F339006

General Info

Members Datasets Scaffolds Average Seq Length
226 127 452 184

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100277507|Ga0307408_1002775072
Length 199
Sequence LSPRLLVSSSVFMWQSKTKTDLIIEVWEKLDCESVGAKEIEAIEIAVEDRFGFGAVDSPMIIARLLADEGAHLRHSEILELDVKRRLESPYDAMFRNILKFSDFKQTLISIRRLENLRKKFAAENDKEGLRLVRETALKGKNRAQMISKNEKVDEKKRIEKAEIAEWFTLWMQSPEMFENWISLRQNSPDFKEKFETEQ

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
118 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
121 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
122 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
123 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
124 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
125 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
126 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
127 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 0
Rhizosphere 98.67
Stem 0
Stem Tuber 0
Unclassified 32.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100277507 3300031548 Bacteria 1394
2 LJQas_1000354 3300000549 Bacteria 7809
3 JGI25406J46586_10091803 3300003203 Bacteria 915
4 rootL2_10093202 3300003322 Bacteria 4764
5 Ga0065715_10189178 3300005293 Bacteria 1426
6 Ga0070658_10006000 3300005327 Bacteria 9851
7 Ga0070676_10132305 3300005328 Bacteria 1579
8 Ga0070690_100138842 3300005330 Bacteria 1648
9 Ga0070670_100011491 3300005331 Bacteria 7574
10 Ga0068869_101019033 3300005334 Unclassified 721
11 Ga0070680_100064385 3300005336 Bacteria 3005
12 Ga0070682_100033779 3300005337 Bacteria 3110
13 Ga0070682_100508052 3300005337 Unclassified 935
14 Ga0070689_100019567 3300005340 Bacteria 5008
15 Ga0070661_100028535 3300005344 Bacteria 4025
16 Ga0070661_100558664 3300005344 Bacteria 922
17 Ga0070669_100313342 3300005353 Unclassified 1265
18 Ga0070675_100097353 3300005354 Bacteria 2474
19 Ga0070675_100234859 3300005354 Bacteria 1601
20 Ga0070671_100281778 3300005355 Unclassified 1414
21 Ga0070671_100381005 3300005355 Bacteria 1205
22 Ga0070674_100186314 3300005356 Bacteria 1593
23 Ga0070674_100585976 3300005356 Bacteria 940
24 Ga0070688_100022179 3300005365 Bacteria 3717
25 Ga0070659_100031351 3300005366 Unclassified 4117
26 Ga0070667_100077144 3300005367 Bacteria 2845
27 Ga0070700_100180661 3300005441 Bacteria 1468
28 Ga0070678_100193367 3300005456 Unclassified 1674
29 Ga0070681_10026509 3300005458 Bacteria 5825
30 Ga0070681_10044087 3300005458 Bacteria 4464
31 Ga0068867_100887357 3300005459 Unclassified 801
32 Ga0070685_10053508 3300005466 Unclassified 2339
33 Ga0070685_10197239 3300005466 Bacteria 1306
34 Ga0070679_100083298 3300005530 Bacteria 3187
35 Ga0070679_100486685 3300005530 Bacteria 1178
36 Ga0068853_100021980 3300005539 Bacteria 5321
37 Ga0068853_100033514 3300005539 Unclassified 4358
38 Ga0068853_100648524 3300005539 Unclassified 1005
39 Ga0070672_100024655 3300005543 Bacteria 4449
40 Ga0070672_100420506 3300005543 Bacteria 1148
41 Ga0070665_100295605 3300005548 Bacteria 1622
42 Ga0070704_100016037 3300005549 Bacteria 4724
43 Ga0068855_100029745 3300005563 Bacteria 6531
44 Ga0070664_100003239 3300005564 Bacteria 13157
45 Ga0070664_100146065 3300005564 Bacteria 2086
46 Ga0070664_100365283 3300005564 Bacteria 1315
47 Ga0068857_100009590 3300005577 Bacteria 8411
48 Ga0068857_100140683 3300005577 Bacteria 2181
49 Ga0068857_100170526 3300005577 Bacteria 1978
50 Ga0068852_100243500 3300005616 Bacteria 1720
51 Ga0068852_100310221 3300005616 Bacteria 1529
52 Ga0068859_100138060 3300005617 Bacteria 2511
53 Ga0068859_100972895 3300005617 Bacteria 931
54 Ga0068864_100354849 3300005618 Unclassified 1384
55 Ga0068864_100571179 3300005618 Bacteria 1095
56 Ga0068866_10712423 3300005718 Unclassified 689
57 Ga0068861_100265208 3300005719 Unclassified 1472
58 Ga0068861_100441425 3300005719 Bacteria 1164
59 Ga0068870_10505290 3300005840 Bacteria 806
60 Ga0068863_100036432 3300005841 Unclassified 4686
61 Ga0068863_100277306 3300005841 Bacteria 1624
62 Ga0068858_100171806 3300005842 Unclassified 2044
63 Ga0068860_100005827 3300005843 Bacteria 12400
64 Ga0068860_100661083 3300005843 Unclassified 1053
65 Ga0068862_100041667 3300005844 Unclassified 3908
66 Ga0068862_100495089 3300005844 Bacteria 1159
67 Ga0081539_10000660 3300005985 Bacteria 69312
68 Ga0097621_100631101 3300006237 Unclassified 981
69 Ga0068871_100046726 3300006358 Unclassified 3488
70 Ga0068871_100106059 3300006358 Bacteria 2359
71 Ga0097620_100138061 3300006931 Bacteria 2511
72 Ga0097620_100141783 3300006931 Unclassified 2477
73 Ga0097620_100972895 3300006931 Bacteria 931
74 Ga0111539_10222969 3300009094 Bacteria 2196
75 Ga0111539_10383457 3300009094 Unclassified 1637
76 Ga0105243_10030497 3300009148 Unclassified 4152
77 Ga0105243_10260832 3300009148 Unclassified 1551
78 Ga0105241_10036214 3300009174 Bacteria 3713
79 Ga0105242_10702365 3300009176 Unclassified 990
80 Ga0105248_10045389 3300009177 Bacteria 4928
81 Ga0105248_11027295 3300009177 Bacteria 931
82 Ga0105249_10011261 3300009553 Bacteria 7851
83 Ga0105249_10034666 3300009553 Bacteria 4574
84 Ga0105249_10040540 3300009553 Unclassified 4230
85 Ga0105249_10522144 3300009553 Unclassified 1235
86 Ga0105239_10012544 3300010375 Bacteria 9436
87 Ga0105239_10746837 3300010375 Unclassified 1120
88 Ga0105239_10939115 3300010375 Unclassified 993
89 Ga0157373_10014871 3300013100 Bacteria 5699
90 Ga0157373_10538738 3300013100 Unclassified 846
91 Ga0157369_10289721 3300013105 Bacteria 1705
92 Ga0157378_10081564 3300013297 Bacteria 2923
93 Ga0157378_10335613 3300013297 Bacteria 1472
94 Ga0157378_11395774 3300013297 Unclassified 743
95 Ga0163162_10024726 3300013306 Bacteria 5932
96 Ga0163162_10122270 3300013306 Unclassified 2708
97 Ga0163162_10158181 3300013306 Unclassified 2387
98 Ga0163162_10266431 3300013306 Bacteria 1845
99 Ga0163162_11207390 3300013306 Unclassified 858
100 Ga0157372_10024282 3300013307 Bacteria 6582
101 Ga0157372_10093099 3300013307 Unclassified 3429
102 Ga0157375_10095853 3300013308 Bacteria 3039
103 Ga0157375_10232942 3300013308 Bacteria 2001
104 Ga0157375_10499539 3300013308 Bacteria 1380
105 Ga0157375_11372534 3300013308 Unclassified 832
106 Ga0157380_10025118 3300014326 Bacteria 4516
107 Ga0157380_10751210 3300014326 Unclassified 987
108 Ga0157380_11968567 3300014326 Unclassified 646
109 Ga0157376_10366028 3300014969 Bacteria 1384
110 Ga0163161_10000410 3300017792 Bacteria 36003
111 Ga0163161_10338763 3300017792 Unclassified 1193
112 Ga0207656_10059695 3300025321 Bacteria 1670
113 Ga0207682_10152779 3300025893 Bacteria 1042
114 Ga0207645_10244619 3300025907 Unclassified 1186
115 Ga0207707_10112223 3300025912 Bacteria 2383
116 Ga0207707_10116635 3300025912 Bacteria 2333
117 Ga0207695_10622202 3300025913 Unclassified 961
118 Ga0207662_10340113 3300025918 Bacteria 1005
119 Ga0207649_10174542 3300025920 Bacteria 1500
120 Ga0207649_10478380 3300025920 Bacteria 944
121 Ga0207652_10006533 3300025921 Bacteria 9398
122 Ga0207652_10484959 3300025921 Bacteria 1113
123 Ga0207650_10063268 3300025925 Bacteria 2766
124 Ga0207644_10224282 3300025931 Unclassified 1491
125 Ga0207690_10057884 3300025932 Bacteria 2620
126 Ga0207709_10327927 3300025935 Unclassified 1148
127 Ga0207704_10265453 3300025938 Unclassified 1297
128 Ga0207691_10081127 3300025940 Bacteria 2916
129 Ga0207691_10306502 3300025940 Bacteria 1363
130 Ga0207711_10071377 3300025941 Bacteria 3013
131 Ga0207689_10899800 3300025942 Unclassified 747
132 Ga0207661_10532030 3300025944 Bacteria 1076
133 Ga0207679_10017627 3300025945 Bacteria 4767
134 Ga0207679_10278838 3300025945 Bacteria 1433
135 Ga0207679_10329019 3300025945 Bacteria 1325
136 Ga0207667_10048887 3300025949 Bacteria 4470
137 Ga0207651_10259504 3300025960 Unclassified 1426
138 Ga0207712_10310417 3300025961 Bacteria 1298
139 Ga0207712_10340899 3300025961 Unclassified 1243
140 Ga0207668_10039073 3300025972 Bacteria 3191
141 Ga0207658_10108216 3300025986 Bacteria 2192
142 Ga0207639_10012982 3300026041 Bacteria 5814
143 Ga0207639_10029424 3300026041 Bacteria 4021
144 Ga0207639_10119802 3300026041 Bacteria 2160
145 Ga0207708_10236504 3300026075 Bacteria 1468
146 Ga0207641_10033617 3300026088 Unclassified 4260
147 Ga0207641_10394051 3300026088 Bacteria 1328
148 Ga0207648_10011808 3300026089 Bacteria 8208
149 Ga0207648_10147073 3300026089 Unclassified 2079
150 Ga0207648_10827596 3300026089 Unclassified 863
151 Ga0207676_10031555 3300026095 Unclassified 3985
152 Ga0207676_10072811 3300026095 Unclassified 2763
153 Ga0207674_10012459 3300026116 Bacteria 9502
154 Ga0207674_10188376 3300026116 Bacteria 2013
155 Ga0207674_10369019 3300026116 Unclassified 1387
156 Ga0207674_10411397 3300026116 Bacteria 1307
157 Ga0207675_100337654 3300026118 Unclassified 1474
158 Ga0207675_100344425 3300026118 Unclassified 1459
159 Ga0207683_10945722 3300026121 Unclassified 800
160 Ga0209974_10029363 3300027876 Unclassified 1821
161 Ga0268266_10255525 3300028379 Bacteria 1622
162 Ga0268265_10189413 3300028380 Bacteria 1775
163 Ga0268265_10816919 3300028380 Bacteria 910
164 Ga0268264_11526882 3300028381 Unclassified 678
165 Ga0307408_100003399 3300031548 Bacteria 10919
166 Ga0307408_100214040 3300031548 Unclassified 1568
167 Ga0307408_101010900 3300031548 Bacteria 767
168 Ga0307405_10001061 3300031731 Bacteria 11147
169 Ga0307405_10006681 3300031731 Bacteria 5696
170 Ga0307405_10113104 3300031731 Bacteria 1843
171 Ga0307405_10161269 3300031731 Bacteria 1589
172 Ga0307413_10000509 3300031824 Bacteria 12815
173 Ga0307413_10000750 3300031824 Bacteria 11208
174 Ga0307413_10016908 3300031824 Unclassified 3785
175 Ga0307413_10192023 3300031824 Unclassified 1467
176 Ga0307413_10761877 3300031824 Unclassified 810
177 Ga0307410_10000472 3300031852 Bacteria 16305
178 Ga0307410_10004110 3300031852 Bacteria 7452
179 Ga0307410_10102516 3300031852 Bacteria 2053
180 Ga0307410_10110880 3300031852 Bacteria 1985
181 Ga0307410_10143733 3300031852 Bacteria 1768
182 Ga0307410_10363383 3300031852 Bacteria 1160
183 Ga0307406_10268062 3300031901 Bacteria 1296
184 Ga0307406_10291721 3300031901 Bacteria 1249
185 Ga0307407_10000153 3300031903 Bacteria 21222
186 Ga0307407_10002100 3300031903 Bacteria 7643
187 Ga0307407_10024957 3300031903 Bacteria 3144
188 Ga0307412_10039673 3300031911 Bacteria 3042
189 Ga0307412_10042085 3300031911 Unclassified 2965
190 Ga0307412_10052907 3300031911 Bacteria 2690
191 Ga0307412_10196395 3300031911 Bacteria 1529
192 Ga0307409_100051087 3300031995 Unclassified 3161
193 Ga0307409_100546136 3300031995 Bacteria 1137
194 Ga0307409_100970819 3300031995 Bacteria 866
195 Ga0307416_100002196 3300032002 Bacteria 11085
196 Ga0307416_100009996 3300032002 Bacteria 6245
197 Ga0307416_100197989 3300032002 Bacteria 1903
198 Ga0307414_10008287 3300032004 Bacteria 5885
199 Ga0307414_10026733 3300032004 Unclassified 3718
200 Ga0307414_10054375 3300032004 Bacteria 2798
201 Ga0307414_10178380 3300032004 Bacteria 1706
202 Ga0307411_10008433 3300032005 Bacteria 5339
203 Ga0307411_10027826 3300032005 Bacteria 3427
204 Ga0307411_10093620 3300032005 Unclassified 2104
205 Ga0307411_10196116 3300032005 Bacteria 1546
206 Ga0307411_10449193 3300032005 Unclassified 1078
207 Ga0307415_100013310 3300032126 Bacteria 4798
208 Ga0307415_100094170 3300032126 Unclassified 2177
209 Ga0307415_100583338 3300032126 Bacteria 992
210 Ga0395898_0330646 3300037466 Bacteria 1453
211 Ga0395905_0210630 3300037471 Bacteria 1821
212 Ga0395901_0626135 3300038443 Bacteria 1082
213 Ga0436365_1689327 3300039437 Bacteria 1286
214 Ga0439457_050792 3300042014 Unclassified 931
215 Ga0495632_0002938 3300046519 Bacteria 12506
216 Ga0495598_0006243 3300046537 Unclassified 2684
217 Ga0495621_0176839 3300046539 Unclassified 850
218 Ga0495668_0001862 3300046616 Bacteria 18937
219 Ga0501224_036681 3300049664 Bacteria 738
220 Ga0501235_108818 3300049669 Bacteria 684
221 Ga0501242_005073 3300049674 Bacteria 1473
222 Ga0501225_0034078 3300049705 Bacteria 1402
223 Ga0501234_040067 3300049707 Unclassified 766
224 Ga0501263_013318 3300049760 Unclassified 1041
225 Ga0501268_004097 3300049765 Unclassified 2038
226 Ga0500577_0003460 3300053142 Bacteria 4101
227 Ga0307408_100277507
228 LJQas_1000354
229 JGI25406J46586_10091803
230 rootL2_10093202
231 Ga0065715_10189178
232 Ga0070658_10006000
233 Ga0070676_10132305
234 Ga0070690_100138842
235 Ga0070670_100011491
236 Ga0068869_101019033
237 Ga0070680_100064385
238 Ga0070682_100033779
239 Ga0070682_100508052
240 Ga0070689_100019567
241 Ga0070661_100028535
242 Ga0070661_100558664
243 Ga0070669_100313342
244 Ga0070675_100097353
245 Ga0070675_100234859
246 Ga0070671_100281778
247 Ga0070671_100381005
248 Ga0070674_100186314
249 Ga0070674_100585976
250 Ga0070688_100022179
251 Ga0070659_100031351
252 Ga0070667_100077144
253 Ga0070700_100180661
254 Ga0070678_100193367
255 Ga0070681_10026509
256 Ga0070681_10044087
257 Ga0068867_100887357
258 Ga0070685_10053508
259 Ga0070685_10197239
260 Ga0070679_100083298
261 Ga0070679_100486685
262 Ga0068853_100021980
263 Ga0068853_100033514
264 Ga0068853_100648524
265 Ga0070672_100024655
266 Ga0070672_100420506
267 Ga0070665_100295605
268 Ga0070704_100016037
269 Ga0068855_100029745
270 Ga0070664_100003239
271 Ga0070664_100146065
272 Ga0070664_100365283
273 Ga0068857_100009590
274 Ga0068857_100140683
275 Ga0068857_100170526
276 Ga0068852_100243500
277 Ga0068852_100310221
278 Ga0068859_100138060
279 Ga0068859_100972895
280 Ga0068864_100354849
281 Ga0068864_100571179
282 Ga0068866_10712423
283 Ga0068861_100265208
284 Ga0068861_100441425
285 Ga0068870_10505290
286 Ga0068863_100036432
287 Ga0068863_100277306
288 Ga0068858_100171806
289 Ga0068860_100005827
290 Ga0068860_100661083
291 Ga0068862_100041667
292 Ga0068862_100495089
293 Ga0081539_10000660
294 Ga0097621_100631101
295 Ga0068871_100046726
296 Ga0068871_100106059
297 Ga0097620_100138061
298 Ga0097620_100141783
299 Ga0097620_100972895
300 Ga0111539_10222969
301 Ga0111539_10383457
302 Ga0105243_10030497
303 Ga0105243_10260832
304 Ga0105241_10036214
305 Ga0105242_10702365
306 Ga0105248_10045389
307 Ga0105248_11027295
308 Ga0105249_10011261
309 Ga0105249_10034666
310 Ga0105249_10040540
311 Ga0105249_10522144
312 Ga0105239_10012544
313 Ga0105239_10746837
314 Ga0105239_10939115
315 Ga0157373_10014871
316 Ga0157373_10538738
317 Ga0157369_10289721
318 Ga0157378_10081564
319 Ga0157378_10335613
320 Ga0157378_11395774
321 Ga0163162_10024726
322 Ga0163162_10122270
323 Ga0163162_10158181
324 Ga0163162_10266431
325 Ga0163162_11207390
326 Ga0157372_10024282
327 Ga0157372_10093099
328 Ga0157375_10095853
329 Ga0157375_10232942
330 Ga0157375_10499539
331 Ga0157375_11372534
332 Ga0157380_10025118
333 Ga0157380_10751210
334 Ga0157380_11968567
335 Ga0157376_10366028
336 Ga0163161_10000410
337 Ga0163161_10338763
338 Ga0207656_10059695
339 Ga0207682_10152779
340 Ga0207645_10244619
341 Ga0207707_10112223
342 Ga0207707_10116635
343 Ga0207695_10622202
344 Ga0207662_10340113
345 Ga0207649_10174542
346 Ga0207649_10478380
347 Ga0207652_10006533
348 Ga0207652_10484959
349 Ga0207650_10063268
350 Ga0207644_10224282
351 Ga0207690_10057884
352 Ga0207709_10327927
353 Ga0207704_10265453
354 Ga0207691_10081127
355 Ga0207691_10306502
356 Ga0207711_10071377
357 Ga0207689_10899800
358 Ga0207661_10532030
359 Ga0207679_10017627
360 Ga0207679_10278838
361 Ga0207679_10329019
362 Ga0207667_10048887
363 Ga0207651_10259504
364 Ga0207712_10310417
365 Ga0207712_10340899
366 Ga0207668_10039073
367 Ga0207658_10108216
368 Ga0207639_10012982
369 Ga0207639_10029424
370 Ga0207639_10119802
371 Ga0207708_10236504
372 Ga0207641_10033617
373 Ga0207641_10394051
374 Ga0207648_10011808
375 Ga0207648_10147073
376 Ga0207648_10827596
377 Ga0207676_10031555
378 Ga0207676_10072811
379 Ga0207674_10012459
380 Ga0207674_10188376
381 Ga0207674_10369019
382 Ga0207674_10411397
383 Ga0207675_100337654
384 Ga0207675_100344425
385 Ga0207683_10945722
386 Ga0209974_10029363
387 Ga0268266_10255525
388 Ga0268265_10189413
389 Ga0268265_10816919
390 Ga0268264_11526882
391 Ga0307408_100003399
392 Ga0307408_100214040
393 Ga0307408_101010900
394 Ga0307405_10001061
395 Ga0307405_10006681
396 Ga0307405_10113104
397 Ga0307405_10161269
398 Ga0307413_10000509
399 Ga0307413_10000750
400 Ga0307413_10016908
401 Ga0307413_10192023
402 Ga0307413_10761877
403 Ga0307410_10000472
404 Ga0307410_10004110
405 Ga0307410_10102516
406 Ga0307410_10110880
407 Ga0307410_10143733
408 Ga0307410_10363383
409 Ga0307406_10268062
410 Ga0307406_10291721
411 Ga0307407_10000153
412 Ga0307407_10002100
413 Ga0307407_10024957
414 Ga0307412_10039673
415 Ga0307412_10042085
416 Ga0307412_10052907
417 Ga0307412_10196395
418 Ga0307409_100051087
419 Ga0307409_100546136
420 Ga0307409_100970819
421 Ga0307416_100002196
422 Ga0307416_100009996
423 Ga0307416_100197989
424 Ga0307414_10008287
425 Ga0307414_10026733
426 Ga0307414_10054375
427 Ga0307414_10178380
428 Ga0307411_10008433
429 Ga0307411_10027826
430 Ga0307411_10093620
431 Ga0307411_10196116
432 Ga0307411_10449193
433 Ga0307415_100013310
434 Ga0307415_100094170
435 Ga0307415_100583338
436 Ga0395898_0330646
437 Ga0395905_0210630
438 Ga0395901_0626135
439 Ga0436365_1689327
440 Ga0439457_050792
441 Ga0495632_0002938
442 Ga0495598_0006243
443 Ga0495621_0176839
444 Ga0495668_0001862
445 Ga0501224_036681
446 Ga0501235_108818
447 Ga0501242_005073
448 Ga0501225_0034078
449 Ga0501234_040067
450 Ga0501263_013318
451 Ga0501268_004097
452 Ga0500577_0003460

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nce-assembly1.cif.gz_A crystal structure of the human foxn3 dna binding domain in complex with a forkhead dna sequence 0.4544 1 56
8e12-assembly1.cif.gz_A homotrimeric variant of tctrp9, bgl14 0.409 3 166
8e0o-assembly1.cif.gz_A heterotrimeric variant of tctrp9, hetbgl03-15-18 0.408 7 162
8e0o-assembly1.cif.gz_A heterotrimeric variant of tctrp9, hetbgl03-15-18 0.3859 7 162
8e0m-assembly1.cif.gz_B homotrimeric variant of tctrp9, bgl15 0.3704 3 162
ID Description Score Start End Superfamily
af_Q8VZI9_22_82_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.7172 2 56 1.10.10.60
af_Q8VZI9_22_82_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.6513 2 56 1.10.10.60
af_I1M9V5_29_89_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6205 2 56 1.20.1250.20
af_Q9LNC6_223_310_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5652 87 164 1.20.58.160
af_I1M9V5_29_89_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5635 2 56 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V9KGD7-F1-model_v4 Uncharacterized protein 0.9862 117 183
AF-A0A7X8UDE6-F1-model_v4 Uncharacterized protein 0.9749 77 185
AF-A0A7X2PKB7-F1-model_v4 Uncharacterized protein 0.9611 92 173
AF-A0A7W1GCV4-F1-model_v4 Uncharacterized protein 0.955 74 192
AF-A0A2V8QRP9-F1-model_v4 Uncharacterized protein 0.9426 83 192

Map