F338689

General Info

Members Datasets Scaffolds Average Seq Length
226 140 452 457

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100063408|Ga0068864_1000634083
Length 491
Sequence MSYGPLEPLRRNIGVRLSLWYALIFTLSSLALLTLAYYLLAAALSSKDREILESRLKEAAAVYVAGGVHALERWSQNQPAAVQHTLFVRVITRFNEVAFVSAPQDWLTVQDIPTADGVRREVGLYLRLPQNAERDFTRTAAMFPDGSVIQVGRMTNSRQALLDPVRRTFFTVGSATILLGFIAGAFFANRAMQPVRQIVSTARSIIRTGQLDARVPVRDSDDELDELVRLFNSLLEKNENLIRAMRESLDNVAHDLRTPLARLRGTAEVALQAGADSATSREALADCVEESERVLNMLNTLMDITEAEAGMMKLHREPVDLCQIANETADLYQYVAEEKHISVTTTCQPAQPAVTPPPGETHNVASVDRTRMKQVFANLLDNAIKYTPEGGRVAIEVGSDGKEASVVFRDSGIGIPADEQDKIWARLYRGDKSRSQRGLGLXLSLVKAVVEAHGGTVQVLSQPDQGSVFTVKLPASSSAFHPAETAAAGTR

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
67 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
68 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
69 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
82 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
83 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
86 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
87 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
133 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
138 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.54
Nodule 0
Rhizoplane 0.44
Rhizosphere 90.27
Stem 0
Stem Tuber 0
Unclassified 3.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100063408 3300005618 Bacteria 3203
2 rootH2_10095282 3300003320 Bacteria 13965
3 rootH2_10186354 3300003320 Bacteria 5567
4 rootL2_10110219 3300003322 Bacteria 3444
5 rootH1_10057360 3300003323 Bacteria 3843
6 rootH1_10148053 3300003323 Bacteria 3398
7 rootH1_10178131 3300003323 Bacteria 4702
8 rootH1_10256016 3300003323 Bacteria 2932
9 Ga0055530_10008418 3300003791 Bacteria 4137
10 Ga0070658_10011790 3300005327 Bacteria 7015
11 Ga0070658_10014493 3300005327 Bacteria 6327
12 Ga0070689_100014054 3300005340 Bacteria 5808
13 Ga0070689_100047848 3300005340 Bacteria 3297
14 Ga0070689_100234965 3300005340 Bacteria 1508
15 Ga0070668_100198217 3300005347 Bacteria 1647
16 Ga0070674_100096374 3300005356 Bacteria 2146
17 Ga0070714_100063983 3300005435 Bacteria 3165
18 Ga0070713_100063198 3300005436 Bacteria 3103
19 Ga0070694_100060049 3300005444 Bacteria 2592
20 Ga0070708_100185989 3300005445 Bacteria 1943
21 Ga0070681_10158635 3300005458 Bacteria 2186
22 Ga0070706_100001865 3300005467 Bacteria 21771
23 Ga0070706_100007870 3300005467 Bacteria 9961
24 Ga0070706_100068338 3300005467 Bacteria 3286
25 Ga0070707_100178223 3300005468 Bacteria 2072
26 Ga0070707_100278999 3300005468 Bacteria 1624
27 Ga0070698_100010009 3300005471 Bacteria 10131
28 Ga0070698_100013824 3300005471 Bacteria 8539
29 Ga0070686_100002585 3300005544 Bacteria 9983
30 Ga0070686_100014620 3300005544 Bacteria 4528
31 Ga0070695_100020383 3300005545 Bacteria 4049
32 Ga0070696_100000121 3300005546 Bacteria 40968
33 Ga0070704_100105697 3300005549 Bacteria 2132
34 Ga0068855_100000826 3300005563 Bacteria 38309
35 Ga0068855_100093085 3300005563 Bacteria 3476
36 Ga0068855_100281107 3300005563 Bacteria 1848
37 Ga0068857_100000867 3300005577 Bacteria 22747
38 Ga0068857_100094367 3300005577 Bacteria 2679
39 Ga0068857_100136849 3300005577 Bacteria 2212
40 Ga0068857_100162987 3300005577 Bacteria 2024
41 Ga0068856_100002715 3300005614 Bacteria 18137
42 Ga0068852_100088210 3300005616 Bacteria 2770
43 Ga0068859_100022877 3300005617 Bacteria 6267
44 Ga0068859_100052370 3300005617 Bacteria 4104
45 Ga0068859_100101784 3300005617 Bacteria 2930
46 Ga0068859_100199612 3300005617 Bacteria 2085
47 Ga0068861_100087781 3300005719 Bacteria 2448
48 Ga0068863_100032409 3300005841 Bacteria 4982
49 Ga0068863_100038437 3300005841 Bacteria 4553
50 Ga0068860_100086062 3300005843 Bacteria 2991
51 Ga0070717_10000751 3300006028 Bacteria 21164
52 Ga0075362_10000145 3300006177 Bacteria 19361
53 Ga0097621_100012132 3300006237 Bacteria 6376
54 Ga0075431_100090341 3300006847 Bacteria 3161
55 Ga0075431_100230353 3300006847 Bacteria 1888
56 Ga0075431_100231325 3300006847 Bacteria 1883
57 Ga0075433_10007991 3300006852 Bacteria 8421
58 Ga0075434_100001536 3300006871 Bacteria 19529
59 Ga0075429_100067185 3300006880 Bacteria 3120
60 Ga0075436_100166789 3300006914 Unclassified 1554
61 Ga0097620_100022878 3300006931 Bacteria 6267
62 Ga0097620_100052370 3300006931 Bacteria 4104
63 Ga0097620_100101791 3300006931 Bacteria 2930
64 Ga0097620_100199607 3300006931 Bacteria 2085
65 Ga0105240_10004004 3300009093 Bacteria 22704
66 Ga0111539_10074939 3300009094 Bacteria 3987
67 Ga0105238_10024866 3300009551 Bacteria 6103
68 Ga0157374_10052503 3300013296 Bacteria 3797
69 Ga0157372_10307183 3300013307 Bacteria 1846
70 Ga0157375_10001024 3300013308 Bacteria 24137
71 Ga0157375_10015705 3300013308 Bacteria 6783
72 Ga0163163_10000018 3300014325 Bacteria 199503
73 Ga0163163_10017084 3300014325 Bacteria 6759
74 Ga0213872_10010981 3300021361 Bacteria 4296
75 Ga0213872_10011871 3300021361 Unclassified 4113
76 Ga0213874_10007798 3300021377 Bacteria 2585
77 Ga0213876_10003976 3300021384 Bacteria 8338
78 Ga0209050_1000668 3300025298 Bacteria 52124
79 Ga0207705_10007177 3300025909 Bacteria 8208
80 Ga0207684_10001294 3300025910 Bacteria 27535
81 Ga0207707_10066234 3300025912 Bacteria 3146
82 Ga0207695_10022032 3300025913 Bacteria 7249
83 Ga0207695_10114816 3300025913 Bacteria 2667
84 Ga0207694_10012808 3300025924 Bacteria 6317
85 Ga0207687_10107612 3300025927 Bacteria 2063
86 Ga0207700_10050131 3300025928 Bacteria 3110
87 Ga0207700_10164338 3300025928 Bacteria 1846
88 Ga0207664_10011883 3300025929 Bacteria 6211
89 Ga0207670_10004794 3300025936 Bacteria 7341
90 Ga0207670_10026752 3300025936 Bacteria 3639
91 Ga0207711_10259665 3300025941 Bacteria 1596
92 Ga0207667_10154718 3300025949 Bacteria 2359
93 Ga0207667_10225246 3300025949 Bacteria 1921
94 Ga0207668_10172892 3300025972 Bacteria 1696
95 Ga0207702_10001489 3300026078 Bacteria 23183
96 Ga0207702_10059530 3300026078 Bacteria 3253
97 Ga0207674_10007655 3300026116 Bacteria 12579
98 Ga0207674_10071818 3300026116 Bacteria 3477
99 Ga0207674_10117646 3300026116 Bacteria 2628
100 Ga0207674_10159482 3300026116 Bacteria 2211
101 Ga0207698_10158814 3300026142 Bacteria 1974
102 Ga0268264_10046282 3300028381 Bacteria 3613
103 Ga0265319_1000531 3300028563 Bacteria 26056
104 Ga0265334_10007385 3300028573 Bacteria 4713
105 Ga0265323_10001064 3300028653 Bacteria 14212
106 Ga0265323_10006117 3300028653 Bacteria 5082
107 Ga0265323_10015566 3300028653 Bacteria 2989
108 Ga0265322_10006656 3300028654 Bacteria 3395
109 Ga0265338_10000140 3300028800 Bacteria 133666
110 Ga0265338_10012788 3300028800 Bacteria 9545
111 Ga0265338_10029082 3300028800 Bacteria 5491
112 Ga0265338_10065263 3300028800 Bacteria 3159
113 Ga0265324_10023515 3300029957 Bacteria 2194
114 Ga0265330_10023906 3300031235 Bacteria 2772
115 Ga0265329_10006101 3300031242 Bacteria 4809
116 Ga0265340_10003845 3300031247 Bacteria 8465
117 Ga0265340_10009730 3300031247 Bacteria 5153
118 Ga0265339_10057474 3300031249 Bacteria 2104
119 Ga0265327_10000538 3300031251 Bacteria 64869
120 Ga0265316_10011935 3300031344 Bacteria 7810
121 Ga0265316_10082713 3300031344 Bacteria 2460
122 Ga0265316_10146169 3300031344 Bacteria 1773
123 Ga0307408_100010298 3300031548 Bacteria 6165
124 Ga0265313_10000392 3300031595 Bacteria 47135
125 Ga0265313_10004941 3300031595 Bacteria 9982
126 Ga0265314_10000140 3300031711 Bacteria 108620
127 Ga0265314_10112435 3300031711 Bacteria 1728
128 Ga0265342_10004403 3300031712 Bacteria 11113
129 Ga0265342_10013682 3300031712 Bacteria 5424
130 Ga0316576_10044950 3300031727 Unclassified 3192
131 Ga0316578_10070506 3300031728 Bacteria 2069
132 Ga0307416_100006556 3300032002 Bacteria 7299
133 Ga0307416_100076221 3300032002 Bacteria 2810
134 Ga0373944_0020202 3300035089 Bacteria 1916
135 Ga0373951_0007798 3300035091 Bacteria 2428
136 Ga0373954_0008893 3300035118 Bacteria 4419
137 Ga0373956_0011149 3300035119 Bacteria 3701
138 Ga0373937_0013789 3300036401 Bacteria 7122
139 Ga0373937_0022259 3300036401 Bacteria 5697
140 Ga0373937_0150788 3300036401 Bacteria 2178
141 Ga0373937_0151605 3300036401 Bacteria 2172
142 Ga0316582_0156423 3300036647 Bacteria 1543
143 Ga0316584_0033286 3300036712 Unclassified 3818
144 Ga0373925_0040435 3300037068 Bacteria 3452
145 Ga0373925_0139366 3300037068 Unclassified 1897
146 Ga0436365_1363082 3300039437 Bacteria 5048
147 Ga0436365_1582546 3300039437 Bacteria 17220
148 Ga0436360_0042988 3300039438 Bacteria 1875
149 Ga0436360_0275722 3300039438 Unclassified 2389
150 Ga0436360_0286394 3300039438 Bacteria 3923
151 Ga0436361_0286051 3300039447 Bacteria 2020
152 Ga0436361_0910002 3300039447 Bacteria 19282
153 Ga0436363_0484149 3300039450 Bacteria 6113
154 Ga0436362_0371015 3300039453 Bacteria 3629
155 Ga0451577_0001641 3300042876 Bacteria 28964
156 Ga0451577_0013572 3300042876 Bacteria 7618
157 Ga0451577_0083896 3300042876 Bacteria 2843
158 Ga0451577_0203382 3300042876 Bacteria 1788
159 Ga0466969_0026327 3300044656 Bacteria 2983
160 Ga0453683_0008713 3300044673 Bacteria 6801
161 Ga0466966_0106859 3300044684 Bacteria 1727
162 Ga0453684_0006457 3300044712 Bacteria 22262
163 Ga0453684_0012907 3300044712 Bacteria 13686
164 Ga0453684_0070481 3300044712 Bacteria 4427
165 Ga0466959_0050029 3300045049 Bacteria 3070
166 Ga0451576_0013714 3300045051 Bacteria 9055
167 Ga0451576_0031500 3300045051 Bacteria 5652
168 Ga0451576_0041615 3300045051 Bacteria 4857
169 Ga0451576_0057979 3300045051 Unclassified 4048
170 Ga0451576_0137765 3300045051 Bacteria 2546
171 Ga0451576_0227589 3300045051 Bacteria 1947
172 Ga0451576_0249523 3300045051 Unclassified 1855
173 Ga0451576_0264460 3300045051 Bacteria 1798
174 Ga0451576_0272212 3300045051 Bacteria 1770
175 Ga0466967_0057040 3300045976 Bacteria 3446
176 Ga0495592_0000221 3300046454 Bacteria 49044
177 Ga0495582_0015879 3300046473 Bacteria 4129
178 Ga0495582_0094386 3300046473 Bacteria 1670
179 Ga0495662_0013248 3300046476 Bacteria 4014
180 Ga0495618_0003088 3300046514 Bacteria 10504
181 Ga0495618_0089352 3300046514 Bacteria 1970
182 Ga0495628_0000256 3300046516 Bacteria 47095
183 Ga0495628_0086993 3300046516 Bacteria 2423
184 Ga0495630_0000063 3300046517 Bacteria 85919
185 Ga0495630_0223390 3300046517 Bacteria 1438
186 Ga0495666_0010158 3300046526 Bacteria 4696
187 Ga0495640_0069072 3300046533 Bacteria 2377
188 Ga0495586_0000009 3300046535 Bacteria 144639
189 Ga0495586_0001242 3300046535 Bacteria 14305
190 Ga0495586_0001954 3300046535 Bacteria 11243
191 Ga0495645_0057861 3300046543 Bacteria 2813
192 Ga0495667_0163275 3300046559 Unclassified 1432
193 Ga0495634_0001352 3300046642 Bacteria 22321
194 Ga0495634_0104489 3300046642 Bacteria 1827
195 Ga0495599_0013642 3300046678 Bacteria 5021
196 Ga0495647_0013994 3300046681 Bacteria 2789
197 Ga0495647_0021971 3300046681 Bacteria 2303
198 Ga0495658_0004100 3300046683 Bacteria 7178
199 Ga0495658_0021354 3300046683 Bacteria 3412
200 Ga0495613_0019883 3300046689 Bacteria 5004
201 Ga0495613_0024325 3300046689 Bacteria 4512
202 Ga0495613_0101147 3300046689 Bacteria 2081
203 Ga0495624_0026421 3300046690 Bacteria 3805
204 Ga0495674_0000451 3300047319 Bacteria 37104
205 Ga0495674_0011305 3300047319 Bacteria 8426
206 Ga0495674_0032292 3300047319 Bacteria 4749
207 Ga0495676_0004825 3300047321 Bacteria 12365
208 Ga0495676_0101073 3300047321 Bacteria 2134
209 Ga0495680_0004803 3300047322 Bacteria 12829
210 Ga0495675_0105779 3300047444 Bacteria 1759
211 Ga0495684_0052919 3300047471 Bacteria 3098
212 Ga0495684_0087224 3300047471 Bacteria 2365
213 Ga0496115_0071042 3300048918 Bacteria 2823
214 Ga0501047_0023192 3300049581 Bacteria 5959
215 Ga0501080_0083882 3300049742 Bacteria 2961
216 Ga0501083_0109786 3300049744 Bacteria 1814
217 nmdc:mga03683_147_c1 3300050489 Bacteria 24092
218 nmdc:mga07m45_6988_c1 3300050496 Bacteria 5741
219 nmdc:mga09592_35712_c1 3300050508 Bacteria 4161
220 nmdc:mga06r32_107322_c1 3300050510 Bacteria 2744
221 nmdc:mga06r32_173062_c1 3300050510 Bacteria 2143
222 nmdc:mga0n895_27790_c1 3300050512 Bacteria 5377
223 Ga0500555_000293 3300053103 Bacteria 21619
224 Ga0500556_0000243 3300053104 Bacteria 44193
225 Ga0500616_0002815 3300053153 Bacteria 13986
226 2788437608 2786546940 Bacteria 6396474
227 Ga0068864_100063408
228 rootH2_10095282
229 rootH2_10186354
230 rootL2_10110219
231 rootH1_10057360
232 rootH1_10148053
233 rootH1_10178131
234 rootH1_10256016
235 Ga0055530_10008418
236 Ga0070658_10011790
237 Ga0070658_10014493
238 Ga0070689_100014054
239 Ga0070689_100047848
240 Ga0070689_100234965
241 Ga0070668_100198217
242 Ga0070674_100096374
243 Ga0070714_100063983
244 Ga0070713_100063198
245 Ga0070694_100060049
246 Ga0070708_100185989
247 Ga0070681_10158635
248 Ga0070706_100001865
249 Ga0070706_100007870
250 Ga0070706_100068338
251 Ga0070707_100178223
252 Ga0070707_100278999
253 Ga0070698_100010009
254 Ga0070698_100013824
255 Ga0070686_100002585
256 Ga0070686_100014620
257 Ga0070695_100020383
258 Ga0070696_100000121
259 Ga0070704_100105697
260 Ga0068855_100000826
261 Ga0068855_100093085
262 Ga0068855_100281107
263 Ga0068857_100000867
264 Ga0068857_100094367
265 Ga0068857_100136849
266 Ga0068857_100162987
267 Ga0068856_100002715
268 Ga0068852_100088210
269 Ga0068859_100022877
270 Ga0068859_100052370
271 Ga0068859_100101784
272 Ga0068859_100199612
273 Ga0068861_100087781
274 Ga0068863_100032409
275 Ga0068863_100038437
276 Ga0068860_100086062
277 Ga0070717_10000751
278 Ga0075362_10000145
279 Ga0097621_100012132
280 Ga0075431_100090341
281 Ga0075431_100230353
282 Ga0075431_100231325
283 Ga0075433_10007991
284 Ga0075434_100001536
285 Ga0075429_100067185
286 Ga0075436_100166789
287 Ga0097620_100022878
288 Ga0097620_100052370
289 Ga0097620_100101791
290 Ga0097620_100199607
291 Ga0105240_10004004
292 Ga0111539_10074939
293 Ga0105238_10024866
294 Ga0157374_10052503
295 Ga0157372_10307183
296 Ga0157375_10001024
297 Ga0157375_10015705
298 Ga0163163_10000018
299 Ga0163163_10017084
300 Ga0213872_10010981
301 Ga0213872_10011871
302 Ga0213874_10007798
303 Ga0213876_10003976
304 Ga0209050_1000668
305 Ga0207705_10007177
306 Ga0207684_10001294
307 Ga0207707_10066234
308 Ga0207695_10022032
309 Ga0207695_10114816
310 Ga0207694_10012808
311 Ga0207687_10107612
312 Ga0207700_10050131
313 Ga0207700_10164338
314 Ga0207664_10011883
315 Ga0207670_10004794
316 Ga0207670_10026752
317 Ga0207711_10259665
318 Ga0207667_10154718
319 Ga0207667_10225246
320 Ga0207668_10172892
321 Ga0207702_10001489
322 Ga0207702_10059530
323 Ga0207674_10007655
324 Ga0207674_10071818
325 Ga0207674_10117646
326 Ga0207674_10159482
327 Ga0207698_10158814
328 Ga0268264_10046282
329 Ga0265319_1000531
330 Ga0265334_10007385
331 Ga0265323_10001064
332 Ga0265323_10006117
333 Ga0265323_10015566
334 Ga0265322_10006656
335 Ga0265338_10000140
336 Ga0265338_10012788
337 Ga0265338_10029082
338 Ga0265338_10065263
339 Ga0265324_10023515
340 Ga0265330_10023906
341 Ga0265329_10006101
342 Ga0265340_10003845
343 Ga0265340_10009730
344 Ga0265339_10057474
345 Ga0265327_10000538
346 Ga0265316_10011935
347 Ga0265316_10082713
348 Ga0265316_10146169
349 Ga0307408_100010298
350 Ga0265313_10000392
351 Ga0265313_10004941
352 Ga0265314_10000140
353 Ga0265314_10112435
354 Ga0265342_10004403
355 Ga0265342_10013682
356 Ga0316576_10044950
357 Ga0316578_10070506
358 Ga0307416_100006556
359 Ga0307416_100076221
360 Ga0373944_0020202
361 Ga0373951_0007798
362 Ga0373954_0008893
363 Ga0373956_0011149
364 Ga0373937_0013789
365 Ga0373937_0022259
366 Ga0373937_0150788
367 Ga0373937_0151605
368 Ga0316582_0156423
369 Ga0316584_0033286
370 Ga0373925_0040435
371 Ga0373925_0139366
372 Ga0436365_1363082
373 Ga0436365_1582546
374 Ga0436360_0042988
375 Ga0436360_0275722
376 Ga0436360_0286394
377 Ga0436361_0286051
378 Ga0436361_0910002
379 Ga0436363_0484149
380 Ga0436362_0371015
381 Ga0451577_0001641
382 Ga0451577_0013572
383 Ga0451577_0083896
384 Ga0451577_0203382
385 Ga0466969_0026327
386 Ga0453683_0008713
387 Ga0466966_0106859
388 Ga0453684_0006457
389 Ga0453684_0012907
390 Ga0453684_0070481
391 Ga0466959_0050029
392 Ga0451576_0013714
393 Ga0451576_0031500
394 Ga0451576_0041615
395 Ga0451576_0057979
396 Ga0451576_0137765
397 Ga0451576_0227589
398 Ga0451576_0249523
399 Ga0451576_0264460
400 Ga0451576_0272212
401 Ga0466967_0057040
402 Ga0495592_0000221
403 Ga0495582_0015879
404 Ga0495582_0094386
405 Ga0495662_0013248
406 Ga0495618_0003088
407 Ga0495618_0089352
408 Ga0495628_0000256
409 Ga0495628_0086993
410 Ga0495630_0000063
411 Ga0495630_0223390
412 Ga0495666_0010158
413 Ga0495640_0069072
414 Ga0495586_0000009
415 Ga0495586_0001242
416 Ga0495586_0001954
417 Ga0495645_0057861
418 Ga0495667_0163275
419 Ga0495634_0001352
420 Ga0495634_0104489
421 Ga0495599_0013642
422 Ga0495647_0013994
423 Ga0495647_0021971
424 Ga0495658_0004100
425 Ga0495658_0021354
426 Ga0495613_0019883
427 Ga0495613_0024325
428 Ga0495613_0101147
429 Ga0495624_0026421
430 Ga0495674_0000451
431 Ga0495674_0011305
432 Ga0495674_0032292
433 Ga0495676_0004825
434 Ga0495676_0101073
435 Ga0495680_0004803
436 Ga0495675_0105779
437 Ga0495684_0052919
438 Ga0495684_0087224
439 Ga0496115_0071042
440 Ga0501047_0023192
441 Ga0501080_0083882
442 Ga0501083_0109786
443 nmdc:mga03683_147_c1
444 nmdc:mga07m45_6988_c1
445 nmdc:mga09592_35712_c1
446 nmdc:mga06r32_107322_c1
447 nmdc:mga06r32_173062_c1
448 nmdc:mga0n895_27790_c1
449 Ga0500555_000293
450 Ga0500556_0000243
451 Ga0500616_0002815
452 2788437608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

367

477

0.97

PF00512

HisKA

His Kinase A (phospho-acceptor) domain

244

310

0.93

PF00672

HAMP

HAMP domain

186

240

0.93

Map