F339189

General Info

Members Datasets Scaffolds Average Seq Length
226 170 452 210

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0050170|Ga0495630_0050170_2317_3066
Length 249
Sequence LLTSPDFAVRVSIERHTDRRDRVHLSRHLVWRLHDPGACITMTNVNPWDTIHQERAALAADLADLDGARWQTRSACGDWTVQQVLGHMTAAAATTPATWLVRFAGTGFRFNTLISHDIATQTAGGPEQTLARFRAIVDSSGHPPGPVDSWLGETMVHAEDIRRPLGIAHDYPTEPLTRLAGFYAGSNLLIGAKKRVAGLTLRTTDADWSTGSGPEVAGPAIAIVLAMTGRTEAIDELAGDGVDTLRSRA

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
91 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
92 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
164 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
165 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
166 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
167 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
168 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
169 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
170 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.69
Metatranscriptomes 2.21
Isolates 3.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.77
Nodule 0
Rhizoplane 4.87
Rhizosphere 87.61
Stem 0
Stem Tuber 0
Unclassified 3.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_0050170 3300046517 Unclassified 3123
2 JGI24737J22298_10020212 3300001990 Bacteria 2126
3 Ga0058862_11355672 3300004803 Bacteria 1193
4 Ga0070690_100336204 3300005330 Bacteria 1092
5 Ga0070680_100002108 3300005336 Bacteria 14682
6 Ga0070682_100189022 3300005337 Bacteria 1445
7 Ga0070682_100244044 3300005337 Bacteria 1291
8 Ga0070689_100093687 3300005340 Bacteria 2371
9 Ga0070691_10043370 3300005341 Bacteria 2131
10 Ga0070668_100209672 3300005347 Bacteria 1602
11 Ga0070668_100595831 3300005347 Bacteria 966
12 Ga0070671_100394922 3300005355 Bacteria 1183
13 Ga0070688_100051485 3300005365 Bacteria 2569
14 Ga0070659_100046511 3300005366 Bacteria 3401
15 Ga0070659_100924651 3300005366 Bacteria 763
16 Ga0070667_100872134 3300005367 Bacteria 837
17 Ga0070714_100393315 3300005435 Bacteria 1309
18 Ga0070714_100966013 3300005435 Unclassified 828
19 Ga0070700_100000558 3300005441 Bacteria 18695
20 Ga0070708_100007136 3300005445 Bacteria 8915
21 Ga0070663_100276705 3300005455 Bacteria 1336
22 Ga0070678_100465449 3300005456 Bacteria 1110
23 Ga0070681_10000550 3300005458 Bacteria 30983
24 Ga0070706_100265628 3300005467 Bacteria 1601
25 Ga0070706_100283194 3300005467 Bacteria 1547
26 Ga0070706_100309432 3300005467 Bacteria 1474
27 Ga0070707_100461628 3300005468 Bacteria 1231
28 Ga0070698_100301081 3300005471 Bacteria 1534
29 Ga0070679_100000045 3300005530 Bacteria 93900
30 Ga0070679_100492342 3300005530 Bacteria 1170
31 Ga0070684_100113213 3300005535 Bacteria 2435
32 Ga0070684_100158143 3300005535 Bacteria 2055
33 Ga0070684_100613138 3300005535 Bacteria 1012
34 Ga0070684_100642371 3300005535 Bacteria 988
35 Ga0070686_100376389 3300005544 Bacteria 1074
36 Ga0068854_100019908 3300005578 Bacteria 4530
37 Ga0070702_100188352 3300005615 Bacteria 1356
38 Ga0068852_100071676 3300005616 Bacteria 3043
39 Ga0068852_100821937 3300005616 Bacteria 944
40 Ga0068859_100233199 3300005617 Bacteria 1929
41 Ga0068851_10436643 3300005834 Bacteria 776
42 Ga0070717_10057411 3300006028 Bacteria 3217
43 Ga0070717_10122882 3300006028 Bacteria 2226
44 Ga0075365_10039386 3300006038 Bacteria 3077
45 Ga0070716_100026965 3300006173 Bacteria 3081
46 Ga0070712_100709552 3300006175 Bacteria 858
47 Ga0070712_100858178 3300006175 Bacteria 781
48 Ga0097621_100510300 3300006237 Bacteria 1090
49 Ga0075428_100000006 3300006844 Bacteria 288592
50 Ga0097620_100233200 3300006931 Bacteria 1929
51 Ga0075435_100386349 3300007076 Bacteria 1203
52 Ga0111539_10063576 3300009094 Bacteria 4367
53 Ga0105245_11308040 3300009098 Bacteria 774
54 Ga0105243_10000560 3300009148 Bacteria 37602
55 Ga0105243_10004091 3300009148 Bacteria 11610
56 Ga0105242_11017687 3300009176 Bacteria 837
57 Ga0105248_10021175 3300009177 Bacteria 7205
58 Ga0105248_10133139 3300009177 Bacteria 2805
59 Ga0105238_10254752 3300009551 Bacteria 1734
60 Ga0105246_10012870 3300011119 Bacteria 5233
61 Ga0157371_10052918 3300013102 Bacteria 2883
62 Ga0157370_10015605 3300013104 Bacteria 7718
63 Ga0157374_10122256 3300013296 Bacteria 2513
64 Ga0157372_10047434 3300013307 Bacteria 4774
65 Ga0157372_11325863 3300013307 Bacteria 830
66 Ga0163163_10075784 3300014325 Bacteria 3357
67 Ga0157380_10010995 3300014326 Bacteria 6527
68 Ga0182008_10064805 3300014497 Bacteria 1798
69 Ga0197907_10814180 3300020069 Bacteria 1078
70 Ga0206356_11674008 3300020070 Bacteria 941
71 Ga0206354_11072057 3300020081 Bacteria 3321
72 Ga0206353_10572349 3300020082 Bacteria 1668
73 Ga0213876_10170989 3300021384 Bacteria 1156
74 Ga0207643_10001500 3300025908 Bacteria 13363
75 Ga0207705_10174286 3300025909 Bacteria 1620
76 Ga0207684_10287953 3300025910 Bacteria 1417
77 Ga0207707_10000114 3300025912 Bacteria 81766
78 Ga0207707_10532031 3300025912 Bacteria 1000
79 Ga0207660_10002560 3300025917 Bacteria 11947
80 Ga0207652_10000075 3300025921 Bacteria 107831
81 Ga0207646_10559017 3300025922 Bacteria 1028
82 Ga0207694_10381652 3300025924 Bacteria 1170
83 Ga0207700_10163271 3300025928 Bacteria 1852
84 Ga0207690_10018578 3300025932 Bacteria 4265
85 Ga0207709_10000770 3300025935 Bacteria 25211
86 Ga0207691_10014090 3300025940 Bacteria 7628
87 Ga0207661_10035364 3300025944 Bacteria 3892
88 Ga0207661_10136085 3300025944 Bacteria 2110
89 Ga0207668_10208286 3300025972 Bacteria 1562
90 Ga0207677_10381156 3300026023 Bacteria 1190
91 Ga0207678_10449507 3300026067 Bacteria 1120
92 Ga0207708_10001200 3300026075 Bacteria 19550
93 Ga0207676_10116570 3300026095 Bacteria 2245
94 Ga0207675_100005418 3300026118 Bacteria 12223
95 Ga0207698_10031841 3300026142 Bacteria 3812
96 Ga0207698_10906378 3300026142 Bacteria 889
97 Ga0207428_10144500 3300027907 Bacteria 1814
98 Ga0307515_10164070 3300028794 Bacteria 2249
99 Ga0265327_10001602 3300031251 Bacteria 27454
100 Ga0307514_10356847 3300031649 Bacteria 775
101 Ga0307410_10023160 3300031852 Bacteria 3855
102 Ga0307410_10175650 3300031852 Bacteria 1618
103 Ga0307406_10057875 3300031901 Bacteria 2488
104 Ga0307407_10040858 3300031903 Bacteria 2589
105 Ga0307409_100101320 3300031995 Bacteria 2389
106 Ga0307409_101417099 3300031995 Bacteria 721
107 Ga0307414_10070459 3300032004 Bacteria 2518
108 Ga0307411_10089939 3300032005 Bacteria 2140
109 Ga0307415_100402467 3300032126 Bacteria 1169
110 Ga0307415_100476743 3300032126 Bacteria 1085
111 Ga0373923_0168158 3300035111 Bacteria 1003
112 Ga0373939_0188816 3300035114 Bacteria 773
113 Ga0373953_0029103 3300035117 Bacteria 2135
114 Ga0373957_0130164 3300035120 Bacteria 1024
115 Ga0373943_0017467 3300035170 Bacteria 3283
116 Ga0373943_0027357 3300035170 Bacteria 2679
117 Ga0373946_0310438 3300035171 Bacteria 782
118 Ga0373955_0012348 3300035172 Bacteria 4106
119 Ga0373933_0020822 3300035724 Bacteria 3719
120 Ga0373933_0149645 3300035724 Bacteria 1478
121 Ga0373947_0083781 3300035725 Bacteria 1978
122 Ga0373947_0100933 3300035725 Bacteria 1814
123 Ga0373937_0012999 3300036401 Bacteria 7331
124 Ga0373937_0717353 3300036401 Bacteria 947
125 Ga0373925_0000594 3300037068 Bacteria 34840
126 Ga0373925_0030477 3300037068 Bacteria 3960
127 Ga0373925_0115618 3300037068 Bacteria 2077
128 Ga0373925_0751391 3300037068 Bacteria 804
129 Ga0395899_0225792 3300037312 Bacteria 1295
130 Ga0395898_0007698 3300037466 Bacteria 11437
131 Ga0395898_0338115 3300037466 Bacteria 1436
132 Ga0436364_0137829 3300037853 Bacteria 2363
133 Ga0436364_1016610 3300037853 Unclassified 1025
134 Ga0436364_1041488 3300037853 Bacteria 17558
135 Ga0436364_1299779 3300037853 Bacteria 159755
136 Ga0395901_0018966 3300038443 Bacteria 7033
137 Ga0395901_0546978 3300038443 Bacteria 1174
138 Ga0436365_1185618 3300039437 Bacteria 39779
139 Ga0436365_1546892 3300039437 Bacteria 50890
140 Ga0436365_1900611 3300039437 Bacteria 3081
141 Ga0436363_0994669 3300039450 Bacteria 2848
142 Ga0436363_1712299 3300039450 Bacteria 1585
143 Ga0436362_0045169 3300039453 Bacteria 2039
144 Ga0466965_0146547 3300044683 Bacteria 1232
145 Ga0466966_0048451 3300044684 Bacteria 2707
146 Ga0466961_0023098 3300044693 Bacteria 3999
147 Ga0466963_0120168 3300044694 Bacteria 1807
148 Ga0466964_0048688 3300044706 Bacteria 1734
149 Ga0466971_0038901 3300044719 Bacteria 2135
150 Ga0466957_0488250 3300044842 Bacteria 853
151 Ga0466957_0581438 3300044842 Bacteria 783
152 Ga0466960_0074338 3300044901 Bacteria 1698
153 Ga0466960_0107539 3300044901 Bacteria 1445
154 Ga0466960_0152878 3300044901 Bacteria 1234
155 Ga0466959_0078130 3300045049 Bacteria 2387
156 Ga0466958_0262687 3300045836 Bacteria 1105
157 Ga0466967_0001693 3300045976 Bacteria 13110
158 Ga0466967_0054031 3300045976 Bacteria 3533
159 Ga0466967_0142981 3300045976 Unclassified 2230
160 Ga0466967_0255740 3300045976 Bacteria 1674
161 Ga0466967_0493044 3300045976 Bacteria 1201
162 Ga0495592_0074748 3300046454 Bacteria 2461
163 Ga0495651_0001132 3300046462 Bacteria 20594
164 Ga0495651_0197687 3300046462 Bacteria 1410
165 Ga0495653_0001792 3300046463 Bacteria 16932
166 Ga0495653_0112809 3300046463 Bacteria 1951
167 Ga0495580_0202633 3300046472 Bacteria 1367
168 Ga0495664_0049930 3300046477 Bacteria 2483
169 Ga0495608_0002326 3300046511 Bacteria 13719
170 Ga0495608_0161177 3300046511 Bacteria 1426
171 Ga0495618_0017466 3300046514 Bacteria 4400
172 Ga0495618_0090484 3300046514 Bacteria 1957
173 Ga0495628_0015409 3300046516 Bacteria 6382
174 Ga0495630_0041356 3300046517 Bacteria 3442
175 Ga0495652_0002744 3300046529 Bacteria 17808
176 Ga0495640_0052699 3300046533 Bacteria 2792
177 Ga0495587_0001328 3300046536 Bacteria 16435
178 Ga0495645_0160737 3300046543 Bacteria 1553
179 Ga0495667_0017354 3300046559 Bacteria 4862
180 Ga0495634_0251964 3300046642 Bacteria 1080
181 Ga0495635_0052810 3300046663 Bacteria 2799
182 Ga0495635_0054404 3300046663 Bacteria 2757
183 Ga0495657_0012695 3300046675 Bacteria 6245
184 Ga0495599_0013392 3300046678 Bacteria 5068
185 Ga0495623_0020807 3300046679 Bacteria 4240
186 Ga0495646_0027239 3300046680 Bacteria 3586
187 Ga0495646_0346262 3300046680 Bacteria 779
188 Ga0495624_0120829 3300046690 Bacteria 1609
189 Ga0495600_0013272 3300046809 Bacteria 5172
190 Ga0495581_0022102 3300047315 Bacteria 3686
191 Ga0495604_0006350 3300047317 Bacteria 9372
192 Ga0495674_0009814 3300047319 Bacteria 9087
193 Ga0495674_0010237 3300047319 Bacteria 8879
194 Ga0495672_0161294 3300047320 Unclassified 1153
195 Ga0495675_0224486 3300047444 Bacteria 1135
196 Ga0495684_0004253 3300047471 Bacteria 11175
197 Ga0495684_0239349 3300047471 Bacteria 1325
198 Ga0495602_0003002 3300048088 Bacteria 17306
199 Ga0496104_0277568 3300048907 Bacteria 1589
200 Ga0496108_0502606 3300048911 Bacteria 1059
201 Ga0496109_0274870 3300048912 Bacteria 1587
202 Ga0496109_0494018 3300048912 Bacteria 1155
203 Ga0496110_0051875 3300048913 Bacteria 3605
204 Ga0496110_0092047 3300048913 Bacteria 2713
205 Ga0496111_0182502 3300048914 Bacteria 1560
206 Ga0496111_0461335 3300048914 Bacteria 937
207 Ga0496112_0055323 3300048915 Bacteria 3901
208 Ga0496113_0027231 3300048916 Bacteria 4096
209 Ga0496114_0313231 3300048917 Bacteria 1386
210 Ga0501034_0667699 3300049571 Bacteria 940
211 nmdc:mga0yw44_9805_c1 3300050492 Bacteria 4864
212 nmdc:mga08y16_29546_c1 3300050511 Bacteria 5774
213 Ga0495601_0037548 3300053077 Bacteria 3029
214 Ga0500635_0042166 3300053080 Unclassified 1529
215 Ga0495595_0181553 3300053084 Bacteria 1044
216 Ga0495619_0056847 3300053085 Bacteria 2595
217 Ga0500620_010466 3300053155 Unclassified 2444
218 Ga0466962_0021765 3300061719 Bacteria 3078
219 Ga0530510_0022096 3300061734 Bacteria 4530
220 2739239133 2738543011 Bacteria 5731169
221 2810364365 2808606700 Bacteria 3482157
222 2819742821 2818991472 Bacteria 10089953
223 2889304087 2889300758 Bacteria 5690814
224 2905927913 2905926851 Bacteria 4423176
225 2939745519 2939743619 Bacteria 5762299
226 2946005512 2946003308 Bacteria 3857229
227 Ga0495630_0050170
228 JGI24737J22298_10020212
229 Ga0058862_11355672
230 Ga0070690_100336204
231 Ga0070680_100002108
232 Ga0070682_100189022
233 Ga0070682_100244044
234 Ga0070689_100093687
235 Ga0070691_10043370
236 Ga0070668_100209672
237 Ga0070668_100595831
238 Ga0070671_100394922
239 Ga0070688_100051485
240 Ga0070659_100046511
241 Ga0070659_100924651
242 Ga0070667_100872134
243 Ga0070714_100393315
244 Ga0070714_100966013
245 Ga0070700_100000558
246 Ga0070708_100007136
247 Ga0070663_100276705
248 Ga0070678_100465449
249 Ga0070681_10000550
250 Ga0070706_100265628
251 Ga0070706_100283194
252 Ga0070706_100309432
253 Ga0070707_100461628
254 Ga0070698_100301081
255 Ga0070679_100000045
256 Ga0070679_100492342
257 Ga0070684_100113213
258 Ga0070684_100158143
259 Ga0070684_100613138
260 Ga0070684_100642371
261 Ga0070686_100376389
262 Ga0068854_100019908
263 Ga0070702_100188352
264 Ga0068852_100071676
265 Ga0068852_100821937
266 Ga0068859_100233199
267 Ga0068851_10436643
268 Ga0070717_10057411
269 Ga0070717_10122882
270 Ga0075365_10039386
271 Ga0070716_100026965
272 Ga0070712_100709552
273 Ga0070712_100858178
274 Ga0097621_100510300
275 Ga0075428_100000006
276 Ga0097620_100233200
277 Ga0075435_100386349
278 Ga0111539_10063576
279 Ga0105245_11308040
280 Ga0105243_10000560
281 Ga0105243_10004091
282 Ga0105242_11017687
283 Ga0105248_10021175
284 Ga0105248_10133139
285 Ga0105238_10254752
286 Ga0105246_10012870
287 Ga0157371_10052918
288 Ga0157370_10015605
289 Ga0157374_10122256
290 Ga0157372_10047434
291 Ga0157372_11325863
292 Ga0163163_10075784
293 Ga0157380_10010995
294 Ga0182008_10064805
295 Ga0197907_10814180
296 Ga0206356_11674008
297 Ga0206354_11072057
298 Ga0206353_10572349
299 Ga0213876_10170989
300 Ga0207643_10001500
301 Ga0207705_10174286
302 Ga0207684_10287953
303 Ga0207707_10000114
304 Ga0207707_10532031
305 Ga0207660_10002560
306 Ga0207652_10000075
307 Ga0207646_10559017
308 Ga0207694_10381652
309 Ga0207700_10163271
310 Ga0207690_10018578
311 Ga0207709_10000770
312 Ga0207691_10014090
313 Ga0207661_10035364
314 Ga0207661_10136085
315 Ga0207668_10208286
316 Ga0207677_10381156
317 Ga0207678_10449507
318 Ga0207708_10001200
319 Ga0207676_10116570
320 Ga0207675_100005418
321 Ga0207698_10031841
322 Ga0207698_10906378
323 Ga0207428_10144500
324 Ga0307515_10164070
325 Ga0265327_10001602
326 Ga0307514_10356847
327 Ga0307410_10023160
328 Ga0307410_10175650
329 Ga0307406_10057875
330 Ga0307407_10040858
331 Ga0307409_100101320
332 Ga0307409_101417099
333 Ga0307414_10070459
334 Ga0307411_10089939
335 Ga0307415_100402467
336 Ga0307415_100476743
337 Ga0373923_0168158
338 Ga0373939_0188816
339 Ga0373953_0029103
340 Ga0373957_0130164
341 Ga0373943_0017467
342 Ga0373943_0027357
343 Ga0373946_0310438
344 Ga0373955_0012348
345 Ga0373933_0020822
346 Ga0373933_0149645
347 Ga0373947_0083781
348 Ga0373947_0100933
349 Ga0373937_0012999
350 Ga0373937_0717353
351 Ga0373925_0000594
352 Ga0373925_0030477
353 Ga0373925_0115618
354 Ga0373925_0751391
355 Ga0395899_0225792
356 Ga0395898_0007698
357 Ga0395898_0338115
358 Ga0436364_0137829
359 Ga0436364_1016610
360 Ga0436364_1041488
361 Ga0436364_1299779
362 Ga0395901_0018966
363 Ga0395901_0546978
364 Ga0436365_1185618
365 Ga0436365_1546892
366 Ga0436365_1900611
367 Ga0436363_0994669
368 Ga0436363_1712299
369 Ga0436362_0045169
370 Ga0466965_0146547
371 Ga0466966_0048451
372 Ga0466961_0023098
373 Ga0466963_0120168
374 Ga0466964_0048688
375 Ga0466971_0038901
376 Ga0466957_0488250
377 Ga0466957_0581438
378 Ga0466960_0074338
379 Ga0466960_0107539
380 Ga0466960_0152878
381 Ga0466959_0078130
382 Ga0466958_0262687
383 Ga0466967_0001693
384 Ga0466967_0054031
385 Ga0466967_0142981
386 Ga0466967_0255740
387 Ga0466967_0493044
388 Ga0495592_0074748
389 Ga0495651_0001132
390 Ga0495651_0197687
391 Ga0495653_0001792
392 Ga0495653_0112809
393 Ga0495580_0202633
394 Ga0495664_0049930
395 Ga0495608_0002326
396 Ga0495608_0161177
397 Ga0495618_0017466
398 Ga0495618_0090484
399 Ga0495628_0015409
400 Ga0495630_0041356
401 Ga0495652_0002744
402 Ga0495640_0052699
403 Ga0495587_0001328
404 Ga0495645_0160737
405 Ga0495667_0017354
406 Ga0495634_0251964
407 Ga0495635_0052810
408 Ga0495635_0054404
409 Ga0495657_0012695
410 Ga0495599_0013392
411 Ga0495623_0020807
412 Ga0495646_0027239
413 Ga0495646_0346262
414 Ga0495624_0120829
415 Ga0495600_0013272
416 Ga0495581_0022102
417 Ga0495604_0006350
418 Ga0495674_0009814
419 Ga0495674_0010237
420 Ga0495672_0161294
421 Ga0495675_0224486
422 Ga0495684_0004253
423 Ga0495684_0239349
424 Ga0495602_0003002
425 Ga0496104_0277568
426 Ga0496108_0502606
427 Ga0496109_0274870
428 Ga0496109_0494018
429 Ga0496110_0051875
430 Ga0496110_0092047
431 Ga0496111_0182502
432 Ga0496111_0461335
433 Ga0496112_0055323
434 Ga0496113_0027231
435 Ga0496114_0313231
436 Ga0501034_0667699
437 nmdc:mga0yw44_9805_c1
438 nmdc:mga08y16_29546_c1
439 Ga0495601_0037548
440 Ga0500635_0042166
441 Ga0495595_0181553
442 Ga0495619_0056847
443 Ga0500620_010466
444 Ga0466962_0021765
445 Ga0530510_0022096
446 2739239133
447 2810364365
448 2819742821
449 2889304087
450 2905927913
451 2939745519
452 2946005512

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11716

MDMPI_N

Mycothiol maleylpyruvate isomerase N-terminal domain

51

142

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nsg-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant 0.6679 10 203
2nsf-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase 0.6553 10 203
2nsg-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant 0.6173 10 203
5cog-assembly1.cif.gz_A crystal structure of yeast irc4 0.6155 10 133
2nsf-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase 0.6047 10 203
ID Description Score Start End Superfamily
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7258 10 128 1.20.120.450
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6943 15 127 1.20.120.450
af_P95285_1_214_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6685 6 211 1.20.120.450
af_P95285_1_214_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6493 6 211 1.20.120.450
5civA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6479 10 99 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7G9RHY6-F1-model_v4 Uncharacterized protein 0.9935 156 211
AF-A0A561EP16-F1-model_v4 Uncharacterized protein (TIGR03083 family) 0.9883 8 208 GO:0046872
AF-A0A1I2H1X3-F1-model_v4 Uncharacterized protein 0.9873 110 211
AF-A0A269Z4D1-F1-model_v4 Mycothiol-dependent maleylpyruvate isomerase metal-binding domain-containing protein 0.9869 10 211 GO:0046872
AF-A0A1X7MTJ6-F1-model_v4 TIGR03083 family protein 0.9866 10 209 GO:0046872

Map