F339780

General Info

Members Datasets Scaffolds Average Seq Length
227 143 454 110

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100051754|Ga0070712_1000517541
Length 122
Sequence VARPQARDNGSVAYDEHLAERVRELVAANPGLTEKRMFGGLAFLIGGHMSVSASGDGGLLVRVDPEQTKALLAEPHARPMVMRGREMDGWLRVDAGGVRDKRALEKWVRRGVAYARSLPPKA

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
29 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
30 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
57 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
58 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
59 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
60 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
61 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
62 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
65 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
66 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
77 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
78 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
79 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
80 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
81 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
82 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
83 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
84 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
87 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
88 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
89 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
90 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
95 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
98 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
99 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
100 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
101 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
102 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
103 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
104 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.69
Rhizosphere 81.94
Stem 0
Stem Tuber 0
Unclassified 2.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100051754 3300006175 Bacteria 2862
2 JGI24740J21852_10013962 3300001979 Bacteria 2977
3 JGI24735J21928_10006203 3300002067 Bacteria 3947
4 Ga0070658_10042275 3300005327 Bacteria 3680
5 Ga0070683_100183192 3300005329 Bacteria 1988
6 Ga0070680_100020709 3300005336 Bacteria 5219
7 Ga0070680_100153052 3300005336 Bacteria 1937
8 Ga0070682_100691010 3300005337 Bacteria 817
9 Ga0070682_100789653 3300005337 Bacteria 770
10 Ga0070682_101811708 3300005337 Bacteria 533
11 Ga0068868_101469976 3300005338 Bacteria 637
12 Ga0070660_100075622 3300005339 Bacteria 2637
13 Ga0070661_101273572 3300005344 Bacteria 616
14 Ga0070668_100100518 3300005347 Bacteria 2291
15 Ga0070714_100774906 3300005435 Bacteria 928
16 Ga0070714_102049112 3300005435 Unclassified 558
17 Ga0070713_100147016 3300005436 Bacteria 2093
18 Ga0070713_100158077 3300005436 Bacteria 2021
19 Ga0070681_10031639 3300005458 Bacteria 5311
20 Ga0070681_10197344 3300005458 Bacteria 1931
21 Ga0070706_100354051 3300005467 Bacteria 1368
22 Ga0070679_100018979 3300005530 Bacteria 6679
23 Ga0070679_100128100 3300005530 Bacteria 2520
24 Ga0070693_100819929 3300005547 Bacteria 691
25 Ga0070664_102020891 3300005564 Bacteria 547
26 Ga0070702_100125601 3300005615 Bacteria 1612
27 Ga0068861_100066854 3300005719 Bacteria 2772
28 Ga0068863_100012325 3300005841 Bacteria 8253
29 Ga0070717_10061317 3300006028 Bacteria 3116
30 Ga0070717_10370594 3300006028 Bacteria 1283
31 Ga0070712_101210366 3300006175 Bacteria 657
32 Ga0068871_101718967 3300006358 Bacteria 595
33 Ga0105247_11103262 3300009101 Bacteria 626
34 Ga0105243_11358444 3300009148 Bacteria 730
35 Ga0105249_11278886 3300009553 Bacteria 805
36 Ga0105239_11183957 3300010375 Bacteria 880
37 Ga0157379_10001061 3300014968 Bacteria 22404
38 Ga0213875_10039578 3300021388 Bacteria 2221
39 Ga0213875_10285300 3300021388 Bacteria 780
40 Ga0213875_10551529 3300021388 Bacteria 555
41 Ga0207692_10019481 3300025898 Bacteria 3068
42 Ga0207710_10061035 3300025900 Bacteria 1710
43 Ga0207647_10069956 3300025904 Bacteria 2121
44 Ga0207699_10038654 3300025906 Bacteria 2737
45 Ga0207699_11205075 3300025906 Bacteria 561
46 Ga0207705_10676399 3300025909 Bacteria 802
47 Ga0207707_10163860 3300025912 Bacteria 1943
48 Ga0207707_10471374 3300025912 Bacteria 1073
49 Ga0207693_10899061 3300025915 Bacteria 679
50 Ga0207663_10594088 3300025916 Bacteria 869
51 Ga0207660_10009088 3300025917 Bacteria 6437
52 Ga0207660_10093786 3300025917 Bacteria 2231
53 Ga0207660_10495205 3300025917 Bacteria 991
54 Ga0207657_10413056 3300025919 Bacteria 1061
55 Ga0207652_10005672 3300025921 Bacteria 10128
56 Ga0207652_10115834 3300025921 Bacteria 2381
57 Ga0207700_10058996 3300025928 Bacteria 2901
58 Ga0207700_10208624 3300025928 Bacteria 1650
59 Ga0207700_10490806 3300025928 Bacteria 1086
60 Ga0207664_10027561 3300025929 Bacteria 4308
61 Ga0207664_10613900 3300025929 Bacteria 977
62 Ga0207704_11516912 3300025938 Bacteria 575
63 Ga0207665_10833198 3300025939 Bacteria 730
64 Ga0207661_10417329 3300025944 Bacteria 1219
65 Ga0207661_10418088 3300025944 Bacteria 1217
66 Ga0207679_11177201 3300025945 Bacteria 703
67 Ga0207668_10079486 3300025972 Bacteria 2372
68 Ga0207641_10007064 3300026088 Bacteria 9376
69 Ga0207675_100109558 3300026118 Bacteria 2605
70 Ga0207683_11528821 3300026121 Bacteria 616
71 Ga0207428_10090071 3300027907 Bacteria 2383
72 Ga0268264_11298586 3300028381 Bacteria 738
73 Ga0265327_10486589 3300031251 Unclassified 532
74 Ga0373935_1394021 3300035692 Bacteria 524
75 Ga0395898_1074967 3300037466 Bacteria 739
76 Ga0436364_0205187 3300037853 Bacteria 4016
77 Ga0436364_0412916 3300037853 Bacteria 10150
78 Ga0436364_0998126 3300037853 Bacteria 830
79 Ga0436365_1548685 3300039437 Bacteria 5469
80 Ga0436362_0592257 3300039453 Bacteria 821
81 Ga0451837_0284401 3300041494 Bacteria 572
82 Ga0466965_0105327 3300044683 Bacteria 1446
83 Ga0466966_0006458 3300044684 Bacteria 7756
84 Ga0466966_0122660 3300044684 Bacteria 1595
85 Ga0466961_0045839 3300044693 Bacteria 2797
86 Ga0466961_0053651 3300044693 Bacteria 2572
87 Ga0466961_0134544 3300044693 Bacteria 1549
88 Ga0466961_0323797 3300044693 Bacteria 940
89 Ga0466961_0492859 3300044693 Bacteria 740
90 Ga0466961_0584494 3300044693 Bacteria 672
91 Ga0466963_0094214 3300044694 Bacteria 2042
92 Ga0466963_0200954 3300044694 Bacteria 1394
93 Ga0466963_0423120 3300044694 Bacteria 939
94 Ga0466963_0531020 3300044694 Bacteria 831
95 Ga0466963_0702789 3300044694 Bacteria 713
96 Ga0466964_0255929 3300044706 Bacteria 865
97 Ga0466971_0162340 3300044719 Bacteria 1046
98 Ga0466968_0018599 3300044735 Bacteria 2789
99 Ga0466968_0055653 3300044735 Bacteria 1698
100 Ga0466970_0505354 3300044765 Bacteria 696
101 Ga0466957_0086164 3300044842 Bacteria 1963
102 Ga0466957_0496890 3300044842 Bacteria 845
103 Ga0466957_1008522 3300044842 Bacteria 598
104 Ga0466957_1169293 3300044842 Bacteria 556
105 Ga0466960_0546919 3300044901 Bacteria 683
106 Ga0466959_0062718 3300045049 Bacteria 2701
107 Ga0466959_0116173 3300045049 Bacteria 1905
108 Ga0466959_0840768 3300045049 Bacteria 613
109 Ga0466959_0962196 3300045049 Bacteria 569
110 Ga0466958_0030522 3300045836 Bacteria 3202
111 Ga0466958_0198400 3300045836 Bacteria 1277
112 Ga0466958_0324383 3300045836 Bacteria 990
113 Ga0466958_0930884 3300045836 Bacteria 567
114 Ga0466967_0000261 3300045976 Bacteria 23133
115 Ga0466967_0007957 3300045976 Bacteria 7713
116 Ga0466967_0018400 3300045976 Bacteria 5581
117 Ga0466967_0036791 3300045976 Bacteria 4182
118 Ga0466967_0302861 3300045976 Bacteria 1538
119 Ga0466967_0386666 3300045976 Bacteria 1359
120 Ga0466967_0447194 3300045976 Bacteria 1262
121 Ga0466967_0611153 3300045976 Bacteria 1076
122 Ga0466967_1808450 3300045976 Bacteria 608
123 Ga0495592_0582613 3300046454 Bacteria 684
124 Ga0495641_0412042 3300046461 Bacteria 613
125 Ga0495628_0992693 3300046516 Bacteria 578
126 Ga0495652_0287227 3300046529 Bacteria 1202
127 Ga0495667_0662924 3300046559 Bacteria 648
128 Ga0495599_0318840 3300046678 Bacteria 936
129 Ga0495600_0695574 3300046809 Bacteria 612
130 Ga0495600_0761324 3300046809 Bacteria 579
131 Ga0495674_0373323 3300047319 Bacteria 1155
132 Ga0495593_0579318 3300047673 Bacteria 563
133 Ga0495602_0692845 3300048088 Bacteria 692
134 Ga0496100_0012336 3300048903 Bacteria 4896
135 Ga0496100_0012984 3300048903 Bacteria 4793
136 Ga0496101_0034218 3300048904 Bacteria 3587
137 Ga0496101_0037225 3300048904 Bacteria 3450
138 Ga0496102_0000080 3300048905 Bacteria 140541
139 Ga0496102_0240929 3300048905 Bacteria 1705
140 Ga0496103_0000118 3300048906 Bacteria 86519
141 Ga0496104_0368310 3300048907 Bacteria 1349
142 Ga0496105_0003744 3300048908 Bacteria 11327
143 Ga0496105_0072967 3300048908 Bacteria 2836
144 Ga0496106_0326944 3300048909 Bacteria 1231
145 Ga0496107_0104051 3300048910 Bacteria 2083
146 Ga0496107_0273280 3300048910 Bacteria 1258
147 Ga0496108_0171714 3300048911 Bacteria 1876
148 Ga0496109_0205240 3300048912 Bacteria 1853
149 Ga0496110_0084032 3300048913 Bacteria 2841
150 Ga0496110_1604496 3300048913 Bacteria 561
151 Ga0496111_1023340 3300048914 Bacteria 591
152 Ga0496113_0175487 3300048916 Bacteria 1698
153 Ga0496114_0138732 3300048917 Bacteria 2104
154 Ga0496115_0053811 3300048918 Bacteria 3231
155 Ga0496115_0575371 3300048918 Bacteria 898
156 Ga0496116_0000493 3300048919 Bacteria 54285
157 Ga0496117_0000287 3300048920 Bacteria 91621
158 Ga0496118_0000266 3300048921 Bacteria 91632
159 Ga0496119_0000558 3300048922 Bacteria 50488
160 Ga0496120_0024443 3300048923 Bacteria 3767
161 Ga0496121_0024712 3300048924 Bacteria 5733
162 Ga0496123_0200585 3300048926 Bacteria 1023
163 Ga0496124_0029960 3300048927 Bacteria 4839
164 Ga0496125_0102152 3300048928 Bacteria 2107
165 Ga0496126_0000383 3300048929 Bacteria 91602
166 Ga0496126_0013017 3300048929 Bacteria 8489
167 Ga0501031_0038948 3300049568 Bacteria 3101
168 Ga0501031_0238935 3300049568 Bacteria 1181
169 Ga0501032_0050678 3300049569 Bacteria 2799
170 Ga0501033_0008086 3300049570 Bacteria 8150
171 Ga0501034_0221640 3300049571 Bacteria 1843
172 Ga0501034_0407254 3300049571 Bacteria 1282
173 Ga0501036_0084147 3300049572 Bacteria 2689
174 Ga0501036_0374955 3300049572 Unclassified 1188
175 Ga0501037_0011207 3300049573 Bacteria 6599
176 Ga0501037_0122392 3300049573 Bacteria 1870
177 Ga0501038_0041340 3300049574 Bacteria 4020
178 Ga0501039_0101769 3300049575 Bacteria 2242
179 Ga0501041_0037725 3300049577 Bacteria 2929
180 Ga0501042_0082955 3300049578 Bacteria 2298
181 Ga0501043_0146202 3300049579 Bacteria 1851
182 Ga0501046_0034071 3300049580 Bacteria 4111
183 Ga0501046_0382266 3300049580 Unclassified 1019
184 Ga0501047_0115156 3300049581 Bacteria 2570
185 Ga0501048_0025873 3300049582 Bacteria 4275
186 Ga0501048_0122237 3300049582 Bacteria 1839
187 Ga0501048_1250262 3300049582 Bacteria 534
188 Ga0501067_0055453 3300049583 Bacteria 2196
189 Ga0501067_0204678 3300049583 Bacteria 1099
190 Ga0501068_0172777 3300049584 Bacteria 1364
191 Ga0501069_0035656 3300049585 Bacteria 2741
192 Ga0501069_0246263 3300049585 Bacteria 1042
193 Ga0501069_0259971 3300049585 Bacteria 1013
194 Ga0501070_0068208 3300049586 Bacteria 2944
195 Ga0501070_0257897 3300049586 Bacteria 1425
196 Ga0501071_0011821 3300049587 Bacteria 5892
197 Ga0501071_0216470 3300049587 Bacteria 1441
198 Ga0501072_0040995 3300049588 Bacteria 3636
199 Ga0501073_0025890 3300049589 Bacteria 4203
200 Ga0501074_0322189 3300049590 Unclassified 1097
201 Ga0501074_0519396 3300049590 Bacteria 843
202 Ga0501076_0010533 3300049592 Bacteria 6862
203 Ga0501076_0123302 3300049592 Bacteria 2099
204 Ga0501077_0029026 3300049593 Bacteria 3516
205 Ga0501077_0773331 3300049593 Bacteria 617
206 Ga0501079_0010284 3300049741 Bacteria 7107
207 Ga0501079_0636122 3300049741 Bacteria 840
208 Ga0501079_0751841 3300049741 Bacteria 767
209 Ga0501080_0014867 3300049742 Bacteria 7167
210 Ga0501080_0046850 3300049742 Bacteria 4024
211 Ga0501080_0640339 3300049742 Bacteria 941
212 Ga0501081_0104476 3300049743 Bacteria 2006
213 Ga0501083_0049748 3300049744 Bacteria 2824
214 Ga0501083_0072801 3300049744 Bacteria 2284
215 Ga0501035_0041933 3300049822 Bacteria 4130
216 Ga0501044_0017472 3300049823 Bacteria 7699
217 Ga0501044_0130481 3300049823 Bacteria 2507
218 Ga0501045_0110088 3300049824 Bacteria 2042
219 Ga0501045_0612103 3300049824 Bacteria 806
220 Ga0495601_0221395 3300053077 Bacteria 1236
221 Ga0495595_0026830 3300053084 Bacteria 2562
222 Ga0501084_0034010 3300054114 Bacteria 4262
223 Ga0501084_0594674 3300054114 Bacteria 935
224 Ga0501082_0091295 3300060353 Bacteria 2629
225 Ga0501082_0640922 3300060353 Bacteria 930
226 Ga0466962_0431329 3300061719 Bacteria 662
227 Ga0466962_0511226 3300061719 Bacteria 608
228 Ga0070712_100051754
229 JGI24740J21852_10013962
230 JGI24735J21928_10006203
231 Ga0070658_10042275
232 Ga0070683_100183192
233 Ga0070680_100020709
234 Ga0070680_100153052
235 Ga0070682_100691010
236 Ga0070682_100789653
237 Ga0070682_101811708
238 Ga0068868_101469976
239 Ga0070660_100075622
240 Ga0070661_101273572
241 Ga0070668_100100518
242 Ga0070714_100774906
243 Ga0070714_102049112
244 Ga0070713_100147016
245 Ga0070713_100158077
246 Ga0070681_10031639
247 Ga0070681_10197344
248 Ga0070706_100354051
249 Ga0070679_100018979
250 Ga0070679_100128100
251 Ga0070693_100819929
252 Ga0070664_102020891
253 Ga0070702_100125601
254 Ga0068861_100066854
255 Ga0068863_100012325
256 Ga0070717_10061317
257 Ga0070717_10370594
258 Ga0070712_101210366
259 Ga0068871_101718967
260 Ga0105247_11103262
261 Ga0105243_11358444
262 Ga0105249_11278886
263 Ga0105239_11183957
264 Ga0157379_10001061
265 Ga0213875_10039578
266 Ga0213875_10285300
267 Ga0213875_10551529
268 Ga0207692_10019481
269 Ga0207710_10061035
270 Ga0207647_10069956
271 Ga0207699_10038654
272 Ga0207699_11205075
273 Ga0207705_10676399
274 Ga0207707_10163860
275 Ga0207707_10471374
276 Ga0207693_10899061
277 Ga0207663_10594088
278 Ga0207660_10009088
279 Ga0207660_10093786
280 Ga0207660_10495205
281 Ga0207657_10413056
282 Ga0207652_10005672
283 Ga0207652_10115834
284 Ga0207700_10058996
285 Ga0207700_10208624
286 Ga0207700_10490806
287 Ga0207664_10027561
288 Ga0207664_10613900
289 Ga0207704_11516912
290 Ga0207665_10833198
291 Ga0207661_10417329
292 Ga0207661_10418088
293 Ga0207679_11177201
294 Ga0207668_10079486
295 Ga0207641_10007064
296 Ga0207675_100109558
297 Ga0207683_11528821
298 Ga0207428_10090071
299 Ga0268264_11298586
300 Ga0265327_10486589
301 Ga0373935_1394021
302 Ga0395898_1074967
303 Ga0436364_0205187
304 Ga0436364_0412916
305 Ga0436364_0998126
306 Ga0436365_1548685
307 Ga0436362_0592257
308 Ga0451837_0284401
309 Ga0466965_0105327
310 Ga0466966_0006458
311 Ga0466966_0122660
312 Ga0466961_0045839
313 Ga0466961_0053651
314 Ga0466961_0134544
315 Ga0466961_0323797
316 Ga0466961_0492859
317 Ga0466961_0584494
318 Ga0466963_0094214
319 Ga0466963_0200954
320 Ga0466963_0423120
321 Ga0466963_0531020
322 Ga0466963_0702789
323 Ga0466964_0255929
324 Ga0466971_0162340
325 Ga0466968_0018599
326 Ga0466968_0055653
327 Ga0466970_0505354
328 Ga0466957_0086164
329 Ga0466957_0496890
330 Ga0466957_1008522
331 Ga0466957_1169293
332 Ga0466960_0546919
333 Ga0466959_0062718
334 Ga0466959_0116173
335 Ga0466959_0840768
336 Ga0466959_0962196
337 Ga0466958_0030522
338 Ga0466958_0198400
339 Ga0466958_0324383
340 Ga0466958_0930884
341 Ga0466967_0000261
342 Ga0466967_0007957
343 Ga0466967_0018400
344 Ga0466967_0036791
345 Ga0466967_0302861
346 Ga0466967_0386666
347 Ga0466967_0447194
348 Ga0466967_0611153
349 Ga0466967_1808450
350 Ga0495592_0582613
351 Ga0495641_0412042
352 Ga0495628_0992693
353 Ga0495652_0287227
354 Ga0495667_0662924
355 Ga0495599_0318840
356 Ga0495600_0695574
357 Ga0495600_0761324
358 Ga0495674_0373323
359 Ga0495593_0579318
360 Ga0495602_0692845
361 Ga0496100_0012336
362 Ga0496100_0012984
363 Ga0496101_0034218
364 Ga0496101_0037225
365 Ga0496102_0000080
366 Ga0496102_0240929
367 Ga0496103_0000118
368 Ga0496104_0368310
369 Ga0496105_0003744
370 Ga0496105_0072967
371 Ga0496106_0326944
372 Ga0496107_0104051
373 Ga0496107_0273280
374 Ga0496108_0171714
375 Ga0496109_0205240
376 Ga0496110_0084032
377 Ga0496110_1604496
378 Ga0496111_1023340
379 Ga0496113_0175487
380 Ga0496114_0138732
381 Ga0496115_0053811
382 Ga0496115_0575371
383 Ga0496116_0000493
384 Ga0496117_0000287
385 Ga0496118_0000266
386 Ga0496119_0000558
387 Ga0496120_0024443
388 Ga0496121_0024712
389 Ga0496123_0200585
390 Ga0496124_0029960
391 Ga0496125_0102152
392 Ga0496126_0000383
393 Ga0496126_0013017
394 Ga0501031_0038948
395 Ga0501031_0238935
396 Ga0501032_0050678
397 Ga0501033_0008086
398 Ga0501034_0221640
399 Ga0501034_0407254
400 Ga0501036_0084147
401 Ga0501036_0374955
402 Ga0501037_0011207
403 Ga0501037_0122392
404 Ga0501038_0041340
405 Ga0501039_0101769
406 Ga0501041_0037725
407 Ga0501042_0082955
408 Ga0501043_0146202
409 Ga0501046_0034071
410 Ga0501046_0382266
411 Ga0501047_0115156
412 Ga0501048_0025873
413 Ga0501048_0122237
414 Ga0501048_1250262
415 Ga0501067_0055453
416 Ga0501067_0204678
417 Ga0501068_0172777
418 Ga0501069_0035656
419 Ga0501069_0246263
420 Ga0501069_0259971
421 Ga0501070_0068208
422 Ga0501070_0257897
423 Ga0501071_0011821
424 Ga0501071_0216470
425 Ga0501072_0040995
426 Ga0501073_0025890
427 Ga0501074_0322189
428 Ga0501074_0519396
429 Ga0501076_0010533
430 Ga0501076_0123302
431 Ga0501077_0029026
432 Ga0501077_0773331
433 Ga0501079_0010284
434 Ga0501079_0636122
435 Ga0501079_0751841
436 Ga0501080_0014867
437 Ga0501080_0046850
438 Ga0501080_0640339
439 Ga0501081_0104476
440 Ga0501083_0049748
441 Ga0501083_0072801
442 Ga0501035_0041933
443 Ga0501044_0017472
444 Ga0501044_0130481
445 Ga0501045_0110088
446 Ga0501045_0612103
447 Ga0495601_0221395
448 Ga0495595_0026830
449 Ga0501084_0034010
450 Ga0501084_0594674
451 Ga0501082_0091295
452 Ga0501082_0640922
453 Ga0466962_0431329
454 Ga0466962_0511226

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04993

TfoX_N

TfoX N-terminal domain

24

115

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gr0-assembly3.cif.gz_C periplasmic domain of the t3ss inner membrane protein prgh from s.typhimurium (fragment 170-362) 0.8474 4 33
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.7353 8 102
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.6985 9 103
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6788 7 109
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.6489 8 102
ID Description Score Start End Superfamily
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7353 8 102 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7305 9 109 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7169 5 107 3.90.1150.30
3h9xA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6832 7 103 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6794 9 109 3.90.1150.30
ID Description Score Start End GO Terms
AF-I4EQR7-F1-model_v4 TfoX N-terminal domain-containing protein 0.9826 3 108
AF-A0A1H4M8R0-F1-model_v4 Transcriptional regulator of competence genes, TfoX/Sxy family 0.9822 1 109
AF-A0A7V9DNC1-F1-model_v4 TfoX/Sxy family protein 0.9821 1 109
AF-A0A4R8J6C8-F1-model_v4 deleted 0.9799 5 109
AF-A0A7I7WJ16-F1-model_v4 TfoX N-terminal domain-containing protein 0.9792 3 109

Map