 266
20 3300048916 Ga0496113_0486451 Ga0496113_0486451_171_971 266
21 3300021388 Ga0213875_10070542 Ga0213875_100705422 267
22 3300037853 Ga0436364_0037496 Ga0436364_0037496_1000_1806 267
23 3300044693 Ga0466961_0187686 Ga0466961_0187686_404_1207 267
24 3300049743 Ga0501081_0319349 Ga0501081_0319349_309_1118 268
25 3300050511 nmdc:mga08y16_111823_c1 nmdc:mga08y16_111823_c1_318_1127 268
26 3300005459 Ga0068867_100460949 Ga0068867_1004609492 269
27 3300005435 Ga0070714_100125416 Ga0070714_1001254162 271
28 3300005458 Ga0070681_10343513 Ga0070681_103435131 271
29 3300006871 Ga0075434_100596022 Ga0075434_1005960221 271
30 3300050515 nmdc:mga0a205_382765_c1 nmdc:mga0a205_382765_c1_216_1034 271
31 3300046511 Ga0495608_0186282 Ga0495608_0186282_47_868 273
32 iso_pu_bacteria 2881644220 2881644758 275
33 3300007265 Ga0099794_10023317 Ga0099794_100233172 288
34 3300027512 Ga0209179_1006221 Ga0209179_10062212 288
35 3300053125 Ga0500618_000095 Ga0500618_000095_4737_5651 288
36 3300028800 Ga0265338_10071035 Ga0265338_100710353 294
37 3300031247 Ga0265340_10162527 Ga0265340_101625272 294
38 3300030760 Ga0265762_1004259 Ga0265762_10042593 295
39 3300031730 Ga0307516_10002886 Ga0307516_100028865 295
40 3300048927 Ga0496124_0045120 Ga0496124_0045120_519_1454 295
41 iso_pu_bacteria 2547132103 2547375394 295
42 iso_pu_bacteria 2843690924 2843694479 295
43 3300046522 Ga0495643_0024569 Ga0495643_0024569_1019_1918 296
44 iso_pu_bacteria 2738541297 2738826941 296
45 iso_pu_bacteria 2738541357 2739150738 296
46 iso_pu_bacteria 2738543003 2739192657 296
47 iso_pu_bacteria 2738543026 2739319134 296
48 iso_pu_bacteria 2738543029 2739337375 296
49 iso_pu_bacteria 2821131069 2821135726 296
50 iso_pu_bacteria 2857564685 2857568156 296
51 3300021361 Ga0213872_10003865 Ga0213872_100038651 297
52 3300021361 Ga0213872_10019610 Ga0213872_100196102 297
53 3300039447 Ga0436361_0057357 Ga0436361_0057357_2310_3221 297
54 3300039447 Ga0436361_0313546 Ga0436361_0313546_34576_35481 297
55 3300021361 Ga0213872_10001172 Ga0213872_100011726 298
56 3300021361 Ga0213872_10024110 Ga0213872_100241102 298
57 3300021361 Ga0213872_10040153 Ga0213872_100401532 298
58 3300039447 Ga0436361_0405830 Ga0436361_0405830_937_1851 298
59 3300039447 Ga0436361_0522385 Ga0436361_0522385_73_981 298
60 3300039447 Ga0436361_0721194 Ga0436361_0721194_2969_3877 298
61 3300039447 Ga0436361_0744478 Ga0436361_0744478_1032_1940 298
62 3300039447 Ga0436361_1177525 Ga0436361_1177525_381_1289 298
63 3300047469 Ga0495673_0000144 Ga0495673_0000144_44517_45413 298
64 iso_pu_bacteria 2857553236 2857557845 298
65 iso_pu_bacteria 2857558681 2857559727 298
66 iso_pu_bacteria 2904424332 2904428694 298
67 3300003771 Ga0055526_1000025 Ga0055526_1000025118 299
68 3300003775 Ga0055524_1001075 Ga0055524_100107517 299
69 3300005262 Ga0065165_1029702 Ga0065165_10297021 299
70 3300006948 Ga0099826_10000001 Ga0099826_100000011063 299
71 3300009036 Ga0105244_10000629 Ga0105244_100006296 299
72 3300021361 Ga0213872_10000695 Ga0213872_100006956 299
73 3300025245 Ga0207425_1002403 Ga0207425_10024033 299
74 3300025294 Ga0209025_1004751 Ga0209025_10047519 299
75 3300025295 Ga0209564_1000027 Ga0209564_1000027152 299
76 3300025297 Ga0209758_1000403 Ga0209758_100040324 299
77 3300025299 Ga0209256_1000005 Ga0209256_1000005556 299
78 3300025728 Ga0207655_1004475 Ga0207655_100447511 299
79 3300027666 Ga0209282_1000001 Ga0209282_10000012187 299
80 3300039447 Ga0436361_0510235 Ga0436361_0510235_16466_17368 299
81 3300039447 Ga0436361_1023996 Ga0436361_1023996_362_1270 299
82 3300046471 Ga0495650_0000100 Ga0495650_0000100_155345_156247 299
83 3300046501 Ga0495607_0016536 Ga0495607_0016536_3082_3993 299
84 3300046507 Ga0495606_0000080 Ga0495606_0000080_139346_140248 299
85 3300046512 Ga0495610_0017150 Ga0495610_0017150_1314_2216 299
86 3300046558 Ga0495633_0011080 Ga0495633_0011080_2561_3472 299
87 3300046558 Ga0495633_0034901 Ga0495633_0034901_1490_2401 299
88 3300046616 Ga0495668_0000183 Ga0495668_0000183_10482_11384 299
89 3300046616 Ga0495668_0000690 Ga0495668_0000690_29153_30055 299
90 3300047472 Ga0495686_0162589 Ga0495686_0162589_261_1172 299
91 iso_pu_bacteria 2842711865 2842712189 299
92 3300003320 rootH2_10015002 rootH2_100150023 300
93 3300003323 rootH1_10027434 rootH1_100274342 300
94 3300035114 Ga0373939_0011256 Ga0373939_0011256_481_1386 300
95 3300044683 Ga0466965_0007073 Ga0466965_0007073_1779_2690 300
96 3300044765 Ga0466970_0011327 Ga0466970_0011327_741_1655 300
97 3300046452 Ga0495617_000032 Ga0495617_000032_68739_69644 300
98 3300046460 Ga0495638_0009254 Ga0495638_0009254_2012_2917 300
99 3300046460 Ga0495638_0013484 Ga0495638_0013484_811_1713 300
100 3300046463 Ga0495653_0000077 Ga0495653_0000077_25461_26366 300
101 3300046471 Ga0495650_0000426 Ga0495650_0000426_42102_43007 300
102 3300046471 Ga0495650_0002122 Ga0495650_0002122_4063_4965 300
103 3300046474 Ga0495605_0000097 Ga0495605_0000097_46714_47619 300
104 3300046492 Ga0495585_0001145 Ga0495585_0001145_3961_4866 300
105 3300046507 Ga0495606_0000090 Ga0495606_0000090_44581_45498 300
106 3300046507 Ga0495606_0000099 Ga0495606_0000099_149061_149966 300
107 3300046512 Ga0495610_0000017 Ga0495610_0000017_154367_155272 300
108 3300046520 Ga0495637_0000047 Ga0495637_0000047_101326_102228 300
109 3300046522 Ga0495643_0032781 Ga0495643_0032781_1704_2606 300
110 3300046524 Ga0495648_0001779 Ga0495648_0001779_8011_8916 300
111 3300046530 Ga0495654_0000030 Ga0495654_0000030_148559_149461 300
112 3300046530 Ga0495654_0002855 Ga0495654_0002855_5063_5968 300
113 3300046616 Ga0495668_0000591 Ga0495668_0000591_23702_24607 300
114 3300046660 Ga0495625_0000303 Ga0495625_0000303_6866_7768 300
115 3300046660 Ga0495625_0053056 Ga0495625_0053056_886_1791 300
116 3300046692 Ga0495671_0000026 Ga0495671_0000026_94125_95030 300
117 3300046810 Ga0495660_0133720 Ga0495660_0133720_117_1025 300
118 3300047323 Ga0495683_0016652 Ga0495683_0016652_1998_2903 300
119 3300047469 Ga0495673_0000069 Ga0495673_0000069_68061_68966 300
120 3300047469 Ga0495673_0000080 Ga0495673_0000080_56588_57496 300
121 3300048919 Ga0496116_0050378 Ga0496116_0050378_1456_2361 300
122 3300048924 Ga0496121_0021570 Ga0496121_0021570_1740_2684 300
123 3300048925 Ga0496122_0034838 Ga0496122_0034838_384_1298 300
124 3300048926 Ga0496123_0007590 Ga0496123_0007590_7080_7994 300
125 3300048929 Ga0496126_0006300 Ga0496126_0006300_6908_7810 300
126 3300049671 Ga0501238_000454 Ga0501238_000454_1750_2670 300
127 3300053145 Ga0500586_000770 Ga0500586_000770_5170_6075 300
128 3300061719 Ga0466962_0048072 Ga0466962_0048072_333_1268 300
129 iso_pu_bacteria 2600255292 2601671643 300
130 iso_pu_bacteria 2643221645 2644254699 300
131 iso_pu_bacteria 2857547612 2857553011 300
132 iso_pu_bacteria 2885080285 2885085472 300
133 iso_pu_bacteria 2932410948 2932414037 300
134 iso_pu_bacteria 2932416698 2932418097 300
135 3300046452 Ga0495617_001246 Ga0495617_001246_6004_6915 301
136 3300046453 Ga0495627_000011 Ga0495627_000011_145303_146238 301
137 3300046507 Ga0495606_0001421 Ga0495606_0001421_13556_14500 301
138 3300046512 Ga0495610_0000854 Ga0495610_0000854_2429_3340 301
139 3300046512 Ga0495610_0004663 Ga0495610_0004663_5420_6331 301
140 3300046520 Ga0495637_0008976 Ga0495637_0008976_3643_4554 301
141 3300046522 Ga0495643_0000218 Ga0495643_0000218_20617_21528 301
142 3300046524 Ga0495648_0028554 Ga0495648_0028554_1072_1983 301
143 3300046538 Ga0495609_0000112 Ga0495609_0000112_69820_70749 301
144 3300046538 Ga0495609_0057717 Ga0495609_0057717_214_1125 301
145 3300046558 Ga0495633_0003371 Ga0495633_0003371_6542_7453 301
146 3300046694 Ga0495649_0001748 Ga0495649_0001748_12391_13302 301
147 3300046810 Ga0495660_0000278 Ga0495660_0000278_3201_4130 301
148 3300047320 Ga0495672_0000189 Ga0495672_0000189_68258_69169 301
149 3300048919 Ga0496116_0051173 Ga0496116_0051173_947_1876 301
150 3300049459 Ga0495678_000314 Ga0495678_000314_20570_21481 301
151 3300053145 Ga0500586_000050 Ga0500586_000050_19218_20129 301
152 3300006946 Ga0079104_1005352 Ga0079104_10053523 302
153 3300009036 Ga0105244_10000609 Ga0105244_1000060919 302
154 3300015261 Ga0182006_1000264 Ga0182006_100026412 302
155 3300015265 Ga0182005_1000016 Ga0182005_1000016120 302
156 3300025728 Ga0207655_1000758 Ga0207655_10007582 302
157 3300027111 Ga0209281_1004266 Ga0209281_10042663 302
158 3300030744 Ga0316181_1056198 Ga0316181_10561982 302
159 3300046660 Ga0495625_0020160 Ga0495625_0020160_4044_4976 302
160 3300046810 Ga0495660_0001460 Ga0495660_0001460_3320_4261 302
161 3300047470 Ga0495681_0003549 Ga0495681_0003549_4331_5272 302
162 3300048906 Ga0496103_0001695 Ga0496103_0001695_11889_12824 302
163 3300048917 Ga0496114_0174237 Ga0496114_0174237_787_1722 302
164 3300049459 Ga0495678_000010 Ga0495678_000010_150284_151222 302
165 3300049766 Ga0501269_000587 Ga0501269_000587_4896_5816 302
166 3300005364 Ga0070673_100002677 Ga0070673_1000026775 303
167 3300007788 Ga0099795_10032683 Ga0099795_100326832 303
168 3300025960 Ga0207651_10104405 Ga0207651_101044052 303
169 3300031730 Ga0307516_10000285 Ga0307516_100002854 303
170 3300035691 Ga0373931_0011670 Ga0373931_0011670_2643_3581 303
171 3300044901 Ga0466960_0025675 Ga0466960_0025675_323_1252 303
172 3300046512 Ga0495610_0028904 Ga0495610_0028904_1224_2141 303
173 3300046529 Ga0495652_0267804 Ga0495652_0267804_183_1112 303
174 3300046542 Ga0495597_0000017 Ga0495597_0000017_56997_57914 303
175 3300046558 Ga0495633_0000070 Ga0495633_0000070_112062_112979 303
176 3300046660 Ga0495625_0031823 Ga0495625_0031823_1155_2072 303
177 3300005459 Ga0068867_100298445 Ga0068867_1002984452 304
178 3300014497 Ga0182008_10000364 Ga0182008_100003642 304
179 3300015261 Ga0182006_1000155 Ga0182006_100015548 304
180 3300015262 Ga0182007_10000275 Ga0182007_1000027520 304
181 3300015265 Ga0182005_1000084 Ga0182005_100008448 304
182 3300017792 Ga0163161_10022988 Ga0163161_100229881 304
183 3300046457 Ga0495590_0000021 Ga0495590_0000021_168999_169937 304
184 3300046460 Ga0495638_0000359 Ga0495638_0000359_34580_35518 304
185 3300046471 Ga0495650_0000179 Ga0495650_0000179_129845_130765 304
186 3300046471 Ga0495650_0000956 Ga0495650_0000956_21096_22034 304
187 3300046475 Ga0495639_0005233 Ga0495639_0005233_2359_3297 304
188 3300046501 Ga0495607_0000659 Ga0495607_0000659_22082_23020 304
189 3300046506 Ga0495583_0000795 Ga0495583_0000795_21139_22077 304
190 3300046507 Ga0495606_0000517 Ga0495606_0000517_53346_54284 304
191 3300046507 Ga0495606_0013586 Ga0495606_0013586_5370_6290 304
192 3300046522 Ga0495643_0000189 Ga0495643_0000189_80125_81063 304
193 3300046524 Ga0495648_0000168 Ga0495648_0000168_53658_54596 304
194 3300046528 Ga0495642_0000473 Ga0495642_0000473_4444_5382 304
195 3300046530 Ga0495654_0003708 Ga0495654_0003708_1612_2535 304
196 3300046538 Ga0495609_0014319 Ga0495609_0014319_871_1809 304
197 3300046538 Ga0495609_0014333 Ga0495609_0014333_871_1809 304
198 3300046542 Ga0495597_0000394 Ga0495597_0000394_21054_21992 304
199 3300046557 Ga0495622_0000288 Ga0495622_0000288_21164_22102 304
200 3300046558 Ga0495633_0000441 Ga0495633_0000441_21108_22046 304
201 3300046558 Ga0495633_0000614 Ga0495633_0000614_21529_22452 304
202 3300046616 Ga0495668_0000560 Ga0495668_0000560_23757_24695 304
203 3300046660 Ga0495625_0000965 Ga0495625_0000965_16209_17147 304
204 3300047443 Ga0495687_001348 Ga0495687_001348_5141_6076 304
205 3300047443 Ga0495687_001926 Ga0495687_001926_11722_12657 304
206 3300048914 Ga0496111_0011079 Ga0496111_0011079_703_1626 304
207 3300048919 Ga0496116_0032149 Ga0496116_0032149_1697_2620 304
208 3300048920 Ga0496117_0000032 Ga0496117_0000032_54494_55417 304
209 3300048921 Ga0496118_0000027 Ga0496118_0000027_320117_321040 304
210 3300048924 Ga0496121_0005510 Ga0496121_0005510_4804_5727 304
211 3300048924 Ga0496121_0010013 Ga0496121_0010013_4607_5530 304
212 3300048925 Ga0496122_0001272 Ga0496122_0001272_31155_32078 304
213 3300048926 Ga0496123_0003399 Ga0496123_0003399_9985_10908 304
214 3300048928 Ga0496125_0025201 Ga0496125_0025201_2193_3116 304
215 3300049459 Ga0495678_002161 Ga0495678_002161_8924_9862 304
216 3300002738 JGI25154J39366_1002520 JGI25154J39366_10025202 305
217 3300003322 rootL2_10010615 rootL2_100106157 305
218 3300003771 Ga0055526_1000045 Ga0055526_100004512 305
219 3300021361 Ga0213872_10008422 Ga0213872_100084223 305
220 3300025246 Ga0209646_1000068 Ga0209646_1000068208 305
221 3300025295 Ga0209564_1000047 Ga0209564_1000047210 305
222 3300039447 Ga0436361_1057060 Ga0436361_1057060_25572_26495 305
223 3300039447 Ga0436361_1119900 Ga0436361_1119900_965_1888 305
224 3300046528 Ga0495642_0059041 Ga0495642_0059041_76_1020 305
225 3300046694 Ga0495649_0035736 Ga0495649_0035736_185_1120 305
226 3300047320 Ga0495672_0000022 Ga0495672_0000022_305_1234 305
227 3300053118 Ga0500594_0001450 Ga0500594_0001450_1073_2008 305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01887

SAM_HAT_N

SAM hydroxide adenosyltransferase N-terminal domain

37

184

0.96

PF20257

SAM_HAT_C

SAM hydroxide adenosyltransferase C-terminal domain

209

303

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zbv-assembly1.cif.gz_C crystal structure of uncharacterized conserved protein from thermotoga maritima 0.9571 29 300
2zbu-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from thermotoga maritima 0.9551 29 302
2zbv-assembly1.cif.gz_B crystal structure of uncharacterized conserved protein from thermotoga maritima 0.9525 29 302
7ccg-assembly1.cif.gz_A crystal structure of cla1, a kind of a chlorinase from soil bacteria 0.9491 28 303
6ryz-assembly1.cif.gz_A sall with s-adenosyl methionine 0.9485 27 301
ID Description Score Start End Superfamily
af_Q2FUT0_167_281_2.40.30.90 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Bacterial fluorinating enzyme like 0.9848 192 305 2.40.30.90
af_Q2FUT0_2_166_3.40.50.10790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9765 27 190 3.40.50.10790
af_Q2FUT0_167_281_2.40.30.90 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Bacterial fluorinating enzyme like 0.9681 192 305 2.40.30.90
af_Q2FUT0_2_166_3.40.50.10790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9649 27 190 3.40.50.10790
2zbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9647 30 189 3.40.50.10790
ID Description Score Start End GO Terms
AF-A0A7W8KTF6-F1-model_v4 deleted 0.9926 202 304
AF-A0A1H8AT79-F1-model_v4 S-adenosyl-l-methionine hydroxide adenosyltransferase 0.9883 21 304
AF-A0A1G8A807-F1-model_v4 S-adenosyl-l-methionine hydroxide adenosyltransferase 0.9878 21 305
AF-A0A439B5C2-F1-model_v4 deleted 0.9878 211 305
AF-B9TD79-F1-model_v4 S-adenosyl-l-methionine hydroxide adenosyltransferase N-terminal domain-containing protein 0.9875 24 223

Feature Viewer

pLDDT pTM Quality
92.09 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map