F339629

General Info

Members Datasets Scaffolds Average Seq Length
227 167 454 226

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100008461|Ga0070667_1000084618
Length 257
Sequence MEAIDGDEGFDRQVGRIAALAEPIRRALYRYISTEPGPVGREQAASAVGVAPHVAKFHLDKLEADGLLDSEYSRPPGRSGPGAGRPAKRYRRSKREVSVSLPERRYDLAGRVMARAIDAATDSGTPLADALHQAAVEHGYHLGDRVAARLGRRRGQAAFGQAICSVLADYGYEPRASEEGAVTLANCPFHALAQEHTELVCGINLDLFNGMLDRCEGSGMHARLDPSPERCCVTLSRDRPTGTRARQTTPRNEGHHE

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
74 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
75 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
76 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
77 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
111 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
167 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 2.2
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.41
Rhizosphere 95.15
Stem 0
Stem Tuber 0
Unclassified 5.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100008461 3300005367 Bacteria 8533
2 Ga0070658_10005382 3300005327 Bacteria 10386
3 Ga0070658_10031981 3300005327 Bacteria 4229
4 Ga0070658_10080358 3300005327 Bacteria 2678
5 Ga0070683_100019779 3300005329 Bacteria 5985
6 Ga0070683_100020080 3300005329 Bacteria 5941
7 Ga0070683_100126721 3300005329 Bacteria 2414
8 Ga0068868_100012500 3300005338 Bacteria 6207
9 Ga0070692_10021582 3300005345 Bacteria 3134
10 Ga0070668_100091061 3300005347 Bacteria 2404
11 Ga0070714_100478775 3300005435 Bacteria 1185
12 Ga0070700_100000007 3300005441 Bacteria 198866
13 Ga0070663_100053438 3300005455 Bacteria 2884
14 Ga0070662_100037089 3300005457 Bacteria 3454
15 Ga0070681_10022355 3300005458 Bacteria 6349
16 Ga0070681_10211180 3300005458 Bacteria 1857
17 Ga0070706_100001069 3300005467 Bacteria 29617
18 Ga0070706_100006234 3300005467 Bacteria 11280
19 Ga0070707_100000067 3300005468 Bacteria 93995
20 Ga0070707_100379611 3300005468 Bacteria 1373
21 Ga0070698_100001348 3300005471 Bacteria 27290
22 Ga0070699_100015143 3300005518 Bacteria 6624
23 Ga0070679_100351269 3300005530 Bacteria 1422
24 Ga0070684_100049425 3300005535 Bacteria 3650
25 Ga0070686_100326922 3300005544 Bacteria 1145
26 Ga0068855_100086012 3300005563 Bacteria 3637
27 Ga0068855_100283263 3300005563 Bacteria 1840
28 Ga0068857_100018055 3300005577 Bacteria 6188
29 Ga0068857_100712183 3300005577 Bacteria 954
30 Ga0068856_100010607 3300005614 Bacteria 8952
31 Ga0070702_100017906 3300005615 Bacteria 3664
32 Ga0068870_10094741 3300005840 Bacteria 1676
33 Ga0068862_100074221 3300005844 Bacteria 2940
34 Ga0070717_10513248 3300006028 Bacteria 1084
35 Ga0070712_100065066 3300006175 Bacteria 2587
36 Ga0075428_100000090 3300006844 Bacteria 74510
37 Ga0075430_100057728 3300006846 Bacteria 3264
38 Ga0075430_100352670 3300006846 Bacteria 1215
39 Ga0075431_100008210 3300006847 Bacteria 10435
40 Ga0075431_100009126 3300006847 Bacteria 9945
41 Ga0075431_100316760 3300006847 Bacteria 1574
42 Ga0075429_100007567 3300006880 Bacteria 9432
43 Ga0075429_100094197 3300006880 Bacteria 2612
44 Ga0068865_100078115 3300006881 Bacteria 2367
45 Ga0075436_100012879 3300006914 Bacteria 5734
46 Ga0075435_100011616 3300007076 Bacteria 6490
47 Ga0111539_10115420 3300009094 Bacteria 3149
48 Ga0111539_10992008 3300009094 Bacteria 976
49 Ga0114129_10003908 3300009147 Bacteria 21033
50 Ga0114129_10996727 3300009147 Unclassified 1055
51 Ga0105249_10145490 3300009553 Bacteria 2277
52 Ga0105239_10404002 3300010375 Bacteria 1546
53 Ga0105246_10025061 3300011119 Bacteria 3886
54 Ga0105246_10094329 3300011119 Bacteria 2164
55 Ga0157372_10604916 3300013307 Bacteria 1278
56 Ga0157375_10274363 3300013308 Bacteria 1848
57 Ga0157377_10001563 3300014745 Bacteria 9954
58 Ga0206354_10298151 3300020081 Bacteria 1184
59 Ga0206354_11002211 3300020081 Bacteria 1877
60 Ga0206353_10216902 3300020082 Bacteria 2698
61 Ga0206353_10621068 3300020082 Bacteria 2118
62 Ga0206353_11959871 3300020082 Bacteria 3885
63 Ga0207645_10060702 3300025907 Bacteria 2414
64 Ga0207705_10220948 3300025909 Bacteria 1439
65 Ga0207684_10000692 3300025910 Bacteria 39839
66 Ga0207684_10002619 3300025910 Bacteria 18004
67 Ga0207684_10301469 3300025910 Bacteria 1381
68 Ga0207707_10143512 3300025912 Bacteria 2087
69 Ga0207707_10165905 3300025912 Bacteria 1930
70 Ga0207657_10180719 3300025919 Bacteria 1705
71 Ga0207652_10164202 3300025921 Bacteria 1991
72 Ga0207652_10469889 3300025921 Bacteria 1133
73 Ga0207646_10000288 3300025922 Bacteria 69433
74 Ga0207646_10229659 3300025922 Bacteria 1676
75 Ga0207659_10009391 3300025926 Bacteria 6108
76 Ga0207664_10361614 3300025929 Bacteria 1286
77 Ga0207690_10333555 3300025932 Unclassified 1195
78 Ga0207706_10037724 3300025933 Bacteria 4289
79 Ga0207704_10058746 3300025938 Bacteria 2370
80 Ga0207661_10013395 3300025944 Bacteria 5990
81 Ga0207661_10159500 3300025944 Bacteria 1956
82 Ga0207661_10707538 3300025944 Unclassified 927
83 Ga0207667_10066608 3300025949 Bacteria 3754
84 Ga0207712_10223121 3300025961 Unclassified 1508
85 Ga0207658_10014300 3300025986 Bacteria 5435
86 Ga0207677_10163454 3300026023 Bacteria 1732
87 Ga0207708_10000006 3300026075 Bacteria 266916
88 Ga0207708_10037950 3300026075 Bacteria 3670
89 Ga0207702_10097018 3300026078 Bacteria 2594
90 Ga0207674_10010869 3300026116 Bacteria 10257
91 Ga0207674_10029263 3300026116 Bacteria 5801
92 Ga0207683_10063570 3300026121 Bacteria 3251
93 Ga0207698_10094195 3300026142 Bacteria 2462
94 Ga0265325_10006327 3300031241 Bacteria 7200
95 Ga0265313_10064746 3300031595 Unclassified 1699
96 Ga0265314_10139623 3300031711 Unclassified 1500
97 Ga0307410_10538135 3300031852 Bacteria 966
98 Ga0307409_100471660 3300031995 Bacteria 1216
99 Ga0307409_100697190 3300031995 Bacteria 1014
100 Ga0307416_101475926 3300032002 Bacteria 786
101 Ga0307415_100067822 3300032126 Bacteria 2495
102 Ga0373934_0108976 3300035086 Bacteria 1122
103 Ga0373944_0099557 3300035089 Bacteria 981
104 Ga0373953_0048588 3300035117 Bacteria 1709
105 Ga0373956_0060977 3300035119 Bacteria 1708
106 Ga0373957_0015518 3300035120 Bacteria 2623
107 Ga0373943_0089632 3300035170 Bacteria 1591
108 Ga0373955_0030520 3300035172 Bacteria 2814
109 Ga0373924_0008867 3300035410 Bacteria 3670
110 Ga0373935_0033785 3300035692 Bacteria 3185
111 Ga0373933_0119201 3300035724 Bacteria 1651
112 Ga0373947_0194336 3300035725 Bacteria 1325
113 Ga0373937_0255599 3300036401 Bacteria 1651
114 Ga0373937_0606775 3300036401 Unclassified 1039
115 Ga0395899_0095295 3300037312 Bacteria 2153
116 Ga0395900_0087677 3300037418 Bacteria 3198
117 Ga0395898_0082582 3300037466 Bacteria 3097
118 Ga0395901_0005559 3300038443 Bacteria 12754
119 Ga0395901_0007269 3300038443 Bacteria 11177
120 Ga0395901_0037691 3300038443 Bacteria 5000
121 Ga0466966_0143405 3300044684 Bacteria 1459
122 Ga0495590_0220653 3300046457 Unclassified 700
123 Ga0495629_0043780 3300046459 Bacteria 3143
124 Ga0495641_0040348 3300046461 Bacteria 2171
125 Ga0495641_0390699 3300046461 Unclassified 631
126 Ga0495651_0109407 3300046462 Bacteria 2045
127 Ga0495653_0104591 3300046463 Bacteria 2045
128 Ga0495662_0003772 3300046476 Bacteria 7641
129 Ga0495664_0022723 3300046477 Bacteria 3637
130 Ga0495608_0035079 3300046511 Bacteria 3384
131 Ga0495618_0002099 3300046514 Bacteria 13058
132 Ga0495628_0069255 3300046516 Bacteria 2751
133 Ga0495630_0036355 3300046517 Bacteria 3681
134 Ga0495652_0115039 3300046529 Bacteria 2156
135 Ga0495665_0011390 3300046531 Bacteria 4813
136 Ga0495640_0004176 3300046533 Bacteria 11550
137 Ga0495586_0025597 3300046535 Bacteria 3157
138 Ga0495587_0013150 3300046536 Bacteria 5203
139 Ga0495645_0052619 3300046543 Bacteria 2961
140 Ga0495634_0029314 3300046642 Bacteria 3810
141 Ga0495657_0055791 3300046675 Bacteria 2634
142 Ga0495599_0006231 3300046678 Bacteria 7190
143 Ga0495623_0013609 3300046679 Bacteria 5272
144 Ga0495646_0006868 3300046680 Bacteria 7223
145 Ga0495613_0050333 3300046689 Bacteria 3072
146 Ga0495581_0037987 3300047315 Bacteria 2786
147 Ga0495604_0006119 3300047317 Bacteria 9550
148 Ga0495674_0291087 3300047319 Bacteria 1335
149 Ga0495675_0045748 3300047444 Bacteria 2787
150 Ga0495684_0183604 3300047471 Bacteria 1549
151 Ga0495593_0078604 3300047673 Bacteria 1708
152 Ga0496102_0135206 3300048905 Bacteria 2310
153 Ga0496102_0165630 3300048905 Bacteria 2080
154 Ga0496104_0199699 3300048907 Bacteria 1912
155 Ga0496109_0291196 3300048912 Unclassified 1539
156 Ga0496109_0534449 3300048912 Bacteria 1106
157 Ga0496110_0008834 3300048913 Bacteria 8117
158 Ga0496111_0021412 3300048914 Bacteria 4514
159 Ga0496112_0206443 3300048915 Bacteria 1923
160 Ga0496114_0245030 3300048917 Bacteria 1577
161 Ga0496114_0365895 3300048917 Bacteria 1276
162 Ga0501032_0010186 3300049569 Bacteria 6785
163 Ga0501032_0036049 3300049569 Bacteria 3378
164 Ga0501033_0127927 3300049570 Bacteria 1841
165 Ga0501034_0000523 3300049571 Bacteria 61646
166 Ga0501034_0010864 3300049571 Bacteria 9458
167 Ga0501036_0067748 3300049572 Bacteria 3020
168 Ga0501036_0093013 3300049572 Bacteria 2548
169 Ga0501036_0190465 3300049572 Bacteria 1726
170 Ga0501038_0018191 3300049574 Bacteria 6344
171 Ga0501039_0069479 3300049575 Bacteria 2735
172 Ga0501039_0146070 3300049575 Bacteria 1858
173 Ga0501039_0309749 3300049575 Bacteria 1241
174 Ga0501041_0007866 3300049577 Bacteria 6262
175 Ga0501043_0036651 3300049579 Bacteria 3859
176 Ga0501043_0068032 3300049579 Bacteria 2796
177 Ga0501046_0081164 3300049580 Bacteria 2505
178 Ga0501047_0017496 3300049581 Bacteria 6865
179 Ga0501048_0038209 3300049582 Bacteria 3445
180 Ga0501048_0213351 3300049582 Bacteria 1369
181 Ga0501048_0380449 3300049582 Bacteria 1008
182 Ga0501067_0360624 3300049583 Bacteria 810
183 Ga0501068_0004339 3300049584 Bacteria 7711
184 Ga0501068_0006830 3300049584 Bacteria 6310
185 Ga0501069_0022819 3300049585 Bacteria 3408
186 Ga0501070_0041424 3300049586 Bacteria 3837
187 Ga0501070_0159446 3300049586 Bacteria 1860
188 Ga0501070_0193033 3300049586 Bacteria 1673
189 Ga0501071_0013581 3300049587 Bacteria 5553
190 Ga0501071_0245740 3300049587 Bacteria 1350
191 Ga0501072_0015757 3300049588 Bacteria 5794
192 Ga0501073_0137495 3300049589 Bacteria 1693
193 Ga0501074_0004616 3300049590 Bacteria 9864
194 Ga0501075_0002503 3300049591 Bacteria 12243
195 Ga0501075_0387259 3300049591 Bacteria 1066
196 Ga0501075_0541178 3300049591 Bacteria 889
197 Ga0501076_0017214 3300049592 Bacteria 5489
198 Ga0501076_0196038 3300049592 Bacteria 1649
199 Ga0501076_0274673 3300049592 Bacteria 1380
200 Ga0501077_0029925 3300049593 Bacteria 3463
201 Ga0501079_0035714 3300049741 Bacteria 3826
202 Ga0501079_0066348 3300049741 Bacteria 2785
203 Ga0501080_0030258 3300049742 Bacteria 5044
204 Ga0501081_0008194 3300049743 Bacteria 6782
205 Ga0501035_0006206 3300049822 Bacteria 11243
206 Ga0501044_0092619 3300049823 Bacteria 3048
207 Ga0501045_0012935 3300049824 Bacteria 5882
208 nmdc:mga05p37_10337_c1 3300050507 Bacteria 11081
209 nmdc:mga05p37_608297_c1 3300050507 Unclassified 1232
210 nmdc:mga09592_626475_c1 3300050508 Unclassified 920
211 nmdc:mga09592_7206_c1 3300050508 Bacteria 9040
212 nmdc:mga0qj67_140807_c1 3300050509 Bacteria 1956
213 nmdc:mga06r32_1181_c1 3300050510 Bacteria 23551
214 nmdc:mga06r32_9448_c1 3300050510 Bacteria 8801
215 nmdc:mga08y16_20574_c1 3300050511 Bacteria 6966
216 nmdc:mga0rr50_93617_c1 3300050513 Bacteria 2345
217 nmdc:mga08x19_119592_c1 3300050514 Bacteria 1765
218 Ga0495601_0059248 3300053077 Bacteria 2428
219 Ga0495601_0091132 3300053077 Bacteria 1962
220 Ga0495612_0002716 3300053078 Bacteria 7321
221 Ga0495619_0035222 3300053085 Bacteria 3256
222 Ga0495619_0321605 3300053085 Bacteria 1071
223 Ga0501084_0039603 3300054114 Bacteria 3941
224 Ga0501084_1072053 3300054114 Bacteria 677
225 Ga0501082_0013313 3300060353 Bacteria 7071
226 2644506406 2643221690 Bacteria 4654705
227 2995728673 2995726249 Bacteria 3470435
228 Ga0070667_100008461
229 Ga0070658_10005382
230 Ga0070658_10031981
231 Ga0070658_10080358
232 Ga0070683_100019779
233 Ga0070683_100020080
234 Ga0070683_100126721
235 Ga0068868_100012500
236 Ga0070692_10021582
237 Ga0070668_100091061
238 Ga0070714_100478775
239 Ga0070700_100000007
240 Ga0070663_100053438
241 Ga0070662_100037089
242 Ga0070681_10022355
243 Ga0070681_10211180
244 Ga0070706_100001069
245 Ga0070706_100006234
246 Ga0070707_100000067
247 Ga0070707_100379611
248 Ga0070698_100001348
249 Ga0070699_100015143
250 Ga0070679_100351269
251 Ga0070684_100049425
252 Ga0070686_100326922
253 Ga0068855_100086012
254 Ga0068855_100283263
255 Ga0068857_100018055
256 Ga0068857_100712183
257 Ga0068856_100010607
258 Ga0070702_100017906
259 Ga0068870_10094741
260 Ga0068862_100074221
261 Ga0070717_10513248
262 Ga0070712_100065066
263 Ga0075428_100000090
264 Ga0075430_100057728
265 Ga0075430_100352670
266 Ga0075431_100008210
267 Ga0075431_100009126
268 Ga0075431_100316760
269 Ga0075429_100007567
270 Ga0075429_100094197
271 Ga0068865_100078115
272 Ga0075436_100012879
273 Ga0075435_100011616
274 Ga0111539_10115420
275 Ga0111539_10992008
276 Ga0114129_10003908
277 Ga0114129_10996727
278 Ga0105249_10145490
279 Ga0105239_10404002
280 Ga0105246_10025061
281 Ga0105246_10094329
282 Ga0157372_10604916
283 Ga0157375_10274363
284 Ga0157377_10001563
285 Ga0206354_10298151
286 Ga0206354_11002211
287 Ga0206353_10216902
288 Ga0206353_10621068
289 Ga0206353_11959871
290 Ga0207645_10060702
291 Ga0207705_10220948
292 Ga0207684_10000692
293 Ga0207684_10002619
294 Ga0207684_10301469
295 Ga0207707_10143512
296 Ga0207707_10165905
297 Ga0207657_10180719
298 Ga0207652_10164202
299 Ga0207652_10469889
300 Ga0207646_10000288
301 Ga0207646_10229659
302 Ga0207659_10009391
303 Ga0207664_10361614
304 Ga0207690_10333555
305 Ga0207706_10037724
306 Ga0207704_10058746
307 Ga0207661_10013395
308 Ga0207661_10159500
309 Ga0207661_10707538
310 Ga0207667_10066608
311 Ga0207712_10223121
312 Ga0207658_10014300
313 Ga0207677_10163454
314 Ga0207708_10000006
315 Ga0207708_10037950
316 Ga0207702_10097018
317 Ga0207674_10010869
318 Ga0207674_10029263
319 Ga0207683_10063570
320 Ga0207698_10094195
321 Ga0265325_10006327
322 Ga0265313_10064746
323 Ga0265314_10139623
324 Ga0307410_10538135
325 Ga0307409_100471660
326 Ga0307409_100697190
327 Ga0307416_101475926
328 Ga0307415_100067822
329 Ga0373934_0108976
330 Ga0373944_0099557
331 Ga0373953_0048588
332 Ga0373956_0060977
333 Ga0373957_0015518
334 Ga0373943_0089632
335 Ga0373955_0030520
336 Ga0373924_0008867
337 Ga0373935_0033785
338 Ga0373933_0119201
339 Ga0373947_0194336
340 Ga0373937_0255599
341 Ga0373937_0606775
342 Ga0395899_0095295
343 Ga0395900_0087677
344 Ga0395898_0082582
345 Ga0395901_0005559
346 Ga0395901_0007269
347 Ga0395901_0037691
348 Ga0466966_0143405
349 Ga0495590_0220653
350 Ga0495629_0043780
351 Ga0495641_0040348
352 Ga0495641_0390699
353 Ga0495651_0109407
354 Ga0495653_0104591
355 Ga0495662_0003772
356 Ga0495664_0022723
357 Ga0495608_0035079
358 Ga0495618_0002099
359 Ga0495628_0069255
360 Ga0495630_0036355
361 Ga0495652_0115039
362 Ga0495665_0011390
363 Ga0495640_0004176
364 Ga0495586_0025597
365 Ga0495587_0013150
366 Ga0495645_0052619
367 Ga0495634_0029314
368 Ga0495657_0055791
369 Ga0495599_0006231
370 Ga0495623_0013609
371 Ga0495646_0006868
372 Ga0495613_0050333
373 Ga0495581_0037987
374 Ga0495604_0006119
375 Ga0495674_0291087
376 Ga0495675_0045748
377 Ga0495684_0183604
378 Ga0495593_0078604
379 Ga0496102_0135206
380 Ga0496102_0165630
381 Ga0496104_0199699
382 Ga0496109_0291196
383 Ga0496109_0534449
384 Ga0496110_0008834
385 Ga0496111_0021412
386 Ga0496112_0206443
387 Ga0496114_0245030
388 Ga0496114_0365895
389 Ga0501032_0010186
390 Ga0501032_0036049
391 Ga0501033_0127927
392 Ga0501034_0000523
393 Ga0501034_0010864
394 Ga0501036_0067748
395 Ga0501036_0093013
396 Ga0501036_0190465
397 Ga0501038_0018191
398 Ga0501039_0069479
399 Ga0501039_0146070
400 Ga0501039_0309749
401 Ga0501041_0007866
402 Ga0501043_0036651
403 Ga0501043_0068032
404 Ga0501046_0081164
405 Ga0501047_0017496
406 Ga0501048_0038209
407 Ga0501048_0213351
408 Ga0501048_0380449
409 Ga0501067_0360624
410 Ga0501068_0004339
411 Ga0501068_0006830
412 Ga0501069_0022819
413 Ga0501070_0041424
414 Ga0501070_0159446
415 Ga0501070_0193033
416 Ga0501071_0013581
417 Ga0501071_0245740
418 Ga0501072_0015757
419 Ga0501073_0137495
420 Ga0501074_0004616
421 Ga0501075_0002503
422 Ga0501075_0387259
423 Ga0501075_0541178
424 Ga0501076_0017214
425 Ga0501076_0196038
426 Ga0501076_0274673
427 Ga0501077_0029925
428 Ga0501079_0035714
429 Ga0501079_0066348
430 Ga0501080_0030258
431 Ga0501081_0008194
432 Ga0501035_0006206
433 Ga0501044_0092619
434 Ga0501045_0012935
435 nmdc:mga05p37_10337_c1
436 nmdc:mga05p37_608297_c1
437 nmdc:mga09592_626475_c1
438 nmdc:mga09592_7206_c1
439 nmdc:mga0qj67_140807_c1
440 nmdc:mga06r32_1181_c1
441 nmdc:mga06r32_9448_c1
442 nmdc:mga08y16_20574_c1
443 nmdc:mga0rr50_93617_c1
444 nmdc:mga08x19_119592_c1
445 Ga0495601_0059248
446 Ga0495601_0091132
447 Ga0495612_0002716
448 Ga0495619_0035222
449 Ga0495619_0321605
450 Ga0501084_0039603
451 Ga0501084_1072053
452 Ga0501082_0013313
453 2644506406
454 2995728673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

20

71

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9465 31 76
5sva-assembly1.cif.gz_h mediator-rna polymerase ii pre-initiation complex 0.8985 35 99
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8893 31 100
3f72-assembly3.cif.gz_E crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant 0.8855 17 76
6xjf-assembly4.cif.gz_D x-ray crystal structure of pyrococcus furiosus general transcription factor tfe-alpha (semet labeled protein) 0.8791 35 101
ID Description Score Start End Superfamily
af_O06195_1_80_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9443 29 107 1.10.10.10
3bp8B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9359 35 76 1.10.10.10
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9357 46 76 1.10.10.10
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9256 31 76 1.10.10.10
3r61B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9247 46 76 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A239BX47-F1-model_v4 Transcriptional regulator 0.9868 168 239
AF-A0A4R5A4Y6-F1-model_v4 Transcriptional regulator 0.9817 164 239
AF-A0A7W0JPZ8-F1-model_v4 Transcriptional regulator 0.9666 167 240
AF-A0A5C6WNQ9-F1-model_v4 deleted 0.9577 168 240
AF-A0A4R5BHY6-F1-model_v4 Transcriptional regulator 0.9562 164 239

Map