F339718

General Info

Members Datasets Scaffolds Average Seq Length
227 179 454 171

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100297704|Ga0070665_1002977042
Length 193
Sequence LVTPAQETGVQGAPPSRRRLASYLYGPPTRFGLIAAALACAIDQASKLWLLFVFDLANKGLVRLTPFLDLVLTWNIGISYGLFPQESDFGRYVLLALKFAAVVVLWVWLARAETRLTAISLGLIIGGALGNAIDRLAYGAVADFVLFHITTATFNFTWYVFNLADAAIVAGVAGLLYESFFGYTPQKRPDPPG

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
116 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
117 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
122 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
166 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
167 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
168 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
169 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
170 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
171 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
172 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
173 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
176 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
177 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
178 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
179 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.24
Metatranscriptomes 0
Isolates 1.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.37
Nodule 0
Rhizoplane 0.44
Rhizosphere 87.67
Stem 0
Stem Tuber 0
Unclassified 5.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100297704 3300005548 Bacteria 1616
2 JGI25406J46586_10000058 3300003203 Bacteria 50229
3 Ga0065707_10365316 3300005295 Bacteria 898
4 Ga0070658_10114664 3300005327 Bacteria 2235
5 Ga0070690_100074365 3300005330 Bacteria 2213
6 Ga0070690_100863336 3300005330 Bacteria 706
7 Ga0068868_100218089 3300005338 Bacteria 1596
8 Ga0068868_100867177 3300005338 Bacteria 818
9 Ga0068868_101809932 3300005338 Bacteria 577
10 Ga0070660_100662796 3300005339 Bacteria 874
11 Ga0070689_100027728 3300005340 Bacteria 4272
12 Ga0070675_100176743 3300005354 Bacteria 1844
13 Ga0070674_100200976 3300005356 Bacteria 1539
14 Ga0070688_100179061 3300005365 Bacteria 1469
15 Ga0070688_100721764 3300005365 Bacteria 773
16 Ga0070714_100071745 3300005435 Bacteria 2995
17 Ga0070714_101157634 3300005435 Bacteria 754
18 Ga0070710_10279259 3300005437 Bacteria 1083
19 Ga0070711_100069251 3300005439 Bacteria 2482
20 Ga0070705_100025057 3300005440 Bacteria 3229
21 Ga0070685_10134819 3300005466 Bacteria 1548
22 Ga0070686_100420181 3300005544 Bacteria 1021
23 Ga0070686_100452082 3300005544 Bacteria 988
24 Ga0070695_100110644 3300005545 Bacteria 1863
25 Ga0070665_100479442 3300005548 Bacteria 1255
26 Ga0070704_100069020 3300005549 Bacteria 2559
27 Ga0068864_100033619 3300005618 Bacteria 4360
28 Ga0068866_10537688 3300005718 Bacteria 779
29 Ga0068861_100425848 3300005719 Bacteria 1184
30 Ga0068870_10126577 3300005840 Bacteria 1479
31 Ga0068858_100157604 3300005842 Bacteria 2136
32 Ga0068860_100647551 3300005843 Bacteria 1064
33 Ga0068860_100693199 3300005843 Bacteria 1028
34 Ga0068862_100689881 3300005844 Bacteria 988
35 Ga0081455_10253020 3300005937 Bacteria 1287
36 Ga0081540_1037777 3300005983 Bacteria 2554
37 Ga0081539_10000825 3300005985 Bacteria 59902
38 Ga0075368_10039699 3300006042 Bacteria 1846
39 Ga0075368_10106430 3300006042 Bacteria 1154
40 Ga0075364_10229382 3300006051 Unclassified 1261
41 Ga0075366_10394127 3300006195 Bacteria 852
42 Ga0097621_100117981 3300006237 Bacteria 2249
43 Ga0068871_100128594 3300006358 Bacteria 2146
44 Ga0075428_100000390 3300006844 Bacteria 43360
45 Ga0075428_100817443 3300006844 Bacteria 990
46 Ga0075430_100002682 3300006846 Bacteria 14859
47 Ga0075431_100000003 3300006847 Bacteria 112884
48 Ga0075431_101539178 3300006847 Bacteria 623
49 Ga0075433_10058454 3300006852 Bacteria 3373
50 Ga0075434_100003749 3300006871 Bacteria 13577
51 Ga0075429_100000288 3300006880 Bacteria 35542
52 Ga0099795_10002394 3300007788 Bacteria 4404
53 Ga0105240_10675652 3300009093 Bacteria 1130
54 Ga0111539_10000753 3300009094 Bacteria 42119
55 Ga0111539_10159163 3300009094 Bacteria 2641
56 Ga0111539_10214061 3300009094 Bacteria 2245
57 Ga0105245_10010184 3300009098 Bacteria 8186
58 Ga0105245_10022728 3300009098 Bacteria 5504
59 Ga0105245_10405232 3300009098 Bacteria 1364
60 Ga0105247_10348995 3300009101 Bacteria 1040
61 Ga0105247_10405187 3300009101 Bacteria 973
62 Ga0114129_10000104 3300009147 Bacteria 83195
63 Ga0105243_10093929 3300009148 Bacteria 2476
64 Ga0105241_10247061 3300009174 Bacteria 1511
65 Ga0105242_10138891 3300009176 Bacteria 2106
66 Ga0105242_10442942 3300009176 Bacteria 1223
67 Ga0105248_11815492 3300009177 Bacteria 691
68 Ga0105237_10239557 3300009545 Bacteria 1815
69 Ga0105249_10007334 3300009553 Bacteria 9613
70 Ga0105249_11180706 3300009553 Bacteria 836
71 Ga0105249_11512324 3300009553 Bacteria 744
72 Ga0105246_10099764 3300011119 Bacteria 2111
73 Ga0157378_10086623 3300013297 Bacteria 2840
74 Ga0157378_10187457 3300013297 Bacteria 1949
75 Ga0157378_10195423 3300013297 Bacteria 1911
76 Ga0157378_10215397 3300013297 Bacteria 1823
77 Ga0157378_10861336 3300013297 Bacteria 935
78 Ga0157375_10543382 3300013308 Bacteria 1324
79 Ga0157380_10279355 3300014326 Bacteria 1527
80 Ga0157380_10312595 3300014326 Bacteria 1453
81 Ga0157380_10431089 3300014326 Bacteria 1260
82 Ga0157379_10521921 3300014968 Bacteria 1103
83 Ga0157379_11053463 3300014968 Bacteria 777
84 Ga0213876_10137408 3300021384 Bacteria 1300
85 Ga0213875_10100629 3300021388 Bacteria 1349
86 Ga0207682_10002286 3300025893 Bacteria 8633
87 Ga0207643_10085546 3300025908 Bacteria 1831
88 Ga0207643_10115537 3300025908 Bacteria 1585
89 Ga0207705_10096072 3300025909 Bacteria 2175
90 Ga0207684_10208969 3300025910 Bacteria 1684
91 Ga0207654_10411529 3300025911 Bacteria 942
92 Ga0207695_10608999 3300025913 Bacteria 973
93 Ga0207671_10175300 3300025914 Bacteria 1666
94 Ga0207662_10087100 3300025918 Bacteria 1915
95 Ga0207681_10276608 3300025923 Bacteria 1320
96 Ga0207694_10324114 3300025924 Bacteria 1272
97 Ga0207650_10091976 3300025925 Bacteria 2319
98 Ga0207659_10278860 3300025926 Bacteria 1366
99 Ga0207687_10071195 3300025927 Bacteria 2484
100 Ga0207687_10268952 3300025927 Bacteria 1362
101 Ga0207664_10359023 3300025929 Bacteria 1290
102 Ga0207664_11012030 3300025929 Bacteria 745
103 Ga0207644_10260793 3300025931 Bacteria 1386
104 Ga0207706_10364499 3300025933 Bacteria 1255
105 Ga0207686_10092713 3300025934 Bacteria 1998
106 Ga0207686_10328620 3300025934 Bacteria 1145
107 Ga0207709_10156392 3300025935 Bacteria 1585
108 Ga0207691_10005525 3300025940 Bacteria 12214
109 Ga0207689_10285014 3300025942 Bacteria 1368
110 Ga0207661_10225474 3300025944 Bacteria 1658
111 Ga0207651_10427604 3300025960 Bacteria 1132
112 Ga0207712_10021120 3300025961 Bacteria 4271
113 Ga0207658_11012813 3300025986 Bacteria 758
114 Ga0207677_10028393 3300026023 Bacteria 3537
115 Ga0207677_10066112 3300026023 Bacteria 2526
116 Ga0207641_10531544 3300026088 Bacteria 1145
117 Ga0207648_10017358 3300026089 Bacteria 6553
118 Ga0207676_10229545 3300026095 Bacteria 1658
119 Ga0209179_1000213 3300027512 Bacteria 5433
120 Ga0209813_10026355 3300027866 Bacteria 1680
121 Ga0209813_10106322 3300027866 Unclassified 961
122 Ga0207428_10000831 3300027907 Bacteria 34817
123 Ga0268266_10855129 3300028379 Bacteria 879
124 Ga0268265_10423968 3300028380 Bacteria 1236
125 Ga0268264_10754953 3300028381 Bacteria 969
126 Ga0265318_10017885 3300028577 Bacteria 2902
127 Ga0265330_10055760 3300031235 Bacteria 1725
128 Ga0265332_10143450 3300031238 Bacteria 1000
129 Ga0265320_10216788 3300031240 Bacteria 853
130 Ga0265325_10032643 3300031241 Bacteria 2778
131 Ga0265329_10012215 3300031242 Bacteria 3094
132 Ga0265340_10030790 3300031247 Bacteria 2687
133 Ga0265339_10026192 3300031249 Bacteria 3341
134 Ga0265331_10029029 3300031250 Bacteria 2763
135 Ga0265316_10280944 3300031344 Bacteria 1216
136 Ga0265313_10063667 3300031595 Bacteria 1718
137 Ga0265314_10010305 3300031711 Bacteria 7807
138 Ga0265342_10452909 3300031712 Bacteria 658
139 Ga0307409_100603408 3300031995 Bacteria 1085
140 Ga0373943_0029089 3300035170 Bacteria 2609
141 Ga0373935_0731182 3300035692 Bacteria 729
142 Ga0373935_0768338 3300035692 Bacteria 711
143 Ga0373947_0059059 3300035725 Bacteria 2325
144 Ga0373925_0034061 3300037068 Bacteria 3754
145 Ga0373925_0962640 3300037068 Bacteria 703
146 Ga0436364_0482104 3300037853 Bacteria 3064
147 Ga0436365_0233026 3300039437 Bacteria 4859
148 Ga0436362_1165899 3300039453 Unclassified 870
149 Ga0439443_002279 3300042003 Bacteria 2274
150 Ga0439435_0050009 3300042436 Bacteria 1194
151 Ga0439460_0020343 3300042461 Bacteria 1804
152 Ga0451576_1357225 3300045051 Bacteria 740
153 Ga0495638_0034163 3300046460 Bacteria 3247
154 Ga0495580_0488395 3300046472 Bacteria 823
155 Ga0495605_0019686 3300046474 Bacteria 3600
156 Ga0495584_0040596 3300046491 Bacteria 2350
157 Ga0495584_0474190 3300046491 Bacteria 637
158 Ga0495630_0307045 3300046517 Unclassified 1212
159 Ga0495663_0090912 3300046525 Bacteria 995
160 Ga0495668_0090606 3300046616 Bacteria 1676
161 Ga0495668_0419985 3300046616 Unclassified 735
162 Ga0495634_0201496 3300046642 Bacteria 1236
163 Ga0495659_0171592 3300046664 Bacteria 880
164 Ga0495658_0040141 3300046683 Bacteria 2601
165 Ga0495669_0232396 3300046684 Unclassified 885
166 Ga0495613_0610639 3300046689 Bacteria 725
167 Ga0495636_0061117 3300047318 Bacteria 1593
168 Ga0495674_1021351 3300047319 Bacteria 633
169 Ga0495615_0025658 3300048090 Bacteria 1370
170 Ga0496112_1198975 3300048915 Bacteria 676
171 Ga0496126_0582662 3300048929 Bacteria 884
172 Ga0496126_0865338 3300048929 Bacteria 688
173 Ga0501032_0104374 3300049569 Bacteria 1878
174 Ga0501033_0107685 3300049570 Bacteria 2030
175 Ga0501034_0088424 3300049571 Bacteria 3096
176 Ga0501034_0151462 3300049571 Bacteria 2295
177 Ga0501037_0425999 3300049573 Bacteria 908
178 Ga0501038_0327555 3300049574 Bacteria 1197
179 Ga0501043_0084657 3300049579 Bacteria 2492
180 Ga0501047_0200293 3300049581 Bacteria 1858
181 Ga0501047_0367117 3300049581 Bacteria 1275
182 Ga0501067_0029548 3300049583 Bacteria 3038
183 Ga0501067_0183371 3300049583 Bacteria 1166
184 Ga0501070_0207789 3300049586 Unclassified 1607
185 Ga0501073_0033084 3300049589 Bacteria 3684
186 Ga0501073_0556034 3300049589 Bacteria 793
187 Ga0501073_1014488 3300049589 Unclassified 571
188 Ga0501074_0044791 3300049590 Bacteria 3202
189 Ga0501076_0364848 3300049592 Bacteria 1187
190 Ga0501077_0497921 3300049593 Bacteria 781
191 Ga0501079_0081787 3300049741 Bacteria 2498
192 Ga0501079_0209440 3300049741 Bacteria 1523
193 Ga0501083_0495044 3300049744 Bacteria 796
194 Ga0501035_0309364 3300049822 Bacteria 1329
195 Ga0501044_0155057 3300049823 Bacteria 2270
196 Ga0501044_0191829 3300049823 Bacteria 2006
197 nmdc:mga00v17_651103_c1 3300050491 Unclassified 677
198 nmdc:mga06z11_251723_c1 3300050494 Bacteria 1040
199 nmdc:mga04h51_122155_c1 3300050495 Unclassified 971
200 nmdc:mga04h51_23075_c1 3300050495 Bacteria 1890
201 nmdc:mga05p37_215_c1 3300050507 Bacteria 57982
202 nmdc:mga09592_1263_c1 3300050508 Bacteria 20295
203 nmdc:mga0qj67_131755_c1 3300050509 Bacteria 2025
204 nmdc:mga0qj67_6755_c1 3300050509 Bacteria 8433
205 nmdc:mga06r32_1551_c1 3300050510 Bacteria 20713
206 nmdc:mga08y16_176_c1 3300050511 Bacteria 56313
207 nmdc:mga08y16_232463_c1 3300050511 Bacteria 1907
208 nmdc:mga0n895_23391_c1 3300050512 Bacteria 5808
209 nmdc:mga0rr50_124097_c1 3300050513 Bacteria 2059
210 nmdc:mga0a205_57171_c1 3300050515 Bacteria 3767
211 Ga0495601_0043828 3300053077 Bacteria 2810
212 Ga0500646_0027237 3300053090 Bacteria 1554
213 Ga0500583_0202722 3300053092 Bacteria 986
214 Ga0500641_0033273 3300053096 Bacteria 2045
215 Ga0500562_024535 3300053108 Unclassified 1577
216 Ga0500594_0071213 3300053118 Bacteria 1023
217 Ga0500658_0044619 3300053134 Bacteria 1790
218 Ga0500577_0208030 3300053142 Unclassified 845
219 Ga0500588_0211839 3300053146 Bacteria 720
220 Ga0500604_0031417 3300053151 Bacteria 1558
221 Ga0501082_0674567 3300060353 Bacteria 905
222 Ga0501082_0755342 3300060353 Bacteria 851
223 Ga0530510_1316004 3300061734 Bacteria 554
224 2883578377 2883577096 Bacteria 4709178
225 2894775801 2894772417 Bacteria 5305674
226 2929206277 2929199973 Bacteria 7260745
227 8055913172 8055909800 Bacteria 7278581
228 Ga0070665_100297704
229 JGI25406J46586_10000058
230 Ga0065707_10365316
231 Ga0070658_10114664
232 Ga0070690_100074365
233 Ga0070690_100863336
234 Ga0068868_100218089
235 Ga0068868_100867177
236 Ga0068868_101809932
237 Ga0070660_100662796
238 Ga0070689_100027728
239 Ga0070675_100176743
240 Ga0070674_100200976
241 Ga0070688_100179061
242 Ga0070688_100721764
243 Ga0070714_100071745
244 Ga0070714_101157634
245 Ga0070710_10279259
246 Ga0070711_100069251
247 Ga0070705_100025057
248 Ga0070685_10134819
249 Ga0070686_100420181
250 Ga0070686_100452082
251 Ga0070695_100110644
252 Ga0070665_100479442
253 Ga0070704_100069020
254 Ga0068864_100033619
255 Ga0068866_10537688
256 Ga0068861_100425848
257 Ga0068870_10126577
258 Ga0068858_100157604
259 Ga0068860_100647551
260 Ga0068860_100693199
261 Ga0068862_100689881
262 Ga0081455_10253020
263 Ga0081540_1037777
264 Ga0081539_10000825
265 Ga0075368_10039699
266 Ga0075368_10106430
267 Ga0075364_10229382
268 Ga0075366_10394127
269 Ga0097621_100117981
270 Ga0068871_100128594
271 Ga0075428_100000390
272 Ga0075428_100817443
273 Ga0075430_100002682
274 Ga0075431_100000003
275 Ga0075431_101539178
276 Ga0075433_10058454
277 Ga0075434_100003749
278 Ga0075429_100000288
279 Ga0099795_10002394
280 Ga0105240_10675652
281 Ga0111539_10000753
282 Ga0111539_10159163
283 Ga0111539_10214061
284 Ga0105245_10010184
285 Ga0105245_10022728
286 Ga0105245_10405232
287 Ga0105247_10348995
288 Ga0105247_10405187
289 Ga0114129_10000104
290 Ga0105243_10093929
291 Ga0105241_10247061
292 Ga0105242_10138891
293 Ga0105242_10442942
294 Ga0105248_11815492
295 Ga0105237_10239557
296 Ga0105249_10007334
297 Ga0105249_11180706
298 Ga0105249_11512324
299 Ga0105246_10099764
300 Ga0157378_10086623
301 Ga0157378_10187457
302 Ga0157378_10195423
303 Ga0157378_10215397
304 Ga0157378_10861336
305 Ga0157375_10543382
306 Ga0157380_10279355
307 Ga0157380_10312595
308 Ga0157380_10431089
309 Ga0157379_10521921
310 Ga0157379_11053463
311 Ga0213876_10137408
312 Ga0213875_10100629
313 Ga0207682_10002286
314 Ga0207643_10085546
315 Ga0207643_10115537
316 Ga0207705_10096072
317 Ga0207684_10208969
318 Ga0207654_10411529
319 Ga0207695_10608999
320 Ga0207671_10175300
321 Ga0207662_10087100
322 Ga0207681_10276608
323 Ga0207694_10324114
324 Ga0207650_10091976
325 Ga0207659_10278860
326 Ga0207687_10071195
327 Ga0207687_10268952
328 Ga0207664_10359023
329 Ga0207664_11012030
330 Ga0207644_10260793
331 Ga0207706_10364499
332 Ga0207686_10092713
333 Ga0207686_10328620
334 Ga0207709_10156392
335 Ga0207691_10005525
336 Ga0207689_10285014
337 Ga0207661_10225474
338 Ga0207651_10427604
339 Ga0207712_10021120
340 Ga0207658_11012813
341 Ga0207677_10028393
342 Ga0207677_10066112
343 Ga0207641_10531544
344 Ga0207648_10017358
345 Ga0207676_10229545
346 Ga0209179_1000213
347 Ga0209813_10026355
348 Ga0209813_10106322
349 Ga0207428_10000831
350 Ga0268266_10855129
351 Ga0268265_10423968
352 Ga0268264_10754953
353 Ga0265318_10017885
354 Ga0265330_10055760
355 Ga0265332_10143450
356 Ga0265320_10216788
357 Ga0265325_10032643
358 Ga0265329_10012215
359 Ga0265340_10030790
360 Ga0265339_10026192
361 Ga0265331_10029029
362 Ga0265316_10280944
363 Ga0265313_10063667
364 Ga0265314_10010305
365 Ga0265342_10452909
366 Ga0307409_100603408
367 Ga0373943_0029089
368 Ga0373935_0731182
369 Ga0373935_0768338
370 Ga0373947_0059059
371 Ga0373925_0034061
372 Ga0373925_0962640
373 Ga0436364_0482104
374 Ga0436365_0233026
375 Ga0436362_1165899
376 Ga0439443_002279
377 Ga0439435_0050009
378 Ga0439460_0020343
379 Ga0451576_1357225
380 Ga0495638_0034163
381 Ga0495580_0488395
382 Ga0495605_0019686
383 Ga0495584_0040596
384 Ga0495584_0474190
385 Ga0495630_0307045
386 Ga0495663_0090912
387 Ga0495668_0090606
388 Ga0495668_0419985
389 Ga0495634_0201496
390 Ga0495659_0171592
391 Ga0495658_0040141
392 Ga0495669_0232396
393 Ga0495613_0610639
394 Ga0495636_0061117
395 Ga0495674_1021351
396 Ga0495615_0025658
397 Ga0496112_1198975
398 Ga0496126_0582662
399 Ga0496126_0865338
400 Ga0501032_0104374
401 Ga0501033_0107685
402 Ga0501034_0088424
403 Ga0501034_0151462
404 Ga0501037_0425999
405 Ga0501038_0327555
406 Ga0501043_0084657
407 Ga0501047_0200293
408 Ga0501047_0367117
409 Ga0501067_0029548
410 Ga0501067_0183371
411 Ga0501070_0207789
412 Ga0501073_0033084
413 Ga0501073_0556034
414 Ga0501073_1014488
415 Ga0501074_0044791
416 Ga0501076_0364848
417 Ga0501077_0497921
418 Ga0501079_0081787
419 Ga0501079_0209440
420 Ga0501083_0495044
421 Ga0501035_0309364
422 Ga0501044_0155057
423 Ga0501044_0191829
424 nmdc:mga00v17_651103_c1
425 nmdc:mga06z11_251723_c1
426 nmdc:mga04h51_122155_c1
427 nmdc:mga04h51_23075_c1
428 nmdc:mga05p37_215_c1
429 nmdc:mga09592_1263_c1
430 nmdc:mga0qj67_131755_c1
431 nmdc:mga0qj67_6755_c1
432 nmdc:mga06r32_1551_c1
433 nmdc:mga08y16_176_c1
434 nmdc:mga08y16_232463_c1
435 nmdc:mga0n895_23391_c1
436 nmdc:mga0rr50_124097_c1
437 nmdc:mga0a205_57171_c1
438 Ga0495601_0043828
439 Ga0500646_0027237
440 Ga0500583_0202722
441 Ga0500641_0033273
442 Ga0500562_024535
443 Ga0500594_0071213
444 Ga0500658_0044619
445 Ga0500577_0208030
446 Ga0500588_0211839
447 Ga0500604_0031417
448 Ga0501082_0674567
449 Ga0501082_0755342
450 Ga0530510_1316004
451 2883578377
452 2894775801
453 2929206277
454 8055913172

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01252

Peptidase_A8

Signal peptidase (SPase) II

35

181

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dir-assembly4.cif.gz_D membrane protein at 2.8 angstroms 0.8724 7 155
5dir-assembly2.cif.gz_B membrane protein at 2.8 angstroms 0.8644 7 152
6ryo-assembly1.cif.gz_A bacterial membrane enzyme structure by the in meso method at 1.9 a resolution 0.8527 6 158
5dir-assembly4.cif.gz_D membrane protein at 2.8 angstroms 0.8505 7 155
6fms-assembly2.cif.gz_B imisx-ep of se-lspa 0.8394 7 150
ID Description Score Start End Superfamily
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.9086 10 155 3.90.1420.10
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8965 10 155 3.90.1420.10
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8911 10 154 3.90.1420.10
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8733 10 154 3.90.1420.10
af_P9WK99_39_178_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8312 10 155 3.90.1420.10
ID Description Score Start End GO Terms
AF-A0A7Y2BRD3-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9736 2 154 GO:0004190
GO:0005886
GO:0006508
AF-A0A257SDR7-F1-model_v4 deleted 0.9734 2 154
AF-A0A558R4Y0-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9683 2 154 GO:0004190
GO:0005886
GO:0006508
AF-A0A2E5MWH0-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9675 2 155 GO:0004190
GO:0005886
GO:0006508
AF-A0A3C0TSX4-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9667 2 158 GO:0004190
GO:0005886
GO:0006508

Map