F339104

General Info

Members Datasets Scaffolds Average Seq Length
226 152 452 290

Family's Representative Sequence

Representative Sequence 3300042156|Ga0439446_0033544|Ga0439446_0033544_404_1450
Length 343
Sequence MPRAVHKFPLSDQNLLCLLFVICEQTDIIDQRMQSSLSLSKLSLLFNYKHLFMKPVSKNFLCFLTLIFSIQLAIQAQDDNKIRIIMIGAHPDDCDTAAIFAQMGYAVKFVSVTNGDAGHQLIGGVELAKRRFAEAQEAGKRLGVVYDVLDNHDGQLMPTLEVRLQIIKKIREWNADLVIAPRPNDYHPDHRYTGVLVQDAAYMVAVPNIAPETPALKKNPVFLYFQDRFQRPNPFRPDIAIDITSVFDKKISALDAHESQMYEWLPWIGHYADKVPKEKTERFKWLAETRKQEIKPEVKTALEKWYGKEKAAAIKNAEAFEICEYGAQPDQAMIKKLFPMLPK

Samples

Sample ID Description Type Environment
1 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
97 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
98 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
99 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 2842903701 Olivibacter sp. R-72191 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0.88
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 0
Rhizosphere 97.79
Stem 0
Stem Tuber 0
Unclassified 26.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439446_0033544 3300042156 Bacteria 1492
2 JGI25406J46586_10006475 3300003203 Bacteria 5387
3 rootH1_10090929 3300003323 Bacteria 1314
4 Ga0055531_10000018 3300003794 Bacteria 175214
5 Ga0065715_10170513 3300005293 Bacteria 1551
6 Ga0070658_10072931 3300005327 Bacteria 2814
7 Ga0070676_10029108 3300005328 Unclassified 3140
8 Ga0070683_100159253 3300005329 Unclassified 2141
9 Ga0070683_100242180 3300005329 Bacteria 1715
10 Ga0068868_100038587 3300005338 Unclassified 3708
11 Ga0070689_100046958 3300005340 Unclassified 3328
12 Ga0070687_100131399 3300005343 Unclassified 1446
13 Ga0070661_100102778 3300005344 Unclassified 2127
14 Ga0070668_100016255 3300005347 Bacteria 5566
15 Ga0070669_100210655 3300005353 Bacteria 1533
16 Ga0070671_100101438 3300005355 Bacteria 2414
17 Ga0070673_100089944 3300005364 Unclassified 2507
18 Ga0070673_100176992 3300005364 Bacteria 1824
19 Ga0070673_100551699 3300005364 Unclassified 1047
20 Ga0070688_100015683 3300005365 Bacteria 4318
21 Ga0070688_100025700 3300005365 Bacteria 3489
22 Ga0070688_100064998 3300005365 Unclassified 2317
23 Ga0070667_100139685 3300005367 Bacteria 2120
24 Ga0070701_10084148 3300005438 Unclassified 1729
25 Ga0070678_100151230 3300005456 Bacteria 1870
26 Ga0070678_100165271 3300005456 Bacteria 1797
27 Ga0070662_100001598 3300005457 Bacteria 13989
28 Ga0070681_10550516 3300005458 Unclassified 1067
29 Ga0068867_100061574 3300005459 Bacteria 2786
30 Ga0068867_100074356 3300005459 Unclassified 2547
31 Ga0068853_100645704 3300005539 Bacteria 1007
32 Ga0070672_100028749 3300005543 Unclassified 4161
33 Ga0070672_100419311 3300005543 Unclassified 1149
34 Ga0070665_100393008 3300005548 Bacteria 1395
35 Ga0070704_100518042 3300005549 Bacteria 1037
36 Ga0068857_100094124 3300005577 Unclassified 2683
37 Ga0068857_100142455 3300005577 Unclassified 2167
38 Ga0068854_100036744 3300005578 Unclassified 3436
39 Ga0068856_100312452 3300005614 Unclassified 1589
40 Ga0068859_100142941 3300005617 Unclassified 2466
41 Ga0068859_100204204 3300005617 Unclassified 2061
42 Ga0068859_100264006 3300005617 Bacteria 1813
43 Ga0068859_100613971 3300005617 Bacteria 1180
44 Ga0068864_100218078 3300005618 Unclassified 1759
45 Ga0068861_100001380 3300005719 Bacteria 15246
46 Ga0068861_100009723 3300005719 Bacteria 6649
47 Ga0068862_100107311 3300005844 Unclassified 2448
48 Ga0081539_10000708 3300005985 Bacteria 66782
49 Ga0070715_10028674 3300006163 Bacteria 2236
50 Ga0097621_100243284 3300006237 Bacteria 1573
51 Ga0075428_100011112 3300006844 Bacteria 10020
52 Ga0075428_100202078 3300006844 Bacteria 2148
53 Ga0075431_100019666 3300006847 Bacteria 6889
54 Ga0075429_100052420 3300006880 Bacteria 3550
55 Ga0068865_100175833 3300006881 Unclassified 1645
56 Ga0068865_100231514 3300006881 Bacteria 1450
57 Ga0097620_100142940 3300006931 Unclassified 2466
58 Ga0097620_100204190 3300006931 Unclassified 2061
59 Ga0097620_100264000 3300006931 Bacteria 1813
60 Ga0097620_100613928 3300006931 Bacteria 1180
61 Ga0111539_10006591 3300009094 Bacteria 14962
62 Ga0111539_10019208 3300009094 Bacteria 8442
63 Ga0111539_10048213 3300009094 Bacteria 5087
64 Ga0111539_10204439 3300009094 Unclassified 2302
65 Ga0114129_10156386 3300009147 Unclassified 3117
66 Ga0105242_10091343 3300009176 Bacteria 2563
67 Ga0105238_10026775 3300009551 Bacteria 5878
68 Ga0105249_10003194 3300009553 Bacteria 14183
69 Ga0105249_10057124 3300009553 Bacteria 3574
70 Ga0105249_10076974 3300009553 Bacteria 3093
71 Ga0105239_10190382 3300010375 Bacteria 2296
72 Ga0105239_10378687 3300010375 Bacteria 1600
73 Ga0105246_10070171 3300011119 Unclassified 2464
74 Ga0157374_10000558 3300013296 Bacteria 33101
75 Ga0157374_10026571 3300013296 Bacteria 5210
76 Ga0157378_10057347 3300013297 Unclassified 3471
77 Ga0157378_10179319 3300013297 Unclassified 1992
78 Ga0163162_10081814 3300013306 Unclassified 3300
79 Ga0163162_10146921 3300013306 Bacteria 2474
80 Ga0163162_10198219 3300013306 Bacteria 2136
81 Ga0163162_10250834 3300013306 Bacteria 1902
82 Ga0163162_10637936 3300013306 Bacteria 1189
83 Ga0157375_10039926 3300013308 Unclassified 4520
84 Ga0157375_10049136 3300013308 Bacteria 4132
85 Ga0157375_10066469 3300013308 Unclassified 3600
86 Ga0157375_10189356 3300013308 Unclassified 2212
87 Ga0163163_10001157 3300014325 Bacteria 22416
88 Ga0163163_10281472 3300014325 Bacteria 1714
89 Ga0163163_10387917 3300014325 Bacteria 1454
90 Ga0157380_10095007 3300014326 Bacteria 2469
91 Ga0157380_10319727 3300014326 Unclassified 1438
92 Ga0157380_10427684 3300014326 Bacteria 1265
93 Ga0157377_10003672 3300014745 Bacteria 6963
94 Ga0157379_10063543 3300014968 Bacteria 3300
95 Ga0157376_10097607 3300014969 Unclassified 2560
96 Ga0163161_10004117 3300017792 Bacteria 10174
97 Ga0197907_11255066 3300020069 Unclassified 953
98 Ga0206350_11117008 3300020080 Bacteria 923
99 Ga0209257_1000023 3300025304 Bacteria 753019
100 Ga0207697_10072698 3300025315 Bacteria 1442
101 Ga0207656_10093618 3300025321 Bacteria 1368
102 Ga0207682_10014047 3300025893 Bacteria 3120
103 Ga0207645_10046224 3300025907 Unclassified 2781
104 Ga0207645_10091649 3300025907 Unclassified 1955
105 Ga0207707_10077010 3300025912 Bacteria 2911
106 Ga0207707_10100310 3300025912 Unclassified 2530
107 Ga0207657_10106260 3300025919 Bacteria 2323
108 Ga0207649_10209297 3300025920 Bacteria 1382
109 Ga0207649_10423817 3300025920 Bacteria 1000
110 Ga0207681_10003075 3300025923 Bacteria 10485
111 Ga0207681_10098123 3300025923 Unclassified 2107
112 Ga0207681_10142680 3300025923 Bacteria 1786
113 Ga0207694_10012157 3300025924 Bacteria 6492
114 Ga0207650_10140130 3300025925 Bacteria 1900
115 Ga0207650_10431458 3300025925 Bacteria 1095
116 Ga0207659_10223500 3300025926 Bacteria 1515
117 Ga0207659_10411956 3300025926 Bacteria 1132
118 Ga0207644_10135896 3300025931 Unclassified 1888
119 Ga0207706_10001247 3300025933 Bacteria 25629
120 Ga0207706_10016620 3300025933 Bacteria 6641
121 Ga0207670_10003181 3300025936 Bacteria 8695
122 Ga0207704_10254943 3300025938 Bacteria 1319
123 Ga0207691_10008234 3300025940 Bacteria 10011
124 Ga0207691_10087110 3300025940 Unclassified 2801
125 Ga0207691_10236177 3300025940 Bacteria 1581
126 Ga0207689_10001600 3300025942 Bacteria 21433
127 Ga0207689_10016775 3300025942 Bacteria 6199
128 Ga0207689_10066019 3300025942 Unclassified 2976
129 Ga0207661_10005489 3300025944 Bacteria 8945
130 Ga0207679_10041546 3300025945 Unclassified 3298
131 Ga0207651_10045881 3300025960 Unclassified 2934
132 Ga0207651_10288824 3300025960 Bacteria 1359
133 Ga0207651_10372436 3300025960 Bacteria 1208
134 Ga0207712_10270415 3300025961 Bacteria 1382
135 Ga0207668_10161006 3300025972 Bacteria 1749
136 Ga0207658_10144741 3300025986 Bacteria 1928
137 Ga0207677_10089162 3300026023 Unclassified 2238
138 Ga0207678_10063889 3300026067 Unclassified 3163
139 Ga0207641_10251751 3300026088 Bacteria 1650
140 Ga0207648_10030999 3300026089 Unclassified 4729
141 Ga0207648_10058390 3300026089 Unclassified 3364
142 Ga0207648_10325776 3300026089 Unclassified 1381
143 Ga0207676_10039864 3300026095 Unclassified 3596
144 Ga0207674_10015651 3300026116 Bacteria 8328
145 Ga0207674_10044090 3300026116 Unclassified 4596
146 Ga0207675_100000051 3300026118 Bacteria 83288
147 Ga0207675_100231441 3300026118 Unclassified 1783
148 Ga0207683_10007576 3300026121 Bacteria 9300
149 Ga0268265_10030510 3300028380 Unclassified 3884
150 Ga0268265_10174409 3300028380 Bacteria 1841
151 Ga0268265_10235636 3300028380 Bacteria 1612
152 Ga0268264_10149780 3300028381 Unclassified 2091
153 Ga0316177_1219534 3300030731 Bacteria 11213
154 Ga0316176_1009535 3300030732 Bacteria 29129
155 Ga0316183_1207931 3300030742 Bacteria 24415
156 Ga0316181_1140375 3300030744 Bacteria 21291
157 Ga0316576_10070420 3300031727 Bacteria 2579
158 Ga0307405_10169280 3300031731 Bacteria 1557
159 Ga0307410_10220389 3300031852 Bacteria 1459
160 Ga0307416_100000609 3300032002 Bacteria 18445
161 Ga0373935_0165488 3300035692 Bacteria 1510
162 Ga0373933_0019988 3300035724 Bacteria 3792
163 Ga0373937_0004778 3300036401 Bacteria 11504
164 Ga0373925_0474305 3300037068 Bacteria 1026
165 Ga0395900_0413204 3300037418 Bacteria 1311
166 Ga0451577_0006282 3300042876 Bacteria 11896
167 Ga0451577_0136811 3300042876 Unclassified 2200
168 Ga0451577_0477088 3300042876 Bacteria 1132
169 Ga0453683_0046396 3300044673 Bacteria 2724
170 Ga0453684_0003872 3300044712 Bacteria 32941
171 Ga0453684_0061063 3300044712 Unclassified 4842
172 Ga0453684_0114764 3300044712 Bacteria 3265
173 Ga0453684_0381515 3300044712 Bacteria 1582
174 Ga0451576_0004062 3300045051 Bacteria 19387
175 Ga0451576_0005497 3300045051 Bacteria 15842
176 Ga0451576_0087383 3300045051 Unclassified 3243
177 Ga0451576_0160539 3300045051 Bacteria 2346
178 Ga0451576_0173148 3300045051 Bacteria 2253
179 Ga0451576_0468980 3300045051 Bacteria 1322
180 Ga0495653_0159379 3300046463 Bacteria 1568
181 Ga0495650_0011384 3300046471 Bacteria 4879
182 Ga0495580_0359461 3300046472 Bacteria 986
183 Ga0495628_0144882 3300046516 Bacteria 1811
184 Ga0495630_0007562 3300046517 Bacteria 7766
185 Ga0495599_0282948 3300046678 Bacteria 1004
186 Ga0501031_0005606 3300049568 Bacteria 8178
187 Ga0501032_0000322 3300049569 Bacteria 40127
188 Ga0501032_0003956 3300049569 Bacteria 11240
189 Ga0501033_0010144 3300049570 Bacteria 7230
190 Ga0501033_0113155 3300049570 Unclassified 1974
191 Ga0501034_0026134 3300049571 Bacteria 5945
192 Ga0501034_0149116 3300049571 Bacteria 2315
193 Ga0501034_0293833 3300049571 Bacteria 1562
194 Ga0501036_0003260 3300049572 Bacteria 12944
195 Ga0501037_0009346 3300049573 Bacteria 7195
196 Ga0501039_0011706 3300049575 Bacteria 6683
197 Ga0501039_0180886 3300049575 Bacteria 1658
198 Ga0501043_0001136 3300049579 Bacteria 23377
199 Ga0501043_0299900 3300049579 Bacteria 1228
200 Ga0501046_0000679 3300049580 Bacteria 33015
201 Ga0501047_0007012 3300049581 Bacteria 10578
202 Ga0501048_0008300 3300049582 Bacteria 7856
203 Ga0501067_0000421 3300049583 Bacteria 23106
204 Ga0501068_0000365 3300049584 Bacteria 22749
205 Ga0501069_0003848 3300049585 Bacteria 7734
206 Ga0501072_0001972 3300049588 Bacteria 15292
207 Ga0501073_0001561 3300049589 Bacteria 16977
208 Ga0501074_0002462 3300049590 Bacteria 12904
209 Ga0501075_0333058 3300049591 Bacteria 1157
210 Ga0501076_0241639 3300049592 Bacteria 1477
211 Ga0501077_0015283 3300049593 Bacteria 4830
212 Ga0501079_0009520 3300049741 Bacteria 7365
213 Ga0501080_0000914 3300049742 Bacteria 24162
214 Ga0501083_0008568 3300049744 Bacteria 7215
215 Ga0501035_0008994 3300049822 Bacteria 9288
216 Ga0501044_0008827 3300049823 Bacteria 11026
217 Ga0501045_0110758 3300049824 Bacteria 2035
218 nmdc:mga05p37_110313_c1 3300050507 Bacteria 3384
219 nmdc:mga09592_224301_c1 3300050508 Unclassified 1628
220 nmdc:mga09592_51037_c1 3300050508 Bacteria 3489
221 nmdc:mga0qj67_416260_c1 3300050509 Bacteria 1084
222 nmdc:mga06r32_30295_c1 3300050510 Bacteria 5077
223 Ga0500616_0022365 3300053153 Bacteria 3531
224 Ga0501084_0002135 3300054114 Bacteria 15796
225 Ga0501082_0003485 3300060353 Bacteria 13724
226 2842904396 2842903701 Bacteria 6986368
227 Ga0439446_0033544
228 JGI25406J46586_10006475
229 rootH1_10090929
230 Ga0055531_10000018
231 Ga0065715_10170513
232 Ga0070658_10072931
233 Ga0070676_10029108
234 Ga0070683_100159253
235 Ga0070683_100242180
236 Ga0068868_100038587
237 Ga0070689_100046958
238 Ga0070687_100131399
239 Ga0070661_100102778
240 Ga0070668_100016255
241 Ga0070669_100210655
242 Ga0070671_100101438
243 Ga0070673_100089944
244 Ga0070673_100176992
245 Ga0070673_100551699
246 Ga0070688_100015683
247 Ga0070688_100025700
248 Ga0070688_100064998
249 Ga0070667_100139685
250 Ga0070701_10084148
251 Ga0070678_100151230
252 Ga0070678_100165271
253 Ga0070662_100001598
254 Ga0070681_10550516
255 Ga0068867_100061574
256 Ga0068867_100074356
257 Ga0068853_100645704
258 Ga0070672_100028749
259 Ga0070672_100419311
260 Ga0070665_100393008
261 Ga0070704_100518042
262 Ga0068857_100094124
263 Ga0068857_100142455
264 Ga0068854_100036744
265 Ga0068856_100312452
266 Ga0068859_100142941
267 Ga0068859_100204204
268 Ga0068859_100264006
269 Ga0068859_100613971
270 Ga0068864_100218078
271 Ga0068861_100001380
272 Ga0068861_100009723
273 Ga0068862_100107311
274 Ga0081539_10000708
275 Ga0070715_10028674
276 Ga0097621_100243284
277 Ga0075428_100011112
278 Ga0075428_100202078
279 Ga0075431_100019666
280 Ga0075429_100052420
281 Ga0068865_100175833
282 Ga0068865_100231514
283 Ga0097620_100142940
284 Ga0097620_100204190
285 Ga0097620_100264000
286 Ga0097620_100613928
287 Ga0111539_10006591
288 Ga0111539_10019208
289 Ga0111539_10048213
290 Ga0111539_10204439
291 Ga0114129_10156386
292 Ga0105242_10091343
293 Ga0105238_10026775
294 Ga0105249_10003194
295 Ga0105249_10057124
296 Ga0105249_10076974
297 Ga0105239_10190382
298 Ga0105239_10378687
299 Ga0105246_10070171
300 Ga0157374_10000558
301 Ga0157374_10026571
302 Ga0157378_10057347
303 Ga0157378_10179319
304 Ga0163162_10081814
305 Ga0163162_10146921
306 Ga0163162_10198219
307 Ga0163162_10250834
308 Ga0163162_10637936
309 Ga0157375_10039926
310 Ga0157375_10049136
311 Ga0157375_10066469
312 Ga0157375_10189356
313 Ga0163163_10001157
314 Ga0163163_10281472
315 Ga0163163_10387917
316 Ga0157380_10095007
317 Ga0157380_10319727
318 Ga0157380_10427684
319 Ga0157377_10003672
320 Ga0157379_10063543
321 Ga0157376_10097607
322 Ga0163161_10004117
323 Ga0197907_11255066
324 Ga0206350_11117008
325 Ga0209257_1000023
326 Ga0207697_10072698
327 Ga0207656_10093618
328 Ga0207682_10014047
329 Ga0207645_10046224
330 Ga0207645_10091649
331 Ga0207707_10077010
332 Ga0207707_10100310
333 Ga0207657_10106260
334 Ga0207649_10209297
335 Ga0207649_10423817
336 Ga0207681_10003075
337 Ga0207681_10098123
338 Ga0207681_10142680
339 Ga0207694_10012157
340 Ga0207650_10140130
341 Ga0207650_10431458
342 Ga0207659_10223500
343 Ga0207659_10411956
344 Ga0207644_10135896
345 Ga0207706_10001247
346 Ga0207706_10016620
347 Ga0207670_10003181
348 Ga0207704_10254943
349 Ga0207691_10008234
350 Ga0207691_10087110
351 Ga0207691_10236177
352 Ga0207689_10001600
353 Ga0207689_10016775
354 Ga0207689_10066019
355 Ga0207661_10005489
356 Ga0207679_10041546
357 Ga0207651_10045881
358 Ga0207651_10288824
359 Ga0207651_10372436
360 Ga0207712_10270415
361 Ga0207668_10161006
362 Ga0207658_10144741
363 Ga0207677_10089162
364 Ga0207678_10063889
365 Ga0207641_10251751
366 Ga0207648_10030999
367 Ga0207648_10058390
368 Ga0207648_10325776
369 Ga0207676_10039864
370 Ga0207674_10015651
371 Ga0207674_10044090
372 Ga0207675_100000051
373 Ga0207675_100231441
374 Ga0207683_10007576
375 Ga0268265_10030510
376 Ga0268265_10174409
377 Ga0268265_10235636
378 Ga0268264_10149780
379 Ga0316177_1219534
380 Ga0316176_1009535
381 Ga0316183_1207931
382 Ga0316181_1140375
383 Ga0316576_10070420
384 Ga0307405_10169280
385 Ga0307410_10220389
386 Ga0307416_100000609
387 Ga0373935_0165488
388 Ga0373933_0019988
389 Ga0373937_0004778
390 Ga0373925_0474305
391 Ga0395900_0413204
392 Ga0451577_0006282
393 Ga0451577_0136811
394 Ga0451577_0477088
395 Ga0453683_0046396
396 Ga0453684_0003872
397 Ga0453684_0061063
398 Ga0453684_0114764
399 Ga0453684_0381515
400 Ga0451576_0004062
401 Ga0451576_0005497
402 Ga0451576_0087383
403 Ga0451576_0160539
404 Ga0451576_0173148
405 Ga0451576_0468980
406 Ga0495653_0159379
407 Ga0495650_0011384
408 Ga0495580_0359461
409 Ga0495628_0144882
410 Ga0495630_0007562
411 Ga0495599_0282948
412 Ga0501031_0005606
413 Ga0501032_0000322
414 Ga0501032_0003956
415 Ga0501033_0010144
416 Ga0501033_0113155
417 Ga0501034_0026134
418 Ga0501034_0149116
419 Ga0501034_0293833
420 Ga0501036_0003260
421 Ga0501037_0009346
422 Ga0501039_0011706
423 Ga0501039_0180886
424 Ga0501043_0001136
425 Ga0501043_0299900
426 Ga0501046_0000679
427 Ga0501047_0007012
428 Ga0501048_0008300
429 Ga0501067_0000421
430 Ga0501068_0000365
431 Ga0501069_0003848
432 Ga0501072_0001972
433 Ga0501073_0001561
434 Ga0501074_0002462
435 Ga0501075_0333058
436 Ga0501076_0241639
437 Ga0501077_0015283
438 Ga0501079_0009520
439 Ga0501080_0000914
440 Ga0501083_0008568
441 Ga0501035_0008994
442 Ga0501044_0008827
443 Ga0501045_0110758
444 nmdc:mga05p37_110313_c1
445 nmdc:mga09592_224301_c1
446 nmdc:mga09592_51037_c1
447 nmdc:mga0qj67_416260_c1
448 nmdc:mga06r32_30295_c1
449 Ga0500616_0022365
450 Ga0501084_0002135
451 Ga0501082_0003485
452 2842904396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

85

201

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uan-assembly1.cif.gz_A crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.8143 17 269
1q74-assembly2.cif.gz_B the crystal structure of 1d-myo-inositol 2-acetamido-2-deoxy-alpha-d-glucopyranoside deacetylase (mshb) 0.8103 13 195
2ixd-assembly1.cif.gz_A crystal structure of the putative deacetylase bc1534 from bacillus cereus 0.8015 14 270
1uan-assembly1.cif.gz_B crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.7997 17 267
1q74-assembly1.cif.gz_A the crystal structure of 1d-myo-inositol 2-acetamido-2-deoxy-alpha-d-glucopyranoside deacetylase (mshb) 0.7996 14 195
ID Description Score Start End Superfamily
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8196 16 261 3.40.50.10320
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8098 12 261 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8015 14 270 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7997 17 267 3.40.50.10320
af_Q54C64_7_186_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7953 14 140 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A1Q7HJH9-F1-model_v4 GlcNAc-PI de-N-acetylase 0.9924 17 281 GO:0016811
AF-A0A2V8GF70-F1-model_v4 GlcNAc-PI de-N-acetylase 0.9915 11 277 GO:0016811
AF-A0A7C5EYQ8-F1-model_v4 PIG-L family deacetylase 0.9883 14 198 GO:0016811
AF-A0A7C5IJD6-F1-model_v4 PIG-L family deacetylase 0.9876 14 228 GO:0016811
AF-A0A0S8E943-F1-model_v4 GlcNAc-PI de-N-acetylase 0.9875 11 192 GO:0016811

Map