F339608

General Info

Members Datasets Scaffolds Average Seq Length
227 122 454 870

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100000422|Ga0070668_10000042217
Length 955
Sequence VSRLASHAGQRVDHSAGLSFSFDGRPRSGLEGDTIASALYAEGQRTFSRSFKYHRRRGELCGCGQCANSLVTVDGAPGVRACGEPLREGMRVEHQNAWPSLDFDLMRATDLFGGPFTPPGFYYKTFIRPRRLWPLYERVLRRAAGLGRLPRRQSEREWRTEYRRRHCDVLVTGGGAAGLSAALRAAELGADVVLCDEDAEPGGALLFEGRHERARGLVVACREAGVEILERGTALGYFDGLVPIWRGDTLHQVRAARHVAATGTLEQPLTFAANDLPGIMLSGGALRLASLYGVAPGQECVIAGVDDRALERALRLTEVGVNVSAVLDLRTEVDGELPAEVRSAGIELHTGCTPVRGRGRKRLEGIDVAAIDLAGRVRGKVRSLACDLLGVSGAPMPASSLLLQAGARAQYDEVANVFLPKEPPSLVHPAGAVAGHETLDRILLSGAVAGGEAALALGFXXXXDRSRIEAERDELASRAAAPHRASAPAVAFDGRRGKAFVDLDEDITAKDVRYAAAEGYDSIELSKRYTTVTMGPSQGRFSQLGSVRVLAEETGLHLSEVGLTTARPPWTTVPLGVLAGRPFEPAKRSAIHARHHDLGADVRWAGDWRRAYDYGDVEAETMAVHETAGLIDVSTLGKLIVAGPDAGELLDRLYPNRMSTLKPGRVRYGVLTTEAGRISDDGTVCRLDDECFYVTTTSSGAGAVEQWFSWWMACWPELEVTLTDVTQGISAMNLAGPSSREILARLTDADVSNDAVGYLDGVELTVAGVRCLVLRIGFVGELGYELHTSAPHGRALWDAIVAEGAQPFGLEPQRILRLQKMHILVGQDTDSEMTPYGANLGFAVKLDKEQDFIGRWALEHYVDRVPAQSLVGFSCPDGAVPTEGAAVVDHAGKVIGQVTSARLAPKLGRSIGLAMVAPELATDGTEITISDGSRRIAALVQTSPFYDPEGQRLRS

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
56 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
59 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
60 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
61 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
62 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
63 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
64 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
65 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
66 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
67 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
68 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
69 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
70 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
71 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
72 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
73 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
74 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
75 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
76 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
77 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
78 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
79 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
80 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
81 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
82 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
83 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
84 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
85 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
86 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
101 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
107 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
113 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
117 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
118 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
119 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
122 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.93
Rhizosphere 87.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100000422 3300005347 Bacteria 28032
2 Ga0070683_100014208 3300005329 Bacteria 6958
3 Ga0070666_10002760 3300005335 Bacteria 10614
4 Ga0070689_100026143 3300005340 Bacteria 4392
5 Ga0070659_100008804 3300005366 Bacteria 7394
6 Ga0070667_100004284 3300005367 Bacteria 12052
7 Ga0070667_100008014 3300005367 Bacteria 8762
8 Ga0070713_100064394 3300005436 Bacteria 3077
9 Ga0070707_100028535 3300005468 Bacteria 5312
10 Ga0070698_100085965 3300005471 Bacteria 3131
11 Ga0070679_100021183 3300005530 Bacteria 6342
12 Ga0070665_100001931 3300005548 Bacteria 23358
13 Ga0070665_100011829 3300005548 Bacteria 8817
14 Ga0068863_100013095 3300005841 Bacteria 8001
15 Ga0068860_100007197 3300005843 Bacteria 11125
16 Ga0068862_100002419 3300005844 Bacteria 16574
17 Ga0081455_10012190 3300005937 Bacteria 8585
18 Ga0081455_10025295 3300005937 Bacteria 5483
19 Ga0081538_10000042 3300005981 Bacteria 115656
20 Ga0081538_10000122 3300005981 Bacteria 78780
21 Ga0081538_10000134 3300005981 Bacteria 76605
22 Ga0081538_10000427 3300005981 Bacteria 47287
23 Ga0081538_10000987 3300005981 Bacteria 30164
24 Ga0081538_10001151 3300005981 Bacteria 27980
25 Ga0081538_10001608 3300005981 Bacteria 23186
26 Ga0081538_10002658 3300005981 Bacteria 17238
27 Ga0081538_10002802 3300005981 Bacteria 16695
28 Ga0081538_10003471 3300005981 Bacteria 14890
29 Ga0081538_10005371 3300005981 Bacteria 11518
30 Ga0081538_10007261 3300005981 Bacteria 9609
31 Ga0081538_10009654 3300005981 Bacteria 8021
32 Ga0081540_1002571 3300005983 Bacteria 14728
33 Ga0081539_10002214 3300005985 Bacteria 28357
34 Ga0075430_100031362 3300006846 Bacteria 4511
35 Ga0075431_100029894 3300006847 Bacteria 5609
36 Ga0075434_100013307 3300006871 Bacteria 7824
37 Ga0075434_100037738 3300006871 Bacteria 4783
38 Ga0105240_10053192 3300009093 Bacteria 5085
39 Ga0105245_10000974 3300009098 Bacteria 26146
40 Ga0105245_10050929 3300009098 Bacteria 3712
41 Ga0114129_10139383 3300009147 Bacteria 3326
42 Ga0105237_10012676 3300009545 Bacteria 8873
43 Ga0105249_10000636 3300009553 Bacteria 32006
44 Ga0105249_10027837 3300009553 Bacteria 5100
45 Ga0157369_10019833 3300013105 Bacteria 7523
46 Ga0157374_10018814 3300013296 Bacteria 6104
47 Ga0157378_10002168 3300013297 Bacteria 17423
48 Ga0163162_10004872 3300013306 Bacteria 12952
49 Ga0163163_10007703 3300014325 Bacteria 9515
50 Ga0163163_10063172 3300014325 Bacteria 3671
51 Ga0157379_10013530 3300014968 Bacteria 7150
52 Ga0157376_10006094 3300014969 Bacteria 8483
53 Ga0206353_11205578 3300020082 Bacteria 8942
54 Ga0213875_10000137 3300021388 Bacteria 80801
55 Ga0207688_10004886 3300025901 Bacteria 7297
56 Ga0207643_10024712 3300025908 Bacteria 3315
57 Ga0207707_10017306 3300025912 Bacteria 6282
58 Ga0207671_10022485 3300025914 Bacteria 4767
59 Ga0207662_10010653 3300025918 Bacteria 5083
60 Ga0207646_10011393 3300025922 Bacteria 8621
61 Ga0207650_10017740 3300025925 Bacteria 4986
62 Ga0207687_10004145 3300025927 Bacteria 9710
63 Ga0207664_10002306 3300025929 Bacteria 12592
64 Ga0207691_10076894 3300025940 Bacteria 3008
65 Ga0207711_10004988 3300025941 Bacteria 11256
66 Ga0207689_10031625 3300025942 Bacteria 4404
67 Ga0207712_10019962 3300025961 Bacteria 4383
68 Ga0207658_10018211 3300025986 Bacteria 4846
69 Ga0207641_10044234 3300026088 Bacteria 3744
70 Ga0268265_10001337 3300028380 Bacteria 21021
71 Ga0373925_0039564 3300037068 Bacteria 3488
72 Ga0395899_0017987 3300037312 Bacteria 5378
73 Ga0395900_0006084 3300037418 Bacteria 12586
74 Ga0395905_0005882 3300037471 Bacteria 12449
75 Ga0436364_0082088 3300037853 Bacteria 178031
76 Ga0436364_0648436 3300037853 Bacteria 3182
77 Ga0436364_0957455 3300037853 Bacteria 17317
78 Ga0436364_1513593 3300037853 Bacteria 6047
79 Ga0395901_0009535 3300038443 Bacteria 9852
80 Ga0395901_0011156 3300038443 Bacteria 9105
81 Ga0395901_0023979 3300038443 Bacteria 6259
82 Ga0436365_0357112 3300039437 Bacteria 12639
83 Ga0436365_0599401 3300039437 Bacteria 22192
84 Ga0436365_0633010 3300039437 Bacteria 8057
85 Ga0436363_0236307 3300039450 Bacteria 8823
86 Ga0466963_0002761 3300044694 Bacteria 9895
87 Ga0466963_0005369 3300044694 Bacteria 7500
88 Ga0466963_0016279 3300044694 Bacteria 4621
89 Ga0466963_0017838 3300044694 Bacteria 4429
90 Ga0466963_0047456 3300044694 Bacteria 2834
91 Ga0466964_0001900 3300044706 Bacteria 7296
92 Ga0466968_0002292 3300044735 Bacteria 6991
93 Ga0466968_0007905 3300044735 Bacteria 4060
94 Ga0466957_0002494 3300044842 Bacteria 9890
95 Ga0466957_0013938 3300044842 Bacteria 4674
96 Ga0466957_0029395 3300044842 Bacteria 3277
97 Ga0466959_0003850 3300045049 Bacteria 9957
98 Ga0466958_0004945 3300045836 Bacteria 7110
99 Ga0466967_0000418 3300045976 Bacteria 20170
100 Ga0466967_0000489 3300045976 Bacteria 19266
101 Ga0466967_0003641 3300045976 Bacteria 10130
102 Ga0466967_0005403 3300045976 Bacteria 8847
103 Ga0466967_0007825 3300045976 Bacteria 7764
104 Ga0495651_0015823 3300046462 Bacteria 5839
105 Ga0495582_0025516 3300046473 Bacteria 3238
106 Ga0495662_0012350 3300046476 Bacteria 4168
107 Ga0495608_0031777 3300046511 Bacteria 3567
108 Ga0495630_0043407 3300046517 Bacteria 3359
109 Ga0495630_0046469 3300046517 Bacteria 3246
110 Ga0495657_0021379 3300046675 Bacteria 4642
111 Ga0496101_0000354 3300048904 Bacteria 30937
112 Ga0496101_0014809 3300048904 Bacteria 5246
113 Ga0496102_0001938 3300048905 Bacteria 17821
114 Ga0496102_0028435 3300048905 Bacteria 4993
115 Ga0496103_0002893 3300048906 Bacteria 10654
116 Ga0496104_0006426 3300048907 Bacteria 10333
117 Ga0496105_0001380 3300048908 Bacteria 17045
118 Ga0496105_0002611 3300048908 Bacteria 13109
119 Ga0496106_0000459 3300048909 Bacteria 29214
120 Ga0496106_0025841 3300048909 Bacteria 4369
121 Ga0496107_0000598 3300048910 Bacteria 20127
122 Ga0496107_0014153 3300048910 Bacteria 5585
123 Ga0496108_0006203 3300048911 Bacteria 9681
124 Ga0496109_0009352 3300048912 Bacteria 8349
125 Ga0496110_0001976 3300048913 Bacteria 15242
126 Ga0496111_0000403 3300048914 Bacteria 21647
127 Ga0496114_0001549 3300048917 Bacteria 17435
128 Ga0496115_0000397 3300048918 Bacteria 35900
129 Ga0496121_0002609 3300048924 Bacteria 27233
130 Ga0501031_0000125 3300049568 Bacteria 42541
131 Ga0501031_0006056 3300049568 Bacteria 7898
132 Ga0501032_0001906 3300049569 Bacteria 16467
133 Ga0501033_0000431 3300049570 Bacteria 40150
134 Ga0501033_0031165 3300049570 Bacteria 4009
135 Ga0501036_0000028 3300049572 Bacteria 94173
136 Ga0501036_0005710 3300049572 Bacteria 10095
137 Ga0501036_0016988 3300049572 Bacteria 6080
138 Ga0501036_0022756 3300049572 Bacteria 5276
139 Ga0501038_0001630 3300049574 Bacteria 20875
140 Ga0501038_0002612 3300049574 Bacteria 16843
141 Ga0501039_0000151 3300049575 Bacteria 47532
142 Ga0501039_0001822 3300049575 Bacteria 15763
143 Ga0501040_0000329 3300049576 Bacteria 27806
144 Ga0501040_0000625 3300049576 Bacteria 21623
145 Ga0501040_0004043 3300049576 Bacteria 9534
146 Ga0501040_0011112 3300049576 Bacteria 5885
147 Ga0501040_0025144 3300049576 Bacteria 4002
148 Ga0501041_0000030 3300049577 Bacteria 45525
149 Ga0501041_0010914 3300049577 Bacteria 5362
150 Ga0501041_0016399 3300049577 Bacteria 4403
151 Ga0501041_0017282 3300049577 Bacteria 4292
152 Ga0501042_0000573 3300049578 Bacteria 19416
153 Ga0501042_0001343 3300049578 Bacteria 14383
154 Ga0501042_0002241 3300049578 Bacteria 11792
155 Ga0501042_0015715 3300049578 Bacteria 5186
156 Ga0501043_0000505 3300049579 Bacteria 35068
157 Ga0501046_0000040 3300049580 Bacteria 155029
158 Ga0501046_0012241 3300049580 Bacteria 7310
159 Ga0501046_0024820 3300049580 Bacteria 4912
160 Ga0501047_0000843 3300049581 Bacteria 31660
161 Ga0501048_0000010 3300049582 Bacteria 80895
162 Ga0501048_0001415 3300049582 Bacteria 18144
163 Ga0501068_0000045 3300049584 Bacteria 47610
164 Ga0501068_0002514 3300049584 Bacteria 9738
165 Ga0501069_0001927 3300049585 Bacteria 10364
166 Ga0501070_0005390 3300049586 Bacteria 10907
167 Ga0501071_0000258 3300049587 Bacteria 24788
168 Ga0501071_0024094 3300049587 Bacteria 4254
169 Ga0501071_0026292 3300049587 Bacteria 4084
170 Ga0501072_0000124 3300049588 Bacteria 57193
171 Ga0501072_0000784 3300049588 Bacteria 23294
172 Ga0501072_0014657 3300049588 Bacteria 6009
173 Ga0501072_0019741 3300049588 Bacteria 5213
174 Ga0501073_0001044 3300049589 Bacteria 20014
175 Ga0501074_0000042 3300049590 Bacteria 59418
176 Ga0501074_0029030 3300049590 Bacteria 4007
177 Ga0501074_0029932 3300049590 Bacteria 3946
178 Ga0501075_0000019 3300049591 Bacteria 68101
179 Ga0501075_0001504 3300049591 Bacteria 15200
180 Ga0501075_0002203 3300049591 Bacteria 12896
181 Ga0501075_0003993 3300049591 Bacteria 9957
182 Ga0501075_0006296 3300049591 Bacteria 8155
183 Ga0501075_0009275 3300049591 Bacteria 6885
184 Ga0501075_0012845 3300049591 Bacteria 5962
185 Ga0501076_0000043 3300049592 Bacteria 62174
186 Ga0501076_0001440 3300049592 Bacteria 15990
187 Ga0501076_0001796 3300049592 Bacteria 14552
188 Ga0501076_0020645 3300049592 Bacteria 5043
189 Ga0501076_0034973 3300049592 Bacteria 3930
190 Ga0501077_0001538 3300049593 Bacteria 13906
191 Ga0501077_0002403 3300049593 Bacteria 11234
192 Ga0501077_0002944 3300049593 Bacteria 10215
193 Ga0501077_0011696 3300049593 Bacteria 5485
194 Ga0501077_0017105 3300049593 Bacteria 4573
195 Ga0501079_0000035 3300049741 Bacteria 58031
196 Ga0501079_0005874 3300049741 Bacteria 9182
197 Ga0501079_0015354 3300049741 Bacteria 5843
198 Ga0501079_0024221 3300049741 Bacteria 4658
199 Ga0501079_0041849 3300049741 Bacteria 3537
200 Ga0501080_0000029 3300049742 Bacteria 88488
201 Ga0501080_0003910 3300049742 Bacteria 13196
202 Ga0501081_0000255 3300049743 Bacteria 27560
203 Ga0501081_0023475 3300049743 Bacteria 4134
204 Ga0501083_0005989 3300049744 Bacteria 8611
205 Ga0501035_0000757 3300049822 Bacteria 34788
206 Ga0501044_0028719 3300049823 Bacteria 5868
207 Ga0501045_0000601 3300049824 Bacteria 22672
208 Ga0501045_0005297 3300049824 Bacteria 8934
209 Ga0501045_0010966 3300049824 Bacteria 6347
210 Ga0501045_0048489 3300049824 Bacteria 3096
211 nmdc:mga05p37_191463_c1 3300050507 Bacteria 2483
212 nmdc:mga05p37_22112_c1 3300050507 Bacteria 7709
213 nmdc:mga05p37_74622_c1 3300050507 Bacteria 4174
214 nmdc:mga09592_24909_c1 3300050508 Bacteria 4949
215 nmdc:mga0qj67_3239_c1 3300050509 Bacteria 11721
216 Ga0501084_0000289 3300054114 Bacteria 38129
217 Ga0501084_0002460 3300054114 Bacteria 14912
218 Ga0501084_0016474 3300054114 Bacteria 6139
219 Ga0501084_0026573 3300054114 Bacteria 4831
220 Ga0501084_0029789 3300054114 Bacteria 4565
221 Ga0501084_0036988 3300054114 Bacteria 4078
222 Ga0501082_0000127 3300060353 Bacteria 61567
223 Ga0501082_0000421 3300060353 Bacteria 37503
224 Ga0530510_0000251 3300061734 Bacteria 33633
225 Ga0530510_0000304 3300061734 Bacteria 31332
226 Ga0530510_0002770 3300061734 Bacteria 12051
227 Ga0530510_0003484 3300061734 Bacteria 10819
228 Ga0070668_100000422
229 Ga0070683_100014208
230 Ga0070666_10002760
231 Ga0070689_100026143
232 Ga0070659_100008804
233 Ga0070667_100004284
234 Ga0070667_100008014
235 Ga0070713_100064394
236 Ga0070707_100028535
237 Ga0070698_100085965
238 Ga0070679_100021183
239 Ga0070665_100001931
240 Ga0070665_100011829
241 Ga0068863_100013095
242 Ga0068860_100007197
243 Ga0068862_100002419
244 Ga0081455_10012190
245 Ga0081455_10025295
246 Ga0081538_10000042
247 Ga0081538_10000122
248 Ga0081538_10000134
249 Ga0081538_10000427
250 Ga0081538_10000987
251 Ga0081538_10001151
252 Ga0081538_10001608
253 Ga0081538_10002658
254 Ga0081538_10002802
255 Ga0081538_10003471
256 Ga0081538_10005371
257 Ga0081538_10007261
258 Ga0081538_10009654
259 Ga0081540_1002571
260 Ga0081539_10002214
261 Ga0075430_100031362
262 Ga0075431_100029894
263 Ga0075434_100013307
264 Ga0075434_100037738
265 Ga0105240_10053192
266 Ga0105245_10000974
267 Ga0105245_10050929
268 Ga0114129_10139383
269 Ga0105237_10012676
270 Ga0105249_10000636
271 Ga0105249_10027837
272 Ga0157369_10019833
273 Ga0157374_10018814
274 Ga0157378_10002168
275 Ga0163162_10004872
276 Ga0163163_10007703
277 Ga0163163_10063172
278 Ga0157379_10013530
279 Ga0157376_10006094
280 Ga0206353_11205578
281 Ga0213875_10000137
282 Ga0207688_10004886
283 Ga0207643_10024712
284 Ga0207707_10017306
285 Ga0207671_10022485
286 Ga0207662_10010653
287 Ga0207646_10011393
288 Ga0207650_10017740
289 Ga0207687_10004145
290 Ga0207664_10002306
291 Ga0207691_10076894
292 Ga0207711_10004988
293 Ga0207689_10031625
294 Ga0207712_10019962
295 Ga0207658_10018211
296 Ga0207641_10044234
297 Ga0268265_10001337
298 Ga0373925_0039564
299 Ga0395899_0017987
300 Ga0395900_0006084
301 Ga0395905_0005882
302 Ga0436364_0082088
303 Ga0436364_0648436
304 Ga0436364_0957455
305 Ga0436364_1513593
306 Ga0395901_0009535
307 Ga0395901_0011156
308 Ga0395901_0023979
309 Ga0436365_0357112
310 Ga0436365_0599401
311 Ga0436365_0633010
312 Ga0436363_0236307
313 Ga0466963_0002761
314 Ga0466963_0005369
315 Ga0466963_0016279
316 Ga0466963_0017838
317 Ga0466963_0047456
318 Ga0466964_0001900
319 Ga0466968_0002292
320 Ga0466968_0007905
321 Ga0466957_0002494
322 Ga0466957_0013938
323 Ga0466957_0029395
324 Ga0466959_0003850
325 Ga0466958_0004945
326 Ga0466967_0000418
327 Ga0466967_0000489
328 Ga0466967_0003641
329 Ga0466967_0005403
330 Ga0466967_0007825
331 Ga0495651_0015823
332 Ga0495582_0025516
333 Ga0495662_0012350
334 Ga0495608_0031777
335 Ga0495630_0043407
336 Ga0495630_0046469
337 Ga0495657_0021379
338 Ga0496101_0000354
339 Ga0496101_0014809
340 Ga0496102_0001938
341 Ga0496102_0028435
342 Ga0496103_0002893
343 Ga0496104_0006426
344 Ga0496105_0001380
345 Ga0496105_0002611
346 Ga0496106_0000459
347 Ga0496106_0025841
348 Ga0496107_0000598
349 Ga0496107_0014153
350 Ga0496108_0006203
351 Ga0496109_0009352
352 Ga0496110_0001976
353 Ga0496111_0000403
354 Ga0496114_0001549
355 Ga0496115_0000397
356 Ga0496121_0002609
357 Ga0501031_0000125
358 Ga0501031_0006056
359 Ga0501032_0001906
360 Ga0501033_0000431
361 Ga0501033_0031165
362 Ga0501036_0000028
363 Ga0501036_0005710
364 Ga0501036_0016988
365 Ga0501036_0022756
366 Ga0501038_0001630
367 Ga0501038_0002612
368 Ga0501039_0000151
369 Ga0501039_0001822
370 Ga0501040_0000329
371 Ga0501040_0000625
372 Ga0501040_0004043
373 Ga0501040_0011112
374 Ga0501040_0025144
375 Ga0501041_0000030
376 Ga0501041_0010914
377 Ga0501041_0016399
378 Ga0501041_0017282
379 Ga0501042_0000573
380 Ga0501042_0001343
381 Ga0501042_0002241
382 Ga0501042_0015715
383 Ga0501043_0000505
384 Ga0501046_0000040
385 Ga0501046_0012241
386 Ga0501046_0024820
387 Ga0501047_0000843
388 Ga0501048_0000010
389 Ga0501048_0001415
390 Ga0501068_0000045
391 Ga0501068_0002514
392 Ga0501069_0001927
393 Ga0501070_0005390
394 Ga0501071_0000258
395 Ga0501071_0024094
396 Ga0501071_0026292
397 Ga0501072_0000124
398 Ga0501072_0000784
399 Ga0501072_0014657
400 Ga0501072_0019741
401 Ga0501073_0001044
402 Ga0501074_0000042
403 Ga0501074_0029030
404 Ga0501074_0029932
405 Ga0501075_0000019
406 Ga0501075_0001504
407 Ga0501075_0002203
408 Ga0501075_0003993
409 Ga0501075_0006296
410 Ga0501075_0009275
411 Ga0501075_0012845
412 Ga0501076_0000043
413 Ga0501076_0001440
414 Ga0501076_0001796
415 Ga0501076_0020645
416 Ga0501076_0034973
417 Ga0501077_0001538
418 Ga0501077_0002403
419 Ga0501077_0002944
420 Ga0501077_0011696
421 Ga0501077_0017105
422 Ga0501079_0000035
423 Ga0501079_0005874
424 Ga0501079_0015354
425 Ga0501079_0024221
426 Ga0501079_0041849
427 Ga0501080_0000029
428 Ga0501080_0003910
429 Ga0501081_0000255
430 Ga0501081_0023475
431 Ga0501083_0005989
432 Ga0501035_0000757
433 Ga0501044_0028719
434 Ga0501045_0000601
435 Ga0501045_0005297
436 Ga0501045_0010966
437 Ga0501045_0048489
438 nmdc:mga05p37_191463_c1
439 nmdc:mga05p37_22112_c1
440 nmdc:mga05p37_74622_c1
441 nmdc:mga09592_24909_c1
442 nmdc:mga0qj67_3239_c1
443 Ga0501084_0000289
444 Ga0501084_0002460
445 Ga0501084_0016474
446 Ga0501084_0026573
447 Ga0501084_0029789
448 Ga0501084_0036988
449 Ga0501082_0000127
450 Ga0501082_0000421
451 Ga0530510_0000251
452 Ga0530510_0000304
453 Ga0530510_0002770
454 Ga0530510_0003484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17806

SO_alpha_A3

Sarcosine oxidase A3 domain

496

581

0.98

PF01571

GCV_T

Aminomethyltransferase folate-binding domain

591

843

0.97

PF13510

Fer2_4

2Fe-2S iron-sulfur cluster binding domain

15

97

0.97

PF08669

GCV_T_C

Glycine cleavage T-protein C-terminal barrel domain

868

947

0.95

PF12831

FAD_oxidored

FAD dependent oxidoreductase

168

214

0.95

PF00890

FAD_binding_2

FAD binding domain

168

209

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lqc-assembly1.cif.gz_A crystal structure of cyclohexylamine oxidase from erythrobacteraceae bacterium 0.9999 166 203
2xfo-assembly1.cif.gz_B tranylcypromine-inhibited human monoamine oxidase b ile199ala mutant in complex with 2-(2-benzofuranyl)-2-imidazoline 0.9959 164 203
2bk4-assembly1.cif.gz_A human monoamine oxidase b: i199f mutant in complex with rasagiline 0.9947 164 203
3ng7-assembly1.cif.gz_X complex of dithionite-reduced 6-hydroxy-l-nicotine oxidase with substrate bound at active site and inhibitor at exit cavity 0.9942 166 203
2c72-assembly1.cif.gz_B functional role of the aromatic cage in human monoamine oxidase b: structures and catalytic properties of tyr435 mutant proteins 0.9941 164 203
ID Description Score Start End Superfamily
af_Q8H191_31_475_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.994 169 204 3.50.50.60
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9919 167 203 3.50.50.60
af_Q54HR9_1_452_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9774 163 203 3.50.50.60
af_A0A0R0K195_47_316_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9725 164 204 3.50.50.60
af_Q58883_2_383_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9692 168 204 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7S3HRF8-F1-model_v4 Aminomethyltransferase folate-binding domain-containing protein 0.9655 706 810 GO:0005739
AF-A0A534RH88-F1-model_v4 aminomethyltransferase (EC 2.1.2.10) (Glycine cleavage system T protein) 0.9654 698 924 GO:0004047
GO:0005829
GO:0005960
GO:0006546
GO:0008168
GO:0008483
GO:0032259
AF-A0A059X046-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain protein 0.9613 17 94 GO:0016491
GO:0051536
AF-T2ISK4-F1-model_v4 Aminomethyltransferase (Glycine cleavage system T protein) (EC 2.1.2.10) 0.9591 767 924 GO:0004047
GO:0005829
GO:0008168
GO:0032259
AF-A0A436FE03-F1-model_v4 Aminomethyl transferase family protein 0.9568 584 929 GO:0016740

Map