F339010

General Info

Members Datasets Scaffolds Average Seq Length
226 169 452 353

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10116939|Ga0307508_101169392
Length 413
Sequence VHSGLLRVRCASTVGDMAQFVDWDLAAATAAALGKSGPAVSYEEAADAVADLKELADEAVQHVTAFTAMEAQVIAPPVRVVDRRDWAATNIDGLRQVINPLAERLTAGNTPGPLTAAIGSRFTGVQAGTVLAYLSGKVLGQYEVFTANPGQLLLVAPNIVEAERRLGADPRDFRLWVCLHEVTHRVQFTAVAWMRGYFLGEVQAFVDASQLNQDQLFERVRRGVTALAEAVRDPESRVSVLDLVQTPGQRAVLDRLTALMTLLEGHAEFVMDGVGPEVIPTVEDIRAKFNRRRETANPVERVVRKLLGIEAKMRQYGEGRKFVHGVVERVGMAGFNRIWDSPLTLPRLDELADPDAWVNRVHGPNAYRQVESVVAVAPAAVVDTPDESAAEGPSSAGSDAEQSGPHLNNPETD

Samples

Sample ID Description Type Environment
1 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
71 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
98 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
121 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
122 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
128 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
129 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
130 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
131 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
132 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
133 2501939600 Micromonospora sp. L5 Isolate Unclassified
134 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
135 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
136 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
137 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
138 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
139 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
140 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
141 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
142 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
143 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
144 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
145 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
146 2858882152 Micromonospora noduli MED15 Isolate Nodule
147 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
148 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
149 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
150 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
151 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
152 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
153 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
154 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
155 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
156 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
157 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
158 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
159 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
160 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
161 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
162 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
163 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
164 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
165 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
166 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
167 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
168 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
169 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.86
Metatranscriptomes 1.77
Isolates 16.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.65
Nodule 2.65
Rhizoplane 6.64
Rhizosphere 73.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307508_10116939 3300031616 Bacteria 2268
2 JGI25406J46586_10011708 3300003203 Bacteria 3834
3 JGI25406J46586_10016037 3300003203 Bacteria 3138
4 Ga0070658_10072511 3300005327 Bacteria 2822
5 Ga0070676_10039365 3300005328 Bacteria 2734
6 Ga0070661_100080199 3300005344 Bacteria 2409
7 Ga0070692_10095000 3300005345 Bacteria 1626
8 Ga0070675_100001609 3300005354 Bacteria 16654
9 Ga0070671_100244635 3300005355 Bacteria 1523
10 Ga0070659_100009936 3300005366 Bacteria 6999
11 Ga0070714_100166182 3300005435 Bacteria 2000
12 Ga0070713_100239217 3300005436 Bacteria 1653
13 Ga0070700_100009968 3300005441 Bacteria 5230
14 Ga0070662_100057325 3300005457 Bacteria 2831
15 Ga0070681_10195785 3300005458 Bacteria 1940
16 Ga0070679_100036018 3300005530 Bacteria 4910
17 Ga0070684_100012252 3300005535 Bacteria 6866
18 Ga0070684_100024054 3300005535 Bacteria 5106
19 Ga0070665_100052820 3300005548 Bacteria 4076
20 Ga0068855_100280635 3300005563 Bacteria 1850
21 Ga0070664_100007802 3300005564 Bacteria 8643
22 Ga0068857_100186648 3300005577 Bacteria 1888
23 Ga0068864_100175591 3300005618 Bacteria 1955
24 Ga0068863_100017891 3300005841 Bacteria 6782
25 Ga0068863_100063316 3300005841 Bacteria 3498
26 Ga0068858_100066462 3300005842 Bacteria 3338
27 Ga0081540_1019998 3300005983 Bacteria 4045
28 Ga0081539_10000779 3300005985 Bacteria 62135
29 Ga0081539_10001096 3300005985 Bacteria 49234
30 Ga0075364_10108113 3300006051 Bacteria 1855
31 Ga0075428_100004329 3300006844 Bacteria 15652
32 Ga0075428_100189646 3300006844 Bacteria 2224
33 Ga0075430_100017562 3300006846 Bacteria 6093
34 Ga0075430_100035229 3300006846 Bacteria 4247
35 Ga0075430_100068904 3300006846 Bacteria 2968
36 Ga0075431_100021138 3300006847 Bacteria 6650
37 Ga0075431_100099739 3300006847 Bacteria 2996
38 Ga0075431_100101516 3300006847 Bacteria 2968
39 Ga0075429_100006139 3300006880 Bacteria 10387
40 Ga0075429_100024979 3300006880 Bacteria 5187
41 Ga0111539_10023355 3300009094 Bacteria 7597
42 Ga0105245_10012776 3300009098 Bacteria 7315
43 Ga0114129_10001523 3300009147 Bacteria 31386
44 Ga0114129_10006682 3300009147 Bacteria 16381
45 Ga0114129_10007655 3300009147 Bacteria 15375
46 Ga0114129_10188387 3300009147 Bacteria 2803
47 Ga0114129_10278784 3300009147 Bacteria 2234
48 Ga0114129_10511105 3300009147 Bacteria 1567
49 Ga0105242_10416054 3300009176 Bacteria 1258
50 Ga0105248_10017097 3300009177 Bacteria 7989
51 Ga0105249_10118230 3300009553 Bacteria 2515
52 Ga0105239_10672587 3300010375 Bacteria 1183
53 Ga0157371_10056122 3300013102 Bacteria 2794
54 Ga0157369_10003881 3300013105 Bacteria 17737
55 Ga0157369_10185472 3300013105 Bacteria 2188
56 Ga0157372_10187753 3300013307 Bacteria 2393
57 Ga0157375_10012516 3300013308 Bacteria 7529
58 Ga0157375_10018853 3300013308 Bacteria 6264
59 Ga0163163_10029795 3300014325 Bacteria 5251
60 Ga0163163_10038146 3300014325 Bacteria 4680
61 Ga0163163_10225214 3300014325 Bacteria 1924
62 Ga0197907_10093712 3300020069 Bacteria 1424
63 Ga0206356_10478539 3300020070 Bacteria 1450
64 Ga0206354_10472549 3300020081 Bacteria 2021
65 Ga0206353_11607613 3300020082 Bacteria 3017
66 Ga0207688_10071081 3300025901 Bacteria 1975
67 Ga0207705_10064254 3300025909 Bacteria 2652
68 Ga0207657_10050063 3300025919 Bacteria 3637
69 Ga0207657_10088421 3300025919 Bacteria 2590
70 Ga0207657_10121185 3300025919 Bacteria 2152
71 Ga0207649_10053517 3300025920 Bacteria 2508
72 Ga0207652_10184217 3300025921 Bacteria 1877
73 Ga0207687_10006347 3300025927 Bacteria 7812
74 Ga0207687_10133752 3300025927 Bacteria 1873
75 Ga0207700_10205219 3300025928 Bacteria 1663
76 Ga0207706_10035195 3300025933 Bacteria 4454
77 Ga0207711_10039754 3300025941 Bacteria 4001
78 Ga0207689_10025453 3300025942 Bacteria 4959
79 Ga0207661_10009456 3300025944 Bacteria 6991
80 Ga0207661_10031421 3300025944 Bacteria 4102
81 Ga0207661_10183099 3300025944 Bacteria 1831
82 Ga0207679_10004025 3300025945 Bacteria 9127
83 Ga0207667_10379098 3300025949 Bacteria 1441
84 Ga0207712_10091902 3300025961 Bacteria 2236
85 Ga0207708_10016063 3300026075 Bacteria 5623
86 Ga0207641_10037867 3300026088 Bacteria 4030
87 Ga0207676_10136562 3300026095 Bacteria 2093
88 Ga0207676_10247797 3300026095 Bacteria 1602
89 Ga0207674_10034401 3300026116 Bacteria 5297
90 Ga0207674_10095468 3300026116 Bacteria 2959
91 Ga0207674_10274825 3300026116 Bacteria 1632
92 Ga0207683_10067922 3300026121 Bacteria 3145
93 Ga0207698_10156510 3300026142 Bacteria 1986
94 Ga0268266_10058751 3300028379 Bacteria 3312
95 Ga0268266_10322270 3300028379 Bacteria 1447
96 Ga0268265_10017673 3300028380 Bacteria 4928
97 Ga0307515_10023591 3300028794 Bacteria 10773
98 Ga0307515_10072507 3300028794 Bacteria 4645
99 Ga0307512_10011572 3300030522 Bacteria 8354
100 Ga0307512_10021079 3300030522 Bacteria 5883
101 Ga0265328_10020375 3300031239 Bacteria 2538
102 Ga0307513_10004641 3300031456 Bacteria 18282
103 Ga0307513_10049704 3300031456 Bacteria 4540
104 Ga0307408_100241660 3300031548 Bacteria 1484
105 Ga0307508_10050543 3300031616 Bacteria 3699
106 Ga0307508_10061925 3300031616 Bacteria 3304
107 Ga0307516_10027518 3300031730 Bacteria 5765
108 Ga0307516_10078179 3300031730 Bacteria 3155
109 Ga0307516_10136782 3300031730 Bacteria 2224
110 Ga0307405_10010569 3300031731 Bacteria 4794
111 Ga0307413_10016436 3300031824 Bacteria 3823
112 Ga0307410_10022376 3300031852 Bacteria 3906
113 Ga0307410_10027666 3300031852 Bacteria 3586
114 Ga0307410_10161449 3300031852 Bacteria 1680
115 Ga0307406_10032866 3300031901 Bacteria 3170
116 Ga0307412_10084650 3300031911 Bacteria 2202
117 Ga0307409_100002319 3300031995 Bacteria 9877
118 Ga0307409_100239481 3300031995 Bacteria 1651
119 Ga0307416_100048228 3300032002 Bacteria 3377
120 Ga0307415_100000057 3300032126 Bacteria 47112
121 Ga0307415_100012886 3300032126 Bacteria 4855
122 Ga0307415_100029950 3300032126 Bacteria 3486
123 Ga0307415_100103326 3300032126 Bacteria 2096
124 Ga0307415_100116613 3300032126 Bacteria 1993
125 Ga0395899_0015233 3300037312 Bacteria 5862
126 Ga0395900_0073709 3300037418 Bacteria 3510
127 Ga0395898_0017437 3300037466 Bacteria 7333
128 Ga0395905_0018674 3300037471 Bacteria 6576
129 Ga0395901_0031725 3300038443 Bacteria 5447
130 Ga0466966_0074981 3300044684 Bacteria 2114
131 Ga0466961_0054616 3300044693 Bacteria 2547
132 Ga0466963_0145056 3300044694 Bacteria 1646
133 Ga0466970_0097307 3300044765 Bacteria 1601
134 Ga0466957_0055121 3300044842 Bacteria 2429
135 Ga0495629_0096696 3300046459 Bacteria 2060
136 Ga0495629_0207945 3300046459 Bacteria 1352
137 Ga0495606_0000899 3300046507 Bacteria 44298
138 Ga0495668_0002206 3300046616 Bacteria 16580
139 Ga0495625_0003279 3300046660 Bacteria 16347
140 Ga0495674_0080327 3300047319 Bacteria 2799
141 Ga0495626_0002553 3300048091 Bacteria 12489
142 Ga0496102_0048261 3300048905 Bacteria 3871
143 Ga0496104_0062958 3300048907 Bacteria 3517
144 Ga0496105_0061370 3300048908 Bacteria 3102
145 Ga0496105_0136206 3300048908 Bacteria 2023
146 Ga0496108_0009017 3300048911 Bacteria 8082
147 Ga0496109_0037713 3300048912 Bacteria 4367
148 Ga0496110_0161154 3300048913 Bacteria 2033
149 Ga0496111_0020118 3300048914 Bacteria 4643
150 Ga0496111_0057671 3300048914 Bacteria 2811
151 Ga0496112_0007433 3300048915 Bacteria 9724
152 Ga0496112_0020271 3300048915 Bacteria 6298
153 Ga0496112_0020788 3300048915 Bacteria 6229
154 Ga0496112_0094755 3300048915 Bacteria 2956
155 Ga0496113_0003155 3300048916 Bacteria 9811
156 Ga0496114_0114620 3300048917 Bacteria 2311
157 Ga0501031_0085371 3300049568 Bacteria 2058
158 Ga0501036_0029655 3300049572 Bacteria 4621
159 Ga0501039_0251929 3300049575 Bacteria 1388
160 Ga0501041_0084496 3300049577 Bacteria 1956
161 Ga0501042_0173354 3300049578 Bacteria 1556
162 Ga0501046_0179110 3300049580 Bacteria 1586
163 Ga0501047_0004267 3300049581 Bacteria 13458
164 Ga0501072_0379425 3300049588 Bacteria 1122
165 Ga0501074_0080017 3300049590 Bacteria 2345
166 Ga0501076_0211836 3300049592 Bacteria 1583
167 Ga0501079_0273844 3300049741 Bacteria 1319
168 Ga0501081_0115792 3300049743 Bacteria 1905
169 Ga0501045_0035434 3300049824 Bacteria 3623
170 nmdc:mga00v17_96148_c1 3300050491 Bacteria 1865
171 nmdc:mga05p37_1585_c2 3300050507 Bacteria 25594
172 nmdc:mga05p37_27327_c1 3300050507 Bacteria 6947
173 nmdc:mga05p37_32669_c2 3300050507 Bacteria 2784
174 nmdc:mga05p37_33429_c1 3300050507 Bacteria 6299
175 nmdc:mga05p37_439912_c1 3300050507 Bacteria 1512
176 nmdc:mga09592_177_c1 3300050508 Bacteria 45265
177 nmdc:mga09592_238547_c1 3300050508 Bacteria 1575
178 nmdc:mga0qj67_10883_c1 3300050509 Bacteria 6804
179 nmdc:mga0qj67_321123_c1 3300050509 Bacteria 1253
180 nmdc:mga0qj67_36_c3 3300050509 Bacteria 71496
181 nmdc:mga06r32_21285_c1 3300050510 Bacteria 5985
182 nmdc:mga06r32_254546_c1 3300050510 Bacteria 1744
183 nmdc:mga06r32_290_c2 3300050510 Bacteria 38684
184 Ga0495619_0006039 3300053085 Bacteria 7674
185 Ga0500646_0000052 3300053090 Bacteria 32125
186 Ga0500568_0001074 3300053139 Bacteria 18492
187 Ga0500579_087089 3300053143 Bacteria 1710
188 Ga0500600_0085570 3300053149 Bacteria 1694
189 Ga0530510_0065859 3300061734 Bacteria 2626
190 2501945954 2501939600 Bacteria 6907073
191 2515497679 2515154088 Bacteria 5526283
192 2515720402 2515154129 Bacteria 5584369
193 2515757791 2515154137 Bacteria 5711575
194 2516091599 2515154203 Bacteria 5458536
195 2676487232 2675903059 Bacteria 8644972
196 2772645274 2772190715 Bacteria 6959372
197 2831939788 2831935698 Bacteria 5963223
198 2832005845 2832004796 Bacteria 6538017
199 2855672420 2855670206 Bacteria 7120389
200 2855677249 2855676851 Bacteria 7063653
201 2857291414 2857288857 Bacteria 7189066
202 2858850283 2858848962 Bacteria 6963058
203 2858884695 2858882152 Bacteria 7230291
204 2858893352 2858888857 Bacteria 7060307
205 2858898275 2858895516 Bacteria 7378898
206 2861526000 2861520306 Bacteria 8348283
207 2866066332 2866065130 Bacteria 6518152
208 2867510524 2867507094 Bacteria 6506033
209 2868091645 2868088558 Bacteria 7609351
210 2869048736 2869048445 Bacteria 6875584
211 2869062294 2869061728 Bacteria 7112407
212 2869075270 2869068681 Bacteria 7205615
213 2880494768 2880489317 Bacteria 7096270
214 2880497546 2880495981 Bacteria 7340502
215 2887485656 2887478801 Bacteria 8972725
216 2929226110 2929219909 Bacteria 6984360
217 2929232772 2929226422 Bacteria 7248583
218 8001783065 8001781756 Bacteria 9586736
219 8003832910 8003830390 Bacteria 6541657
220 8003857170 8003856774 Bacteria 7675274
221 8003876628 8003870546 Bacteria 7396674
222 8054710694 8054704163 Bacteria 7247792
223 8054732396 8054727385 Bacteria 7558670
224 8054739359 8054734606 Bacteria 6947278
225 8055417625 8055412473 Bacteria 6257500
226 8057570492 8057568493 Bacteria 7221719
227 Ga0307508_10116939
228 JGI25406J46586_10011708
229 JGI25406J46586_10016037
230 Ga0070658_10072511
231 Ga0070676_10039365
232 Ga0070661_100080199
233 Ga0070692_10095000
234 Ga0070675_100001609
235 Ga0070671_100244635
236 Ga0070659_100009936
237 Ga0070714_100166182
238 Ga0070713_100239217
239 Ga0070700_100009968
240 Ga0070662_100057325
241 Ga0070681_10195785
242 Ga0070679_100036018
243 Ga0070684_100012252
244 Ga0070684_100024054
245 Ga0070665_100052820
246 Ga0068855_100280635
247 Ga0070664_100007802
248 Ga0068857_100186648
249 Ga0068864_100175591
250 Ga0068863_100017891
251 Ga0068863_100063316
252 Ga0068858_100066462
253 Ga0081540_1019998
254 Ga0081539_10000779
255 Ga0081539_10001096
256 Ga0075364_10108113
257 Ga0075428_100004329
258 Ga0075428_100189646
259 Ga0075430_100017562
260 Ga0075430_100035229
261 Ga0075430_100068904
262 Ga0075431_100021138
263 Ga0075431_100099739
264 Ga0075431_100101516
265 Ga0075429_100006139
266 Ga0075429_100024979
267 Ga0111539_10023355
268 Ga0105245_10012776
269 Ga0114129_10001523
270 Ga0114129_10006682
271 Ga0114129_10007655
272 Ga0114129_10188387
273 Ga0114129_10278784
274 Ga0114129_10511105
275 Ga0105242_10416054
276 Ga0105248_10017097
277 Ga0105249_10118230
278 Ga0105239_10672587
279 Ga0157371_10056122
280 Ga0157369_10003881
281 Ga0157369_10185472
282 Ga0157372_10187753
283 Ga0157375_10012516
284 Ga0157375_10018853
285 Ga0163163_10029795
286 Ga0163163_10038146
287 Ga0163163_10225214
288 Ga0197907_10093712
289 Ga0206356_10478539
290 Ga0206354_10472549
291 Ga0206353_11607613
292 Ga0207688_10071081
293 Ga0207705_10064254
294 Ga0207657_10050063
295 Ga0207657_10088421
296 Ga0207657_10121185
297 Ga0207649_10053517
298 Ga0207652_10184217
299 Ga0207687_10006347
300 Ga0207687_10133752
301 Ga0207700_10205219
302 Ga0207706_10035195
303 Ga0207711_10039754
304 Ga0207689_10025453
305 Ga0207661_10009456
306 Ga0207661_10031421
307 Ga0207661_10183099
308 Ga0207679_10004025
309 Ga0207667_10379098
310 Ga0207712_10091902
311 Ga0207708_10016063
312 Ga0207641_10037867
313 Ga0207676_10136562
314 Ga0207676_10247797
315 Ga0207674_10034401
316 Ga0207674_10095468
317 Ga0207674_10274825
318 Ga0207683_10067922
319 Ga0207698_10156510
320 Ga0268266_10058751
321 Ga0268266_10322270
322 Ga0268265_10017673
323 Ga0307515_10023591
324 Ga0307515_10072507
325 Ga0307512_10011572
326 Ga0307512_10021079
327 Ga0265328_10020375
328 Ga0307513_10004641
329 Ga0307513_10049704
330 Ga0307408_100241660
331 Ga0307508_10050543
332 Ga0307508_10061925
333 Ga0307516_10027518
334 Ga0307516_10078179
335 Ga0307516_10136782
336 Ga0307405_10010569
337 Ga0307413_10016436
338 Ga0307410_10022376
339 Ga0307410_10027666
340 Ga0307410_10161449
341 Ga0307406_10032866
342 Ga0307412_10084650
343 Ga0307409_100002319
344 Ga0307409_100239481
345 Ga0307416_100048228
346 Ga0307415_100000057
347 Ga0307415_100012886
348 Ga0307415_100029950
349 Ga0307415_100103326
350 Ga0307415_100116613
351 Ga0395899_0015233
352 Ga0395900_0073709
353 Ga0395898_0017437
354 Ga0395905_0018674
355 Ga0395901_0031725
356 Ga0466966_0074981
357 Ga0466961_0054616
358 Ga0466963_0145056
359 Ga0466970_0097307
360 Ga0466957_0055121
361 Ga0495629_0096696
362 Ga0495629_0207945
363 Ga0495606_0000899
364 Ga0495668_0002206
365 Ga0495625_0003279
366 Ga0495674_0080327
367 Ga0495626_0002553
368 Ga0496102_0048261
369 Ga0496104_0062958
370 Ga0496105_0061370
371 Ga0496105_0136206
372 Ga0496108_0009017
373 Ga0496109_0037713
374 Ga0496110_0161154
375 Ga0496111_0020118
376 Ga0496111_0057671
377 Ga0496112_0007433
378 Ga0496112_0020271
379 Ga0496112_0020788
380 Ga0496112_0094755
381 Ga0496113_0003155
382 Ga0496114_0114620
383 Ga0501031_0085371
384 Ga0501036_0029655
385 Ga0501039_0251929
386 Ga0501041_0084496
387 Ga0501042_0173354
388 Ga0501046_0179110
389 Ga0501047_0004267
390 Ga0501072_0379425
391 Ga0501074_0080017
392 Ga0501076_0211836
393 Ga0501079_0273844
394 Ga0501081_0115792
395 Ga0501045_0035434
396 nmdc:mga00v17_96148_c1
397 nmdc:mga05p37_1585_c2
398 nmdc:mga05p37_27327_c1
399 nmdc:mga05p37_32669_c2
400 nmdc:mga05p37_33429_c1
401 nmdc:mga05p37_439912_c1
402 nmdc:mga09592_177_c1
403 nmdc:mga09592_238547_c1
404 nmdc:mga0qj67_10883_c1
405 nmdc:mga0qj67_321123_c1
406 nmdc:mga0qj67_36_c3
407 nmdc:mga06r32_21285_c1
408 nmdc:mga06r32_254546_c1
409 nmdc:mga06r32_290_c2
410 Ga0495619_0006039
411 Ga0500646_0000052
412 Ga0500568_0001074
413 Ga0500579_087089
414 Ga0500600_0085570
415 Ga0530510_0065859
416 2501945954
417 2515497679
418 2515720402
419 2515757791
420 2516091599
421 2676487232
422 2772645274
423 2831939788
424 2832005845
425 2855672420
426 2855677249
427 2857291414
428 2858850283
429 2858884695
430 2858893352
431 2858898275
432 2861526000
433 2866066332
434 2867510524
435 2868091645
436 2869048736
437 2869062294
438 2869075270
439 2880494768
440 2880497546
441 2887485656
442 2929226110
443 2929232772
444 8001783065
445 8003832910
446 8003857170
447 8003876628
448 8054710694
449 8054732396
450 8054739359
451 8055417625
452 8057570492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10103

Zincin_2

Zincin-like metallopeptidase

21

358

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cmn-assembly1.cif.gz_A crystal structure of a putative hydrolase with a novel fold from chloroflexus aurantiacus 0.8323 5 344
3cmn-assembly1.cif.gz_A crystal structure of a putative hydrolase with a novel fold from chloroflexus aurantiacus 0.8144 5 344
1tvi-assembly1.cif.gz_A solution structure of tm1509 from thermotoga maritima: vt1, a nesgc target protein 0.5929 33 170
7y7o-assembly1.cif.gz_A crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus 0.5826 36 190
1xm5-assembly1.cif.gz_A crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 0.5524 134 195
ID Description Score Start End Superfamily
3cmnA01 Mainly Alpha;Up-down Bundle;Lysin;Zincin-like metallopeptidase, N-terminal domain 0.7855 5 139 1.20.150.30
3cmnA01 Mainly Alpha;Up-down Bundle;Lysin;Zincin-like metallopeptidase, N-terminal domain 0.7741 5 139 1.20.150.30
af_O53341_85_215_1.20.150.30 Mainly Alpha;Up-down Bundle;Lysin;Zincin-like metallopeptidase, N-terminal domain 0.6466 5 123 1.20.150.30
1tviA00 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.5929 33 170 3.40.390.30
af_O53341_85_215_1.20.150.30 Mainly Alpha;Up-down Bundle;Lysin;Zincin-like metallopeptidase, N-terminal domain 0.5903 5 123 1.20.150.30
ID Description Score Start End GO Terms
AF-A0A1Q7BXI8-F1-model_v4 Coenzyme F420 biosynthesis-associated protein 0.9736 1 346
AF-A0A428X1J0-F1-model_v4 Coenzyme F420 biosynthesis-associated protein 0.973 1 350
AF-A0A1I2JAX6-F1-model_v4 Putative hydrolase/uncharacterized protein, coenzyme F420 biosynthesis associated 0.9703 1 346 GO:0016787
AF-A0A1Q7BXI8-F1-model_v4 Coenzyme F420 biosynthesis-associated protein 0.9681 1 346
AF-A0A428X1J0-F1-model_v4 Coenzyme F420 biosynthesis-associated protein 0.9675 1 350

Map