F339429

General Info

Members Datasets Scaffolds Average Seq Length
226 180 173 451

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8004025490|8004029033
Length 515
Sequence ESRADDVDETAADGAGVGPETVESATAGRTVVDPAGVDTPAARPPGSVGSLVAAARAVFDSGVTRPVAWRRDRLKAMNRMLLEHRGDFTAALAADLGKHPSESWLTELGFLASEITHTIKHLDQWLAPRRADVPLALQPAKAHTILEPLGVVLVIAPWNYPIQLVLAPVIGALAAGNTVVAKPSEMAPACAAALARWIPVYLGGAVTVVEGGVPETSALLEERFDHIFYTGNGRVGSIVMAAAARQLTPVTLELGGKSPVYIDDTVDMKAAAARIAWGKFMNAGQTCVAPDYVLGTASALFNLAAELPQAIRAMYGGAPSRSGAYGHMVSDAAFGRVAAMLDHDLRQDGTRMVTGGRSDPATRYIEPTVLHVEAGAVLMEEEIFGPVLPLVTVESAADAVRFVNARDKPLSLYVFSEDRGVRKAFTEQTSSGALNFGVPAAHLSVPGLPFGGVGGSGMGAYHGQHSVETFSHRKAVLDKPLAPDTLGLIYPPFGALKRQVIKRFVAPAGRRFGKN

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
6 2643221647 Streptomyces sp. Root369 Isolate Unclassified
7 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
8 2643221714 Streptomyces sp. Root264 Isolate Unclassified
9 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
10 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
11 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
12 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
13 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
14 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
15 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
16 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
17 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
18 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
19 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
20 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
21 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
22 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
23 2867428634 Streptomyces sp. RP5T Isolate Unclassified
24 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
25 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
26 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
27 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
28 2920879853 Kocuria salina CV6 Isolate Unclassified
29 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
30 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
31 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
32 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
33 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
34 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
35 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
36 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
37 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
38 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
39 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
40 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
41 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
42 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
43 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
44 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
45 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
46 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
47 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
48 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
77 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
80 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
81 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
82 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
89 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
90 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
95 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
96 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
97 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
98 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
99 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
100 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
101 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
102 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
103 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
104 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
130 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
131 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
157 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
166 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
167 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
168 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
173 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
174 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
175 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
176 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
177 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
178 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
179 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
180 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.11
Metatranscriptomes 0
Isolates 23.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.75
Nodule 0.88
Rhizoplane 2.21
Rhizosphere 65.49
Stem 0
Stem Tuber 0
Unclassified 25.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10001291 3300003316 Bacteria 29451
2 rootH1_10003700 3300003316 Bacteria 13804
3 rootH1_10009365 3300003316 Bacteria 10254
4 rootH1_10009365 3300003323 Bacteria 2107
5 rootH1_10123974 3300003316 Bacteria 1752
6 rootH2_10004559 3300003320 Bacteria 142332
7 rootL2_10034776 3300003322 Bacteria 10012
8 rootH1_10002701 3300003323 Bacteria 73970
9 Ga0070658_10052762 3300005327 Bacteria 3299
10 Ga0070678_100105940 3300005456 Bacteria 2190
11 Ga0070684_100134663 3300005535 Bacteria 2231
12 Ga0070672_100017848 3300005543 Bacteria 5116
13 Ga0068857_100197305 3300005577 Bacteria 1834
14 Ga0075368_10015403 3300006042 Bacteria 2837
15 Ga0075363_100006866 3300006048 Bacteria 5202
16 Ga0075367_10000756 3300006178 Bacteria 12614
17 Ga0075367_10046558 3300006178 Bacteria 2548
18 Ga0105244_10031765 3300009036 Bacteria 2801
19 Ga0105243_10010316 3300009148 Bacteria 7096
20 Ga0105246_10139024 3300011119 Bacteria 1824
21 Ga0157372_10237383 3300013307 Bacteria 2115
22 Ga0182008_10003877 3300014497 Bacteria 8880
23 Ga0182007_10003924 3300015262 Bacteria 6888
24 Ga0183367_1003 3300015688 Bacteria 814276
25 Ga0207645_10010319 3300025907 Bacteria 6412
26 Ga0207705_10071838 3300025909 Bacteria 2509
27 Ga0207659_10079325 3300025926 Bacteria 2422
28 Ga0207644_10176011 3300025931 Bacteria 1674
29 Ga0207709_10032546 3300025935 Bacteria 3054
30 Ga0207691_10046143 3300025940 Bacteria 4006
31 Ga0207689_10006540 3300025942 Bacteria 10284
32 Ga0207651_10036295 3300025960 Bacteria 3216
33 Ga0207658_10036069 3300025986 Bacteria 3545
34 Ga0207683_10095102 3300026121 Bacteria 2656
35 Ga0307517_10055899 3300028786 Bacteria 3863
36 Ga0307515_10000106 3300028794 Bacteria 197218
37 Ga0307515_10034948 3300028794 Bacteria 8199
38 Ga0307511_10000047 3300030521 Bacteria 98863
39 Ga0307511_10000410 3300030521 Bacteria 45774
40 Ga0307511_10014202 3300030521 Bacteria 7752
41 Ga0307512_10019762 3300030522 Bacteria 6124
42 Ga0307512_10034758 3300030522 Bacteria 4306
43 Ga0307513_10014947 3300031456 Bacteria 9430
44 Ga0307513_10062351 3300031456 Bacteria 3941
45 Ga0307509_10024805 3300031507 Bacteria 6710
46 Ga0307509_10025771 3300031507 Bacteria 6566
47 Ga0307509_10036328 3300031507 Bacteria 5395
48 Ga0307508_10019597 3300031616 Bacteria 6149
49 Ga0307508_10053085 3300031616 Bacteria 3599
50 Ga0307514_10015008 3300031649 Bacteria 6397
51 Ga0307514_10122579 3300031649 Bacteria 1809
52 Ga0316576_10007150 3300031727 Bacteria 6999
53 Ga0307516_10000711 3300031730 Bacteria 45216
54 Ga0307516_10097740 3300031730 Bacteria 2755
55 Ga0307518_10012829 3300031838 Bacteria 5984
56 Ga0307518_10034263 3300031838 Bacteria 3686
57 Ga0307518_10080233 3300031838 Bacteria 2356
58 Ga0307518_10107726 3300031838 Bacteria 1988
59 Ga0307410_10044300 3300031852 Bacteria 2955
60 Ga0307409_100119870 3300031995 Bacteria 2226
61 Ga0307415_100025349 3300032126 Bacteria 3719
62 Ga0307507_10010385 3300033179 Bacteria 12042
63 Ga0307510_10031280 3300033180 Bacteria 6017
64 Ga0307510_10141737 3300033180 Bacteria 2045
65 Ga0316584_0024950 3300036712 Bacteria 4381
66 Ga0395899_0039603 3300037312 Bacteria 3527
67 Ga0395900_0075623 3300037418 Bacteria 3462
68 Ga0395900_0122251 3300037418 Bacteria 2671
69 Ga0395901_0072853 3300038443 Bacteria 3581
70 Ga0395901_0129803 3300038443 Bacteria 2648
71 Ga0439436_0005947 3300041404 Bacteria 3741
72 Ga0439439_0004004 3300041406 Bacteria 3289
73 Ga0451837_0721881 3300041494 Bacteria 4113
74 Ga0439433_0013554 3300041999 Bacteria 1790
75 Ga0439449_0014100 3300042007 Bacteria 3006
76 Ga0439457_003912 3300042014 Bacteria 3980
77 Ga0439462_0010724 3300042015 Bacteria 2325
78 Ga0450890_001529 3300042127 Bacteria 3323
79 Ga0450891_000277 3300042129 Bacteria 5194
80 Ga0450903_000118 3300042138 Bacteria 17039
81 Ga0450893_0000263 3300042532 Bacteria 7129
82 Ga0453684_0031077 3300044712 Bacteria 7520
83 Ga0451576_0072153 3300045051 Bacteria 3593
84 Ga0495629_0072731 3300046459 Bacteria 2400
85 Ga0495651_0019166 3300046462 Bacteria 5300
86 Ga0495653_0046753 3300046463 Bacteria 3350
87 Ga0495662_0006918 3300046476 Bacteria 5634
88 Ga0495662_0075526 3300046476 Bacteria 1635
89 Ga0495664_0000236 3300046477 Bacteria 26604
90 Ga0495666_0092752 3300046526 Bacteria 1425
91 Ga0495587_0001199 3300046536 Bacteria 17150
92 Ga0495645_0146654 3300046543 Bacteria 1643
93 Ga0495634_0000597 3300046642 Bacteria 35071
94 Ga0495625_0012742 3300046660 Bacteria 6800
95 Ga0495625_0019349 3300046660 Bacteria 5284
96 Ga0495635_0000810 3300046663 Bacteria 20485
97 Ga0495588_0001349 3300046674 Bacteria 10492
98 Ga0495657_0001598 3300046675 Bacteria 19479
99 Ga0495613_0000319 3300046689 Bacteria 43656
100 Ga0495613_0021454 3300046689 Bacteria 4813
101 Ga0495671_0097055 3300046692 Bacteria 1441
102 Ga0495589_0002710 3300046794 Bacteria 9792
103 Ga0495600_0057256 3300046809 Bacteria 2546
104 Ga0495581_0014411 3300047315 Bacteria 4585
105 Ga0495604_0001916 3300047317 Bacteria 16852
106 Ga0495636_0026373 3300047318 Bacteria 2364
107 Ga0495674_0019336 3300047319 Bacteria 6321
108 Ga0495676_0007625 3300047321 Bacteria 9926
109 Ga0495676_0034769 3300047321 Bacteria 4224
110 Ga0495687_002234 3300047443 Bacteria 15985
111 Ga0495687_005008 3300047443 Bacteria 8655
112 Ga0495685_007730 3300047447 Bacteria 3557
113 Ga0495681_0003382 3300047470 Bacteria 11103
114 Ga0495593_0003472 3300047673 Bacteria 9439
115 Ga0495602_0005718 3300048088 Bacteria 13041
116 Ga0496103_0054315 3300048906 Bacteria 2483
117 Ga0496105_0022757 3300048908 Bacteria 5078
118 Ga0496110_0016753 3300048913 Bacteria 6123
119 Ga0496114_0147717 3300048917 Bacteria 2038
120 Ga0496115_0019363 3300048918 Bacteria 5235
121 Ga0496117_0000235 3300048920 Bacteria 104830
122 Ga0496121_0026483 3300048924 Bacteria 5462
123 Ga0496123_0014769 3300048926 Bacteria 6448
124 Ga0496126_0014124 3300048929 Bacteria 8087
125 Ga0496126_0048259 3300048929 Bacteria 3892
126 Ga0496126_0131970 3300048929 Bacteria 2158
127 Ga0501031_0026947 3300049568 Bacteria 3746
128 Ga0501031_0037679 3300049568 Bacteria 3156
129 Ga0501031_0064396 3300049568 Bacteria 2387
130 Ga0501032_0010715 3300049569 Bacteria 6597
131 Ga0501033_0002815 3300049570 Bacteria 14557
132 Ga0501033_0074670 3300049570 Bacteria 2489
133 Ga0501033_0099477 3300049570 Bacteria 2123
134 Ga0501034_0019953 3300049571 Bacteria 6844
135 Ga0501034_0094785 3300049571 Bacteria 2981
136 Ga0501036_0008874 3300049572 Bacteria 8256
137 Ga0501036_0053766 3300049572 Bacteria 3409
138 Ga0501037_0000817 3300049573 Bacteria 23283
139 Ga0501038_0001431 3300049574 Bacteria 21881
140 Ga0501038_0028918 3300049574 Bacteria 4918
141 Ga0501039_0002975 3300049575 Bacteria 12674
142 Ga0501039_0011709 3300049575 Bacteria 6682
143 Ga0501042_0001910 3300049578 Bacteria 12525
144 Ga0501046_0004213 3300049580 Bacteria 13097
145 Ga0501046_0018001 3300049580 Bacteria 5888
146 Ga0501046_0040150 3300049580 Bacteria 3741
147 Ga0501047_0007648 3300049581 Bacteria 10174
148 Ga0501047_0023349 3300049581 Bacteria 5939
149 Ga0501047_0044130 3300049581 Bacteria 4306
150 Ga0501047_0172012 3300049581 Bacteria 2034
151 Ga0501048_0002856 3300049582 Bacteria 13182
152 Ga0501070_0047365 3300049586 Bacteria 3573
153 Ga0501070_0200474 3300049586 Bacteria 1639
154 Ga0501247_000167 3300049677 Bacteria 4105
155 Ga0501257_014090 3300049686 Bacteria 1835
156 Ga0501080_0187154 3300049742 Bacteria 1903
157 Ga0501083_0000056 3300049744 Bacteria 82115
158 Ga0501264_000016 3300049761 Bacteria 26002
159 Ga0501035_0007481 3300049822 Bacteria 10202
160 Ga0501044_0013986 3300049823 Bacteria 8669
161 Ga0501044_0018586 3300049823 Bacteria 7447
162 Ga0501044_0034042 3300049823 Bacteria 5347
163 Ga0501044_0047174 3300049823 Bacteria 4457
164 nmdc:mga03n38_39390_c1 3300050490 Bacteria 2049
165 nmdc:mga0yw44_20169_c1 3300050492 Bacteria 3693
166 Ga0500635_0000015 3300053080 Bacteria 125195
167 Ga0500578_0116097 3300053086 Bacteria 1685
168 Ga0500643_002269 3300053087 Bacteria 10086
169 Ga0500640_058802 3300053095 Bacteria 1669
170 Ga0500616_0000021 3300053153 Bacteria 484527
171 Ga0500616_0004919 3300053153 Bacteria 9279
172 Ga0500624_003993 3300053157 Bacteria 1935
173 Ga0501084_0000058 3300054114 Bacteria 87566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10237383 Ga0157372_102373832 419
2 3300014497 Ga0182008_10003877 Ga0182008_100038774 419
3 3300015262 Ga0182007_10003924 Ga0182007_100039244 419
4 3300011119 Ga0105246_10139024 Ga0105246_101390242 420
5 3300030522 Ga0307512_10019762 Ga0307512_100197621 422
6 3300042138 Ga0450903_000118 Ga0450903_000118_165_1487 423
7 3300037418 Ga0395900_0075623 Ga0395900_0075623_2142_3422 425
8 3300048906 Ga0496103_0054315 Ga0496103_0054315_1193_2473 425
9 3300048929 Ga0496126_0131970 Ga0496126_0131970_52_1332 425
10 3300049571 Ga0501034_0094785 Ga0501034_0094785_1691_2971 425
11 iso_pu_bacteria 2867428634 2867428799 428
12 3300046476 Ga0495662_0075526 Ga0495662_0075526_55_1377 429
13 3300046689 Ga0495613_0021454 Ga0495613_0021454_350_1672 429
14 3300046794 Ga0495589_0002710 Ga0495589_0002710_827_2149 429
15 3300047447 Ga0495685_007730 Ga0495685_007730_1444_2766 429
16 3300047318 Ga0495636_0026373 Ga0495636_0026373_110_1432 430
17 3300028794 Ga0307515_10000106 Ga0307515_10000106123 431
18 3300030521 Ga0307511_10014202 Ga0307511_100142025 431
19 3300031616 Ga0307508_10053085 Ga0307508_100530853 431
20 3300031838 Ga0307518_10080233 Ga0307518_100802332 431
21 3300033179 Ga0307507_10010385 Ga0307507_100103857 431
22 3300046459 Ga0495629_0072731 Ga0495629_0072731_831_2153 431
23 3300046462 Ga0495651_0019166 Ga0495651_0019166_3069_4391 431
24 3300046476 Ga0495662_0006918 Ga0495662_0006918_3524_4846 431
25 3300046477 Ga0495664_0000236 Ga0495664_0000236_18236_19558 431
26 3300046526 Ga0495666_0092752 Ga0495666_0092752_25_1347 431
27 3300046536 Ga0495587_0001199 Ga0495587_0001199_6683_8005 431
28 3300046543 Ga0495645_0146654 Ga0495645_0146654_268_1590 431
29 3300046642 Ga0495634_0000597 Ga0495634_0000597_8000_9322 431
30 3300046660 Ga0495625_0012742 Ga0495625_0012742_324_1646 431
31 3300046663 Ga0495635_0000810 Ga0495635_0000810_8205_9527 431
32 3300046674 Ga0495588_0001349 Ga0495588_0001349_759_2081 431
33 3300046675 Ga0495657_0001598 Ga0495657_0001598_1180_2502 431
34 3300046689 Ga0495613_0000319 Ga0495613_0000319_31525_32847 431
35 3300046692 Ga0495671_0097055 Ga0495671_0097055_64_1386 431
36 3300046809 Ga0495600_0057256 Ga0495600_0057256_849_2171 431
37 3300047315 Ga0495581_0014411 Ga0495581_0014411_52_1374 431
38 3300047317 Ga0495604_0001916 Ga0495604_0001916_10810_12132 431
39 3300047319 Ga0495674_0019336 Ga0495674_0019336_875_2197 431
40 3300047321 Ga0495676_0007625 Ga0495676_0007625_144_1466 431
41 3300047470 Ga0495681_0003382 Ga0495681_0003382_9748_11070 431
42 3300047673 Ga0495593_0003472 Ga0495593_0003472_961_2283 431
43 3300048088 Ga0495602_0005718 Ga0495602_0005718_8913_10235 431
44 3300053095 Ga0500640_058802 Ga0500640_058802_63_1385 431
45 3300053157 Ga0500624_003993 Ga0500624_003993_176_1498 431
46 iso_pu_bacteria 8056667051 8056671588 434
47 iso_pu_bacteria 2547132111 2547408874 435
48 iso_pu_bacteria 2582581313 2585305983 435
49 iso_pu_bacteria 2616644814 2616693725 435
50 iso_pu_bacteria 2784746768 2785366256 435
51 iso_pu_bacteria 2786546132 2786667225 435
52 iso_pu_bacteria 2811994879 2812353467 435
53 iso_pu_bacteria 2852635781 2852643037 435
54 iso_pu_bacteria 2862178590 2862180591 435
55 iso_pu_bacteria 2877676314 2877684261 435
56 iso_pu_bacteria 2946064051 2946072269 435
57 iso_pu_bacteria 2954380949 2954389592 435
58 iso_pu_bacteria 2954673503 2954682313 435
59 iso_pu_bacteria 2954682443 2954690611 435
60 iso_pu_bacteria 2954691527 2954700439 435
61 iso_pu_bacteria 2954701450 2954701789 435
62 iso_pu_bacteria 3006393351 3006398963 435
63 iso_pu_bacteria 8056829672 8056831001 435
64 iso_pu_bacteria 2643221678 2644441825 436
65 iso_pu_bacteria 2643221714 2644630792 436
66 iso_pu_bacteria 2808606359 2808846844 436
67 iso_pu_bacteria 2862281513 2862282386 436
68 iso_pu_bacteria 2919468124 2919473865 436
69 iso_pu_bacteria 2946072368 2946073025 436
70 3300050492 nmdc:mga0yw44_20169_c1 nmdc:mga0yw44_20169_c1_907_2244 438
71 iso_pu_bacteria 2643221647 2644265155 438
72 iso_pu_bacteria 2808606375 2808917486 438
73 3300003316 rootH1_10003700 rootH1_1000370015 439
74 3300003316 rootH1_10123974 rootH1_101239741 439
75 3300006178 Ga0075367_10000756 Ga0075367_1000075614 439
76 3300028786 Ga0307517_10055899 Ga0307517_100558992 439
77 3300030521 Ga0307511_10000047 Ga0307511_1000004737 439
78 3300030521 Ga0307511_10000410 Ga0307511_1000041036 439
79 3300030522 Ga0307512_10034758 Ga0307512_100347582 439
80 3300031456 Ga0307513_10062351 Ga0307513_100623514 439
81 3300031507 Ga0307509_10024805 Ga0307509_100248053 439
82 3300031507 Ga0307509_10025771 Ga0307509_100257717 439
83 3300031507 Ga0307509_10036328 Ga0307509_100363282 439
84 3300031616 Ga0307508_10019597 Ga0307508_100195975 439
85 3300031649 Ga0307514_10015008 Ga0307514_100150086 439
86 3300031649 Ga0307514_10122579 Ga0307514_101225791 439
87 3300031730 Ga0307516_10000711 Ga0307516_1000071113 439
88 3300031730 Ga0307516_10097740 Ga0307516_100977402 439
89 3300031838 Ga0307518_10034263 Ga0307518_100342633 439
90 3300031838 Ga0307518_10107726 Ga0307518_101077261 439
91 3300033180 Ga0307510_10031280 Ga0307510_100312804 439
92 3300033180 Ga0307510_10141737 Ga0307510_101417373 439
93 3300041404 Ga0439436_0005947 Ga0439436_0005947_266_1588 439
94 3300041406 Ga0439439_0004004 Ga0439439_0004004_620_1942 439
95 3300041494 Ga0451837_0721881 Ga0451837_0721881_2084_3484 439
96 3300041999 Ga0439433_0013554 Ga0439433_0013554_138_1460 439
97 3300042007 Ga0439449_0014100 Ga0439449_0014100_1177_2499 439
98 3300042014 Ga0439457_003912 Ga0439457_003912_1604_2926 439
99 3300042015 Ga0439462_0010724 Ga0439462_0010724_437_1759 439
100 3300046660 Ga0495625_0019349 Ga0495625_0019349_2268_3713 439
101 3300047321 Ga0495676_0034769 Ga0495676_0034769_283_1641 439
102 3300047443 Ga0495687_002234 Ga0495687_002234_5153_6475 439
103 3300047443 Ga0495687_005008 Ga0495687_005008_4945_6267 439
104 3300049574 Ga0501038_0001431 Ga0501038_0001431_10175_11497 439
105 3300049586 Ga0501070_0200474 Ga0501070_0200474_42_1364 439
106 3300053086 Ga0500578_0116097 Ga0500578_0116097_342_1664 439
107 iso_pu_bacteria 2582581314 2585316392 439
108 3300006048 Ga0075363_100006866 Ga0075363_1000068663 440
109 3300015688 Ga0183367_1003 Ga0183367_1003652 440
110 3300028794 Ga0307515_10034948 Ga0307515_100349487 440
111 3300031456 Ga0307513_10014947 Ga0307513_100149479 440
112 3300050490 nmdc:mga03n38_39390_c1 nmdc:mga03n38_39390_c1_185_1612 440
113 iso_pu_bacteria 2954711539 2954719115 440
114 iso_pu_bacteria 2954721474 2954729085 440
115 iso_pu_bacteria 2954731030 2954732726 440
116 iso_pu_bacteria 2954749733 2954751604 440
117 iso_pu_bacteria 2954759201 2954767109 440
118 iso_pu_bacteria 2997451912 2997452194 444
119 iso_pu_bacteria 2818991472 2819747649 445
120 3300031838 Ga0307518_10012829 Ga0307518_100128292 446
121 3300049572 Ga0501036_0008874 Ga0501036_0008874_509_1900 448
122 3300049573 Ga0501037_0000817 Ga0501037_0000817_3354_4745 448
123 3300049575 Ga0501039_0002975 Ga0501039_0002975_6259_7650 448
124 3300049586 Ga0501070_0047365 Ga0501070_0047365_951_2342 448
125 3300053087 Ga0500643_002269 Ga0500643_002269_2549_3913 448
126 3300049568 Ga0501031_0064396 Ga0501031_0064396_945_2342 450
127 3300049569 Ga0501032_0010715 Ga0501032_0010715_945_2342 450
128 3300049571 Ga0501034_0019953 Ga0501034_0019953_4503_5900 450
129 3300049574 Ga0501038_0028918 Ga0501038_0028918_2092_3489 450
130 3300049580 Ga0501046_0004213 Ga0501046_0004213_5235_6632 450
131 3300049581 Ga0501047_0044130 Ga0501047_0044130_818_2215 450
132 3300049582 Ga0501048_0002856 Ga0501048_0002856_6660_8057 450
133 3300049677 Ga0501247_000167 Ga0501247_000167_1519_2952 450
134 3300049823 Ga0501044_0034042 Ga0501044_0034042_2092_3489 450
135 iso_pu_bacteria 2919688452 2919691083 450
136 3300048908 Ga0496105_0022757 Ga0496105_0022757_3107_4477 451
137 3300048913 Ga0496110_0016753 Ga0496110_0016753_4419_5789 451
138 3300005456 Ga0070678_100105940 Ga0070678_1001059402 454
139 3300026121 Ga0207683_10095102 Ga0207683_100951022 454
140 iso_pu_bacteria 2643221632 2644183944 455
141 3300031995 Ga0307409_100119870 Ga0307409_1001198702 456
142 3300046463 Ga0495653_0046753 Ga0495653_0046753_1314_2798 456
143 iso_pu_bacteria 8002811521 8002814166 458
144 3300009036 Ga0105244_10031765 Ga0105244_100317652 459
145 3300053080 Ga0500635_0000015 Ga0500635_0000015_10124_11506 459
146 3300049823 Ga0501044_0047174 Ga0501044_0047174_655_2073 460
147 iso_pu_bacteria 2862993130 2862993384 460
148 iso_pu_bacteria 2868088558 2868094749 460
149 iso_pu_bacteria 8055431914 8055433110 461
150 3300005327 Ga0070658_10052762 Ga0070658_100527623 462
151 3300025907 Ga0207645_10010319 Ga0207645_100103197 462
152 3300025909 Ga0207705_10071838 Ga0207705_100718382 462
153 3300038443 Ga0395901_0129803 Ga0395901_0129803_1150_2541 462
154 3300048917 Ga0496114_0147717 Ga0496114_0147717_550_1941 462
155 3300048918 Ga0496115_0019363 Ga0496115_0019363_2072_3463 462
156 3300048924 Ga0496121_0026483 Ga0496121_0026483_3402_4796 462
157 3300049568 Ga0501031_0026947 Ga0501031_0026947_677_2068 462
158 3300049568 Ga0501031_0037679 Ga0501031_0037679_1105_2496 462
159 3300049570 Ga0501033_0002815 Ga0501033_0002815_8770_10161 462
160 3300049570 Ga0501033_0099477 Ga0501033_0099477_334_1725 462
161 3300049572 Ga0501036_0053766 Ga0501036_0053766_334_1725 462
162 3300049575 Ga0501039_0011709 Ga0501039_0011709_1359_2750 462
163 3300049580 Ga0501046_0018001 Ga0501046_0018001_400_1791 462
164 3300049580 Ga0501046_0040150 Ga0501046_0040150_1149_2540 462
165 3300049581 Ga0501047_0007648 Ga0501047_0007648_5545_6936 462
166 3300049581 Ga0501047_0023349 Ga0501047_0023349_4150_5541 462
167 3300049581 Ga0501047_0172012 Ga0501047_0172012_270_1661 462
168 3300049742 Ga0501080_0187154 Ga0501080_0187154_355_1746 462
169 3300049822 Ga0501035_0007481 Ga0501035_0007481_3450_4841 462
170 3300049823 Ga0501044_0013986 Ga0501044_0013986_3672_5063 462
171 3300049823 Ga0501044_0018586 Ga0501044_0018586_5520_6911 462
172 iso_pu_bacteria 2844852863 2844855672 462
173 iso_pu_bacteria 8056037122 8056039541 462
174 3300031727 Ga0316576_10007150 Ga0316576_100071502 463
175 3300036712 Ga0316584_0024950 Ga0316584_0024950_346_1746 463
176 3300005543 Ga0070672_100017848 Ga0070672_1000178482 464
177 3300025926 Ga0207659_10079325 Ga0207659_100793252 464
178 3300025931 Ga0207644_10176011 Ga0207644_101760111 464
179 3300025940 Ga0207691_10046143 Ga0207691_100461433 464
180 3300025942 Ga0207689_10006540 Ga0207689_100065406 464
181 3300025960 Ga0207651_10036295 Ga0207651_100362953 464
182 3300025986 Ga0207658_10036069 Ga0207658_100360692 464
183 iso_pu_bacteria 2862382967 2862389542 464
184 3300048929 Ga0496126_0048259 Ga0496126_0048259_831_2231 465
185 iso_pu_bacteria 2928121344 2928123641 465
186 iso_pu_bacteria 2939660829 2939663033 465
187 3300037418 Ga0395900_0122251 Ga0395900_0122251_945_2357 466
188 3300053153 Ga0500616_0000021 Ga0500616_0000021_170306_171709 466
189 iso_pu_bacteria 2857729791 2857730398 466
190 iso_pu_bacteria 8004021418 8004023747 466
191 iso_pu_bacteria 8008558824 8008565467 466
192 3300054114 Ga0501084_0000058 Ga0501084_0000058_5012_6415 467
193 3300006042 Ga0075368_10015403 Ga0075368_100154033 468
194 3300006178 Ga0075367_10046558 Ga0075367_100465583 468
195 3300048920 Ga0496117_0000235 Ga0496117_0000235_4503_5948 468
196 iso_pu_bacteria 2582581314 2585311940 468
197 iso_pu_bacteria 2818991318 2819427025 468
198 3300031852 Ga0307410_10044300 Ga0307410_100443002 469
199 3300032126 Ga0307415_100025349 Ga0307415_1000253494 469
200 3300037312 Ga0395899_0039603 Ga0395899_0039603_254_1678 469
201 3300038443 Ga0395901_0072853 Ga0395901_0072853_2074_3498 469
202 3300048929 Ga0496126_0014124 Ga0496126_0014124_343_1770 470
203 iso_pu_bacteria 8057345674 8057348594 470
204 3300005535 Ga0070684_100134663 Ga0070684_1001346631 471
205 3300005577 Ga0068857_100197305 Ga0068857_1001973052 471
206 3300049578 Ga0501042_0001910 Ga0501042_0001910_9640_11058 471
207 3300049744 Ga0501083_0000056 Ga0501083_0000056_8378_9796 471
208 3300053153 Ga0500616_0004919 Ga0500616_0004919_2506_3936 471
209 3300048926 Ga0496123_0014769 Ga0496123_0014769_3537_4961 472
210 3300049570 Ga0501033_0074670 Ga0501033_0074670_155_1591 472
211 iso_pu_bacteria 2920879853 2920881923 475
212 3300003316 rootH1_10009365 rootH1_100093655 476
213 3300003320 rootH2_10004559 rootH2_1000455962 476
214 3300003322 rootL2_10034776 rootL2_100347765 476
215 3300003323 rootH1_10002701 rootH1_1000270142 476
216 3300049686 Ga0501257_014090 Ga0501257_014090_199_1632 476
217 3300049761 Ga0501264_000016 Ga0501264_000016_15310_16743 476
218 3300044712 Ga0453684_0031077 Ga0453684_0031077_748_2187 479
219 3300045051 Ga0451576_0072153 Ga0451576_0072153_670_2109 479
220 iso_pu_bacteria 8004025490 8004029033 479
221 3300003316 rootH1_10001291 rootH1_100012915 488
222 3300009148 Ga0105243_10010316 Ga0105243_100103163 488
223 3300025935 Ga0207709_10032546 Ga0207709_100325462 488
224 3300042127 Ga0450890_001529 Ga0450890_001529_1732_3198 488
225 3300042129 Ga0450891_000277 Ga0450891_000277_710_2176 488
226 3300042532 Ga0450893_0000263 Ga0450893_0000263_3727_5193 488

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

26

476

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ucd-assembly1.cif.gz_B benzaldehyde dehydrogenase, a class 3 aldehyde dehydrogenase, with bound nadp+ and benzoate adduct 0.9671 18 455
1ad3-assembly1.cif.gz_B class 3 aldehyde dehydrogenase complex with nicotinamide-adenine-dinucleotide 0.9619 21 470
4l1o-assembly1.cif.gz_A crystal structure of human aldh3a1 with inhibitor 1-{[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]methyl}-1h-indole-2,3-dione 0.9596 20 470
8bb8-assembly1.cif.gz_A crystal structure of human aldehyde dehydrogenase aldh3a1 in complex with octanal 0.9594 20 470
1ad3-assembly1.cif.gz_B class 3 aldehyde dehydrogenase complex with nicotinamide-adenine-dinucleotide 0.9556 21 470
ID Description Score Start End Superfamily
af_Q54DG1_224_414_3.40.309.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9796 233 431 3.40.309.10
af_F1LT79_6_152_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9792 84 229 3.40.605.10
af_A0A2R8RIE8_244_439_3.40.309.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9785 231 433 3.40.309.10
af_Q2FWX9_214_408_3.40.309.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9769 231 431 3.40.309.10
af_Q2FWX9_4_206_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9761 22 222 3.40.605.10
ID Description Score Start End GO Terms
AF-A0A6A4RT48-F1-model_v4 Aldehyde dehydrogenase domain-containing protein 0.9827 150 430 GO:0004028
GO:0004029
GO:0005737
GO:0006081
AF-A0A7C8Z515-F1-model_v4 Aldehyde dehydrogenase (NAD(+)) (EC 1.2.1.3) 0.98 47 171 GO:0004029
GO:0005737
GO:0006081
AF-A0A6A4RT48-F1-model_v4 Aldehyde dehydrogenase domain-containing protein 0.9792 150 430 GO:0004028
GO:0004029
GO:0005737
GO:0006081
AF-A0A7Y2H0E0-F1-model_v4 Aldehyde dehydrogenase family protein 0.9788 18 413 GO:0004029
GO:0005737
GO:0006081
AF-B7QFL6-F1-model_v4 Aldehyde dehydrogenase, putative (EC 1.2.1.5) 0.977 121 310 GO:0004030
GO:0006081

Feature Viewer

pLDDT pTM Quality
91.94 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map