F339153

General Info

Members Datasets Scaffolds Average Seq Length
226 145 452 290

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0049395|Ga0466967_0049395_2047_3075
Length 342
Sequence LGALSYRRKLPTIKGVPACAPAKQNMLEVNLRLVREGQQYDTVSMTQFDLRSQDCVQGMKRLVEESIDLVVTSPPYNLGVRYGKYSDRQNRDSYLDWCRQWAEQICRLLKSNASFFLNIGGAPSNPMLPHEIVMVLREFFVLQNTIHWIKSIAIDIVEAETDNAYPNPLPRQGEADAKRRVRVEPGFKTFGHFKPINSPRFLNDCHEYVFHFTKSGRVELKRLALGVPYQDKSNIARWSHTGGNDVRCRGNTWFVPYQTIQSRDKERPHPATFPVQLAEWCIKLHGASSVGTMLDPFLGIGNSAIAAQRCDIERFIGFEIDEAYLAEAKRRIANARRSARRK

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 11.06
Rhizosphere 88.05
Stem 0
Stem Tuber 0
Unclassified 13.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0049395 3300045976 Unclassified 3679
2 Ga0065704_10131522 3300005289 Bacteria 1623
3 Ga0065715_10129747 3300005293 Unclassified 2040
4 Ga0065715_10171635 3300005293 Bacteria 1533
5 Ga0065707_10004203 3300005295 Unclassified 4101
6 Ga0065707_10008818 3300005295 Bacteria 2263
7 Ga0070658_10435326 3300005327 Bacteria 1129
8 Ga0070676_10095569 3300005328 Bacteria 1827
9 Ga0070683_100106281 3300005329 Bacteria 2646
10 Ga0070683_100269935 3300005329 Viruses 1618
11 Ga0070690_100115151 3300005330 Bacteria 1798
12 Ga0070670_100031237 3300005331 Bacteria 4586
13 Ga0070670_100057377 3300005331 Unclassified 3342
14 Ga0070670_100114114 3300005331 Bacteria 2329
15 Ga0068869_100157859 3300005334 Bacteria 1764
16 Ga0070666_10066576 3300005335 Bacteria 2445
17 Ga0070666_10124351 3300005335 Bacteria 1790
18 Ga0068868_100086469 3300005338 Bacteria 2520
19 Ga0068868_100121147 3300005338 Bacteria 2134
20 Ga0068868_100219820 3300005338 Bacteria 1590
21 Ga0070689_100193010 3300005340 Bacteria 1659
22 Ga0070687_100196268 3300005343 Bacteria 1220
23 Ga0070661_100125672 3300005344 Bacteria 1924
24 Ga0070669_100107509 3300005353 Bacteria 2113
25 Ga0070675_100265011 3300005354 Unclassified 1506
26 Ga0070671_100022153 3300005355 Bacteria 5190
27 Ga0070671_100076758 3300005355 Bacteria 2791
28 Ga0070674_100005164 3300005356 Bacteria 7511
29 Ga0070674_100140793 3300005356 Bacteria 1810
30 Ga0070673_100084147 3300005364 Bacteria 2586
31 Ga0070673_100137366 3300005364 Bacteria 2059
32 Ga0070688_100037768 3300005365 Bacteria 2945
33 Ga0070659_100141995 3300005366 Bacteria 1955
34 Ga0070667_100113833 3300005367 Bacteria 2348
35 Ga0070709_10046272 3300005434 Bacteria 2704
36 Ga0070709_10100329 3300005434 Bacteria 1927
37 Ga0070713_100134721 3300005436 Bacteria 2182
38 Ga0070663_100123423 3300005455 Unclassified 1959
39 Ga0070681_10095815 3300005458 Bacteria 2916
40 Ga0068867_100329885 3300005459 Bacteria 1267
41 Ga0070698_100162892 3300005471 Bacteria 2174
42 Ga0070679_100017154 3300005530 Archaea 7002
43 Ga0070672_100336233 3300005543 Bacteria 1285
44 Ga0070695_100370646 3300005545 Bacteria 1078
45 Ga0070665_100147947 3300005548 Bacteria 2351
46 Ga0070665_100228179 3300005548 Bacteria 1862
47 Ga0070704_100283720 3300005549 Bacteria 1373
48 Ga0068855_100013769 3300005563 Bacteria 9750
49 Ga0070664_100135173 3300005564 Bacteria 2168
50 Ga0068857_100016577 3300005577 Bacteria 6455
51 Ga0068859_100034456 3300005617 Bacteria 5082
52 Ga0068859_100105364 3300005617 Archaea 2879
53 Ga0068859_100201840 3300005617 Bacteria 2073
54 Ga0068864_100112899 3300005618 Bacteria 2422
55 Ga0068858_100002397 3300005842 Bacteria 18968
56 Ga0068858_100068650 3300005842 Bacteria 3285
57 Ga0068860_100439448 3300005843 Bacteria 1296
58 Ga0068860_100646054 3300005843 Bacteria 1066
59 Ga0081455_10001685 3300005937 Bacteria 26794
60 Ga0081455_10002871 3300005937 Bacteria 20284
61 Ga0075364_10009030 3300006051 Bacteria 5971
62 Ga0070716_100143005 3300006173 Bacteria 1528
63 Ga0070712_100005358 3300006175 Bacteria 7941
64 Ga0097621_100086704 3300006237 Bacteria 2613
65 Ga0097621_100127690 3300006237 Bacteria 2161
66 Ga0068871_100168045 3300006358 Bacteria 1879
67 Ga0068871_100172130 3300006358 Bacteria 1857
68 Ga0075428_100150525 3300006844 Bacteria 2528
69 Ga0075434_100647311 3300006871 Unclassified 1075
70 Ga0075429_100271243 3300006880 Bacteria 1486
71 Ga0068865_100115449 3300006881 Bacteria 1987
72 Ga0068865_100370556 3300006881 Bacteria 1165
73 Ga0075436_100034176 3300006914 Bacteria 3506
74 Ga0097620_100034454 3300006931 Bacteria 5082
75 Ga0097620_100105369 3300006931 Archaea 2879
76 Ga0097620_100201848 3300006931 Bacteria 2073
77 Ga0075435_100193516 3300007076 Bacteria 1722
78 Ga0111539_10062999 3300009094 Bacteria 4388
79 Ga0111539_10266584 3300009094 Bacteria 1994
80 Ga0114129_10061208 3300009147 Bacteria 5261
81 Ga0114129_10222844 3300009147 Bacteria 2543
82 Ga0114129_10320146 3300009147 Bacteria 2062
83 Ga0114129_11148876 3300009147 Unclassified 970
84 Ga0105242_10031224 3300009176 Bacteria 4252
85 Ga0105242_10748347 3300009176 Bacteria 962
86 Ga0105248_10141892 3300009177 Bacteria 2710
87 Ga0105248_10177548 3300009177 Bacteria 2400
88 Ga0105248_10253185 3300009177 Bacteria 1982
89 Ga0105239_10109603 3300010375 Bacteria 3060
90 Ga0105239_10245174 3300010375 Bacteria 2011
91 Ga0157371_10195047 3300013102 Unclassified 1451
92 Ga0157369_10193987 3300013105 Bacteria 2133
93 Ga0157374_10025941 3300013296 Bacteria 5269
94 Ga0157374_10093816 3300013296 Bacteria 2867
95 Ga0157374_10276021 3300013296 Bacteria 1658
96 Ga0157374_10362986 3300013296 Unclassified 1440
97 Ga0157378_10162369 3300013297 Unclassified 2090
98 Ga0157378_10168885 3300013297 Bacteria 2050
99 Ga0157378_10211118 3300013297 Bacteria 1841
100 Ga0157378_10245928 3300013297 Unclassified 1711
101 Ga0157378_10331236 3300013297 Bacteria 1482
102 Ga0157372_10047136 3300013307 Archaea 4787
103 Ga0157372_10145815 3300013307 Bacteria 2730
104 Ga0157375_10003023 3300013308 Bacteria 14591
105 Ga0157375_10059386 3300013308 Bacteria 3789
106 Ga0157375_10089290 3300013308 Bacteria 3138
107 Ga0157375_10257751 3300013308 Bacteria 1905
108 Ga0163163_10113188 3300014325 Bacteria 2743
109 Ga0157376_10029102 3300014969 Bacteria 4399
110 Ga0157376_10226807 3300014969 Bacteria 1733
111 Ga0157376_10279760 3300014969 Bacteria 1571
112 Ga0182005_1020718 3300015265 Bacteria 1807
113 Ga0163161_10006082 3300017792 Bacteria 8361
114 Ga0207666_1005717 3300025271 Archaea 1594
115 Ga0207673_1005040 3300025290 Bacteria 1600
116 Ga0207697_10016481 3300025315 Bacteria 3044
117 Ga0207693_10022635 3300025915 Bacteria 4992
118 Ga0207649_10115209 3300025920 Bacteria 1803
119 Ga0207649_10144942 3300025920 Bacteria 1629
120 Ga0207652_10154763 3300025921 Bacteria 2053
121 Ga0207681_10115834 3300025923 Bacteria 1957
122 Ga0207681_10139443 3300025923 Bacteria 1804
123 Ga0207650_10053608 3300025925 Bacteria 2990
124 Ga0207650_10074460 3300025925 Bacteria 2559
125 Ga0207650_10146566 3300025925 Unclassified 1860
126 Ga0207659_10314843 3300025926 Bacteria 1289
127 Ga0207687_10039394 3300025927 Bacteria 3235
128 Ga0207700_10341489 3300025928 Bacteria 1302
129 Ga0207644_10062386 3300025931 Bacteria 2703
130 Ga0207644_10078688 3300025931 Bacteria 2431
131 Ga0207644_10180455 3300025931 Bacteria 1654
132 Ga0207669_10044912 3300025937 Unclassified 2600
133 Ga0207669_10213477 3300025937 Bacteria 1411
134 Ga0207704_10086668 3300025938 Bacteria 2043
135 Ga0207704_10103468 3300025938 Unclassified 1905
136 Ga0207665_10025219 3300025939 Unclassified 3921
137 Ga0207711_10149341 3300025941 Bacteria 2108
138 Ga0207711_10509021 3300025941 Bacteria 1122
139 Ga0207689_10209497 3300025942 Bacteria 1610
140 Ga0207661_10128087 3300025944 Bacteria 2170
141 Ga0207661_10246360 3300025944 Archaea 1587
142 Ga0207679_10113675 3300025945 Unclassified 2142
143 Ga0207679_10130570 3300025945 Bacteria 2015
144 Ga0207667_10002925 3300025949 Bacteria 21206
145 Ga0207651_10108121 3300025960 Bacteria 2081
146 Ga0207651_10364501 3300025960 Bacteria 1221
147 Ga0207640_10178905 3300025981 Archaea 1588
148 Ga0207658_10098358 3300025986 Bacteria 2286
149 Ga0207677_10156393 3300026023 Bacteria 1766
150 Ga0207677_10209746 3300026023 Unclassified 1555
151 Ga0207703_10001700 3300026035 Bacteria 19783
152 Ga0207703_10254765 3300026035 Bacteria 1584
153 Ga0207678_10145691 3300026067 Bacteria 2021
154 Ga0207708_10043723 3300026075 Bacteria 3414
155 Ga0207702_10070705 3300026078 Bacteria 3002
156 Ga0207648_10100993 3300026089 Bacteria 2528
157 Ga0207676_10042087 3300026095 Bacteria 3512
158 Ga0207674_10147099 3300026116 Unclassified 2314
159 Ga0207683_10009610 3300026121 Bacteria 8243
160 Ga0207683_10115239 3300026121 Bacteria 2409
161 Ga0209971_1004699 3300027682 Bacteria 3240
162 Ga0207428_10006144 3300027907 Bacteria 11092
163 Ga0207428_10388950 3300027907 Bacteria 1022
164 Ga0268266_10046382 3300028379 Bacteria 3721
165 Ga0268266_10057240 3300028379 Bacteria 3354
166 Ga0265314_10067681 3300031711 Bacteria 2404
167 Ga0307405_10048718 3300031731 Unclassified 2615
168 Ga0307410_10122903 3300031852 Unclassified 1896
169 Ga0307409_100050864 3300031995 Unclassified 3168
170 Ga0307411_10094371 3300032005 Unclassified 2097
171 Ga0373944_0023680 3300035089 Bacteria 1794
172 Ga0373943_0007720 3300035170 Bacteria 4831
173 Ga0373927_0097774 3300035695 Bacteria 1908
174 Ga0373947_0057682 3300035725 Bacteria 2350
175 Ga0373925_0113986 3300037068 Bacteria 2091
176 Ga0395900_0073167 3300037418 Bacteria 3523
177 Ga0395901_0048490 3300038443 Bacteria 4411
178 Ga0495592_0089675 3300046454 Unclassified 2208
179 Ga0495635_0320269 3300046663 Archaea 1038
180 Ga0495658_0011462 3300046683 Bacteria 4461
181 Ga0495669_0034850 3300046684 Bacteria 2219
182 Ga0496100_0251665 3300048903 Bacteria 1307
183 Ga0496104_0041339 3300048907 Archaea 4323
184 Ga0496104_0055170 3300048907 Unclassified 3757
185 Ga0496106_0073075 3300048909 Bacteria 2623
186 Ga0496106_0344987 3300048909 Bacteria 1196
187 Ga0496107_0049129 3300048910 Unclassified 3040
188 Ga0496107_0107516 3300048910 Bacteria 2049
189 Ga0496108_0017561 3300048911 Bacteria 5854
190 Ga0496108_0066564 3300048911 Bacteria 3038
191 Ga0496108_0070310 3300048911 Bacteria 2954
192 Ga0496108_0110683 3300048911 Bacteria 2348
193 Ga0496109_0082616 3300048912 Bacteria 2961
194 Ga0496109_0245687 3300048912 Bacteria 1685
195 Ga0496109_0353208 3300048912 Bacteria 1389
196 Ga0496110_0070223 3300048913 Unclassified 3103
197 Ga0496110_0115437 3300048913 Bacteria 2417
198 Ga0496112_0056066 3300048915 Bacteria 3877
199 Ga0496112_0066129 3300048915 Bacteria 3567
200 Ga0496112_0077413 3300048915 Bacteria 3289
201 Ga0496112_0559455 3300048915 Unclassified 1077
202 Ga0496114_0002824 3300048917 Bacteria 13311
203 Ga0496114_0019770 3300048917 Bacteria 5459
204 Ga0496115_0036777 3300048918 Unclassified 3877
205 Ga0496115_0283884 3300048918 Unclassified 1359
206 Ga0496115_0599043 3300048918 Bacteria 876
207 Ga0501034_0010987 3300049571 Bacteria 9399
208 Ga0501034_0014418 3300049571 Bacteria 8141
209 Ga0501036_0106761 3300049572 Unclassified 2368
210 Ga0501037_0257237 3300049573 Bacteria 1220
211 Ga0501048_0026562 3300049582 Bacteria 4216
212 Ga0501071_0044167 3300049587 Bacteria 3196
213 Ga0501074_0202205 3300049590 Bacteria 1416
214 nmdc:mga05p37_284068_c1 3300050507 Bacteria 1972
215 nmdc:mga09592_202051_c1 3300050508 Bacteria 1721
216 nmdc:mga06r32_264758_c1 3300050510 Bacteria 1706
217 nmdc:mga06r32_98355_c1 3300050510 Bacteria 2868
218 nmdc:mga08y16_142890_c1 3300050511 Bacteria 2488
219 nmdc:mga08y16_31152_c1 3300050511 Bacteria 5612
220 nmdc:mga08y16_781942_c1 3300050511 Viruses 949
221 nmdc:mga0n895_84970_c1 3300050512 Bacteria 3158
222 nmdc:mga0rr50_121396_c1 3300050513 Bacteria 2080
223 nmdc:mga0rr50_711136_c1 3300050513 Bacteria 857
224 nmdc:mga0a205_153746_c1 3300050515 Bacteria 2199
225 Ga0500646_0027491 3300053090 Archaea 1548
226 Ga0501082_0081941 3300060353 Bacteria 2784
227 Ga0466967_0049395
228 Ga0065704_10131522
229 Ga0065715_10129747
230 Ga0065715_10171635
231 Ga0065707_10004203
232 Ga0065707_10008818
233 Ga0070658_10435326
234 Ga0070676_10095569
235 Ga0070683_100106281
236 Ga0070683_100269935
237 Ga0070690_100115151
238 Ga0070670_100031237
239 Ga0070670_100057377
240 Ga0070670_100114114
241 Ga0068869_100157859
242 Ga0070666_10066576
243 Ga0070666_10124351
244 Ga0068868_100086469
245 Ga0068868_100121147
246 Ga0068868_100219820
247 Ga0070689_100193010
248 Ga0070687_100196268
249 Ga0070661_100125672
250 Ga0070669_100107509
251 Ga0070675_100265011
252 Ga0070671_100022153
253 Ga0070671_100076758
254 Ga0070674_100005164
255 Ga0070674_100140793
256 Ga0070673_100084147
257 Ga0070673_100137366
258 Ga0070688_100037768
259 Ga0070659_100141995
260 Ga0070667_100113833
261 Ga0070709_10046272
262 Ga0070709_10100329
263 Ga0070713_100134721
264 Ga0070663_100123423
265 Ga0070681_10095815
266 Ga0068867_100329885
267 Ga0070698_100162892
268 Ga0070679_100017154
269 Ga0070672_100336233
270 Ga0070695_100370646
271 Ga0070665_100147947
272 Ga0070665_100228179
273 Ga0070704_100283720
274 Ga0068855_100013769
275 Ga0070664_100135173
276 Ga0068857_100016577
277 Ga0068859_100034456
278 Ga0068859_100105364
279 Ga0068859_100201840
280 Ga0068864_100112899
281 Ga0068858_100002397
282 Ga0068858_100068650
283 Ga0068860_100439448
284 Ga0068860_100646054
285 Ga0081455_10001685
286 Ga0081455_10002871
287 Ga0075364_10009030
288 Ga0070716_100143005
289 Ga0070712_100005358
290 Ga0097621_100086704
291 Ga0097621_100127690
292 Ga0068871_100168045
293 Ga0068871_100172130
294 Ga0075428_100150525
295 Ga0075434_100647311
296 Ga0075429_100271243
297 Ga0068865_100115449
298 Ga0068865_100370556
299 Ga0075436_100034176
300 Ga0097620_100034454
301 Ga0097620_100105369
302 Ga0097620_100201848
303 Ga0075435_100193516
304 Ga0111539_10062999
305 Ga0111539_10266584
306 Ga0114129_10061208
307 Ga0114129_10222844
308 Ga0114129_10320146
309 Ga0114129_11148876
310 Ga0105242_10031224
311 Ga0105242_10748347
312 Ga0105248_10141892
313 Ga0105248_10177548
314 Ga0105248_10253185
315 Ga0105239_10109603
316 Ga0105239_10245174
317 Ga0157371_10195047
318 Ga0157369_10193987
319 Ga0157374_10025941
320 Ga0157374_10093816
321 Ga0157374_10276021
322 Ga0157374_10362986
323 Ga0157378_10162369
324 Ga0157378_10168885
325 Ga0157378_10211118
326 Ga0157378_10245928
327 Ga0157378_10331236
328 Ga0157372_10047136
329 Ga0157372_10145815
330 Ga0157375_10003023
331 Ga0157375_10059386
332 Ga0157375_10089290
333 Ga0157375_10257751
334 Ga0163163_10113188
335 Ga0157376_10029102
336 Ga0157376_10226807
337 Ga0157376_10279760
338 Ga0182005_1020718
339 Ga0163161_10006082
340 Ga0207666_1005717
341 Ga0207673_1005040
342 Ga0207697_10016481
343 Ga0207693_10022635
344 Ga0207649_10115209
345 Ga0207649_10144942
346 Ga0207652_10154763
347 Ga0207681_10115834
348 Ga0207681_10139443
349 Ga0207650_10053608
350 Ga0207650_10074460
351 Ga0207650_10146566
352 Ga0207659_10314843
353 Ga0207687_10039394
354 Ga0207700_10341489
355 Ga0207644_10062386
356 Ga0207644_10078688
357 Ga0207644_10180455
358 Ga0207669_10044912
359 Ga0207669_10213477
360 Ga0207704_10086668
361 Ga0207704_10103468
362 Ga0207665_10025219
363 Ga0207711_10149341
364 Ga0207711_10509021
365 Ga0207689_10209497
366 Ga0207661_10128087
367 Ga0207661_10246360
368 Ga0207679_10113675
369 Ga0207679_10130570
370 Ga0207667_10002925
371 Ga0207651_10108121
372 Ga0207651_10364501
373 Ga0207640_10178905
374 Ga0207658_10098358
375 Ga0207677_10156393
376 Ga0207677_10209746
377 Ga0207703_10001700
378 Ga0207703_10254765
379 Ga0207678_10145691
380 Ga0207708_10043723
381 Ga0207702_10070705
382 Ga0207648_10100993
383 Ga0207676_10042087
384 Ga0207674_10147099
385 Ga0207683_10009610
386 Ga0207683_10115239
387 Ga0209971_1004699
388 Ga0207428_10006144
389 Ga0207428_10388950
390 Ga0268266_10046382
391 Ga0268266_10057240
392 Ga0265314_10067681
393 Ga0307405_10048718
394 Ga0307410_10122903
395 Ga0307409_100050864
396 Ga0307411_10094371
397 Ga0373944_0023680
398 Ga0373943_0007720
399 Ga0373927_0097774
400 Ga0373947_0057682
401 Ga0373925_0113986
402 Ga0395900_0073167
403 Ga0395901_0048490
404 Ga0495592_0089675
405 Ga0495635_0320269
406 Ga0495658_0011462
407 Ga0495669_0034850
408 Ga0496100_0251665
409 Ga0496104_0041339
410 Ga0496104_0055170
411 Ga0496106_0073075
412 Ga0496106_0344987
413 Ga0496107_0049129
414 Ga0496107_0107516
415 Ga0496108_0017561
416 Ga0496108_0066564
417 Ga0496108_0070310
418 Ga0496108_0110683
419 Ga0496109_0082616
420 Ga0496109_0245687
421 Ga0496109_0353208
422 Ga0496110_0070223
423 Ga0496110_0115437
424 Ga0496112_0056066
425 Ga0496112_0066129
426 Ga0496112_0077413
427 Ga0496112_0559455
428 Ga0496114_0002824
429 Ga0496114_0019770
430 Ga0496115_0036777
431 Ga0496115_0283884
432 Ga0496115_0599043
433 Ga0501034_0010987
434 Ga0501034_0014418
435 Ga0501036_0106761
436 Ga0501037_0257237
437 Ga0501048_0026562
438 Ga0501071_0044167
439 Ga0501074_0202205
440 nmdc:mga05p37_284068_c1
441 nmdc:mga09592_202051_c1
442 nmdc:mga06r32_264758_c1
443 nmdc:mga06r32_98355_c1
444 nmdc:mga08y16_142890_c1
445 nmdc:mga08y16_31152_c1
446 nmdc:mga08y16_781942_c1
447 nmdc:mga0n895_84970_c1
448 nmdc:mga0rr50_121396_c1
449 nmdc:mga0rr50_711136_c1
450 nmdc:mga0a205_153746_c1
451 Ga0500646_0027491
452 Ga0501082_0081941

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01555

N6_N4_Mtase

DNA methylase

67

330

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wh9-assembly1.cif.gz_B-2 holo structure of emodin 1-oh o-methyltransferase complex with emodin and s-adenosyl-l-homocysteine 0.9352 51 74
5w7m-assembly1.cif.gz_A crystal structure of roqn 0.848 55 78
3egi-assembly1.cif.gz_D methyltransferase domain of human trimethylguanosine synthase tgs1 bound to m7gpppa (inactive form) 0.8261 236 295
5hil-assembly1.cif.gz_A crystal structure of glycine sarcosine n-methyltransferase from methanohalophilus portucalensis in complex with s-adenosylhomocysteine and sarcosine 0.8046 241 295
4e2w-assembly1.cif.gz_A x-ray structure of the h181n mutant of tcab9, a c-3'-methyltransferase, in complex with s-adenosyl-l-homocysteine and sugar product 0.795 237 293
ID Description Score Start End Superfamily
af_Q58893_2_289_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8929 5 295 3.40.50.150
af_P9WJZ3_50_210_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8564 237 295 3.40.50.150
af_Q4CYU9_6_225_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8332 234 295 3.40.50.150
af_A0A2R8RIC7_223_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8186 234 295 3.40.50.150
af_Q09814_21_235_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8179 234 295 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3C0IVQ3-F1-model_v4 site-specific DNA-methyltransferase (cytosine-N(4)-specific) (EC 2.1.1.113) 0.9499 9 96 GO:0003677
GO:0008170
GO:0009307
GO:0015667
GO:0032259
AF-A0A382HT07-F1-model_v4 site-specific DNA-methyltransferase (cytosine-N(4)-specific) (EC 2.1.1.113) 0.9433 9 103 GO:0003677
GO:0008170
GO:0009307
GO:0015667
GO:0032259
AF-A0A7K3Y2D8-F1-model_v4 site-specific DNA-methyltransferase (cytosine-N(4)-specific) (EC 2.1.1.113) 0.9381 7 103 GO:0003677
GO:0008170
GO:0009307
GO:0015667
GO:0032259
AF-A0A2V8AWG8-F1-model_v4 Methyltransferase (EC 2.1.1.-) 0.9311 6 294 GO:0003677
GO:0008170
GO:0009307
GO:0015667
GO:0032259
AF-A0A2V6N409-F1-model_v4 Methyltransferase (EC 2.1.1.-) 0.9294 16 297 GO:0003677
GO:0008170
GO:0009307
GO:0015667
GO:0032259

Map